kiC Player: ludeguy Game: DCSS trunk Server: crawl.dcss.io Filename: 2026-01-17.16:13:15.ttyrec Time: (1768666395) Sat Jan 17 16:13:15 2026 ki [?1051l[?1052l[?1060l[?1061hki V)0[?7h[?25l[?1ckikiki}Welcome, ludeguy. Please select your species. SimpleIntermediateAdvanced a - Gnollj - Humans - Coglin b - Minotaurk - Koboldt - Vine Stalker c - Merfolkl - Revenantu - Poltergeist d - Gargoylem - Demonspawnv - Demigod e - Mountain Dwarfn - Djinniw - Formicid f - Draconiano - Sprigganx - Naga g - Trollp - Tenguy - Octopode h - Deep Elfq - Oniz - Felid i - Armataurr - BarachiA - Mummy Octopodes are a species of amphibious cephalopods. They can wear eight rings, but almost no armour fits them. + - Recommended species * - Random species # - Recommended character ! - Random character % - List aptitudesSpace - Pick background first ? - Help Tab - Octopode Shapeshifter2ki2ki2kil/Welcome, ludeguy the Octopode. Please select your background. WarriorAdventurerMage a - Fighteri - Artificerq - Hedge Wizard b - Gladiatorj - Shapeshifter  r - Conjurer c - Monkk - Wanderers - Summoner d - Hunterl - Delvert - Necromancer 2kihke - BrigandWarrior-mageu - Forgewright Zealotm - Warperv - Fire Elementalist f - Berserkern - Hexslingerw - Ice Elementalist g - Cinder Acolyteo - Enchanterx - Air Elementalist h - Chaos Knightp - Reavery - Earth Elementalistz - Alchemist Shapeshifters use talismans to shift their form, making them powerful melee fighters (especially when unarmed) at the cost of armour. + - Recommended background * - Random background # - Recommended character ! - Random character % - List aptitudesSpace - Change species ? - Help2ki3 Tab - Octopode Shapeshifter9kiT 9ki19kieludeguy the ApothecaryOctopodeHealth: 11/11 ========================Magic: 3/3========================AC: 1Str: 7EV: 12Int: 17SH: 0Dex: 12XL:  1 Next:  0% Place: Dungeon:1Noise: ---------  Time: 0.0 (0.0)-) TentaclesCast: Poisonous Vapours9ki5 ####.######.......####.........####...........###.............##.....$.......##.............##......@......##.............##.............##.............###...........##9ki ##.........####.:.....######.####9ki9ki8Welcome, ludeguy the Octopode Alchemist.Will you be the one to retrieve the fabled Orb of Zot from the depths?9ki9kiPress ? for a list of commands and other information.  Found 5 gold pieces and a parchment of Sigil of Binding.9ki 9ki [ _Found a staircase leading out of the dungeon.:ki:kiQ:ki~:kiu:kix:ki: _:kiG:ki,:ki:ki,:ki:kiT8 _You now have 5 gold pieces.:kin:ki:ki:ki:ki:ki9:kib:ki:ki :ki  :kim :kif :kiX ,:kip :ki :ki :ki :ki/ :ki :ki :ki :ki :ki< :kiA ,:ki| :kiv :kiO :ki :ki :ki#% + #.............##.............##......<......# #.............# #.............# #.......# ##.....## ##...# #### ####.####  ..#  .#.. #...$ :ki% . ... ##  You pick up a parchment of Sigil of Binding and begin reading...:ki+ 011.0 (11.0):ki+ ,2.0 (12:ki0 :ki3 I _You add the spell Sigil of Binding to your library.:kit 3:ki :ki :ki :ki B:kif :ki :ki :ki} :kiR ,:ki :ki4 :ki ,:ki. :kiC :kiK :ki} :ki :ki :ki ,:kiZ :kiP :ki0 ,:ki :ki ,:ki :ki L _You now have 12 gold pieces (gained 7).:ki :ki  :ki :ki :ki ,:ki3 :kiT :ki #......<......# #.............# #. :ki #.............##.. #.............#..# :ki ##...........##..# ##.........## ..# :ki9 ##.......## ..# ####.#######..## :kib #...#....@.$.# 2:ki V0.....#.#.........# ...#..#........### ##...#........#...#.##.#####.##:ki (#..... #.# .##..... #.# %#:kib #.... ... .#.... #.#:kiB# :ki# ,3.0 (11:ki5- :ki- . _Found a riddle talisman.:ki@3:kil :ki :kiV :ki :kio,:ki:ki:ki:ki:ki:ki:kiL _You now have 20 gold pieces (gained 8).:ki{3:ki:kiU:ki!:kif!:kiZ":ki#:ki%,:ki':ki(:ki*:ki*:ki ,:ki]-:ki/:ki@/:ki0:ki2:kib5%  :ki5DYou encounter a hobgoblin.:kiu;;#.......## #..# ####.#######..##  #...#........#  :ki;.....#.#.........#  ...#..#.#.#  ## ##...#........# ...#.##.#####.## :ki;#..... #.# #.# #..... #.# #@# :ki <#.... ....g.?.# . #.####### :kip<Poisonous Vapours #.#  g   hobgoblin (asleep) :kiWC231.0 (8.0):ki D22.0 (9 _:kiI:kiLU _You see here a riddle talisman.;kiث;ki;ki%;ki.` _A hobgoblin is nearby!;ki .gPoisonous fumes billow around the hobgoblin!  The hobgoblin is poisoned.;kilg  poisoned);ki_]2--------====;ki$3.0 (1;kiO;ki~+ _The hobgoblin shouts!;ki&^ .gPoisonous fumes billow around the hobgoblin!;kiB E very poisoned)1----------------=---4 _The hobgoblin looks even sicker.;ki_ ?Poisonous fumes billow around the hobgoblin!;kie' ;kiwi0----------------2---5Poisonous Vapours;kin;kirM _You kill the hobgoblin!kir>kiS>ki  ##.......## #..#ludeguy the Apothecary####.#######..##Octopode#...#........#Health: 11/11 ========================.....#.#.........#Magic: 0/3------------------------...#..#........#.#AC: 1Str: 7  ## ##...#........#EV: 12Int: 17>ki3...#.##.#####.##SH: 0Dex: 12#..... #.# #.#XL:  1 Next: 20% Place: Dungeon:1#..... #.# #@#Noise: =--------  Time: 35.0 (0.0)#.... ......?.#-) Tentacles.... #.#######Cast: Poisonous Vapours>kiM@#.#The hobgoblin is poisoned. >kiew_The hobgoblin shouts!  Poisonous fumes billow around the hobgoblin! _The hobgoblin looks even sicker.  >kiwjPoisonous fumes billow around the hobgoblin! _You kill the hobgoblin!>kiP  Okay, then.>ki<>ki>ki. _?ki'?kibPotions: (Left/Right to switch category) Potions (go to first with !) ?ki@ g - a potion of magic?ki?kiY?kiD ##.......## #..#ludeguy the Apothecary####.#######..##Octopode#...#........#Health: 11/11 ========================.....#.#.........#Magic: 0/3------------------------...#..#........#.#AC: 1?ki!Str: 7  ## ##...#........#EV: 12Int: 17...#.##.#####.##SH: 0Dex: 12#..... #.# #.#?kiRXL:  1 Next: 20% Place: Dungeon:1#..... #.# #@#Noise: =--------  Time: 35.0 (0.0)#.... ......?.#-) Tentacles.... #.#######Cast: Poisonous Vapours#.# _The hobgoblin shouts!  Poisonous fumes billow around the hobgoblin! _The hobgoblin looks even sicker.  Poisonous fumes billow around the hobgoblin! _You kill the hobgoblin! _Okay, then.?ki?kih?kiU?kio?kik ?kil tDrink which item? Potions ?kil  g - a potion of magic[?] describe selected@ki e@kii@ki"u ##.......## #..#ludeguy the Apothecary####.#######..##Octopode#...#........#Health: 11/11 ========================.....#.#.........#Magic: 0/3------------------------...#..#........#.#AC: 1Str: 7  ## ##...#........#EV: 12Int: 17...#.##.#####.##SH: 0Dex: 12#..... #.# #.#XL:  1 Next: 20% Place: Dungeon:1#..... #.# #@#Noise: =--------  Time: 35.0 (0.0)#.... ......?.#-) Tentacles.... #.#######Cast: Poisonous Vapours#.# _The hobgoblin shouts!  Po@kiu8isonous fumes billow around the hobgoblin! _The hobgoblin looks even sicker.  Poisonous fumes billow around the hobgoblin! _You kill the hobgoblin! _Okay, then.  Okay, then.@kix@kiz@ki|. _Aki[WAkiVXPotions: (Left/Right to switch category) Potions (go to first with !)  g - a potion of magicBki Bki: Bki@  ##.......## #..#ludeguy the Apothecary####.#######..##OctopodeBki #...#........#Health: 11/11 ========================.....#.#.........#Magic: 0/3------------------------...#..#........#.#AC: 1Bki: !Str: 7  ## ##...#........#EV: 12Int: 17...#.##.#####.##SH: 0Dex: 12#..... #.# #.#Bki XL:  1 Next: 20% Place: Dungeon:1#..... #.# #@#Noise: =--------  Time: 35.0 (0.0)#.... ......?.#-) TentaclesBki c.... #.#######Cast: Poisonous Vapours#.#Poisonous fumes billow around the hobgoblin! _The hobgoblin looks even sicker.  Poisonous fumes billow around the hobgoblin! _You kill the hobgoblin! Bki+ \_Okay, then. _Okay, then.Bki Bki BkiG Bki< Cki e  You aren't carrying any scrolls.CkirCkiCki. _DkiGDkitDrink which item? Potions Dki g - a potion of magic[?] describe selectedDki Dki-  ##.......## #..#ludeguy the Apothecary####.#######..##OctopodeDkiμ #...#........#Health: 11/11 ========================.....#.#.........#Magic: 0/3------------------------...#..#........#.#AC: 1Str: 7  ## ##...#........#EV: 12Dki Int: 17...#.##.#####.##SH: 0Dex: 12Dki- h#..... #.# #.#XL:  1 Next: 20% Place: Dungeon:1#..... #.# #@#Dki\ Noise: =--------  Time: 35.0 (0.0)#.... ......?.#Dki -) Tentacles.... #.#######Cast: Poisonous Vapours#.# _The hobgoblin looks even sicker.  Poisonous fumes billow around the hobgoblin! _You kill the hobgoblin! _Okay, then. _Okay, then. _You aren't carrying any scrolls.Dki P  Okay, then.Dki DkiP DkiQ . _EkiEkiPotions: (Left/Right to switch category) Potions (go to first with !)  g - a potion of magicEkizEkimEkiv ##.......## #..#ludeguy the Apothecary####.#######..##Octopode#...#........#Eki=Health: 11/11 ========================.....#.#.........#Magic: 0/3------------------------...#..#........#.#AC: 1Ekig,Str: 7  EkiS## ##...#........#EV: 12Int: 17...#.##.#####.##SH: 0EkiDex: 12#..... #.# #.#XL:  1 Next: 20% Place: Dungeon:1#..... #.# #@#Noise: =--------  Time: 35.0 (0.0)#.... ......?.#-) TentaclesEki:.... #.#######Cast: Poisonous Vapours#.#EkibPoisonous fumes billow around the hobgoblin! _You kill the hobgoblin! _Okay, then. Eki_Okay, then. _You aren't carrying any scrolls. _Okay, then.EkiEkiEki,Eki EkiA5  ####.#######..## #...#........  EkiZ6 .....#.#.........##..#........#.### ##...#..  ...#.##.#####.##..... #.# #.# #.#####% ......? #.###### #.# Eki< Eki< 1-6.0 (1 Eki= _EkiY@ 8%EkiA Fki-&& ####.#..## #...#........# .....#.#.........# ...#..#..#.# ## ##...#........# ...#.##.#####.##Fki&P #..... #.# #.# #......#.#####%# #.....@.# .... .#.# #.#Fki,Fki,!-Fki-7Fki18%Fki8Fki9+8.0 (2Fki<8%Fkir?c _c - a scroll labelled ALYSTR OFUYMYFki"t 3Fkit Fkiu Fkiy nFkiGz Fkitz Fkiz Fki{ ,Fki| Fki| ,Fki } Fki} Fki} Fki~ Fki~ Fki~ Z1========Fkie Fki" FkiL Fki FkiL Fkis FkiɁ Fkix Fki Fki Fki Fki @========Fki Fki Fki Fki Fki Fki Fki` Fki Fki5 Fki FkiB Fkii Fki Fkil Fki Fki Fki Fki΋ Fki$ FkiҌ Fki FkiP Fki Fki2 T2========Fki FkiN Fkir Fkȉ Fki Fki Fki= Fki Fkiϒ Fki Fki Fkih @========Fki Fkiޗ Fki Fkid Fki FkiE Fki Fki` Fki FkiК Fkiӛ Fki FkiE Fki Fki' Fki Fki4 Fki_ Fki Fkia Fki Fki Fki Fki Fki Fki$ FkiS T3========Fki Fki} 4 _Magic restored.Fki Fki FkiC FkiH Fki Fki) Fki Fki Fki= Fkie Fki Fki Fki۬ Fki @========Fki Fkic Fki% Fki] Fki Fki Fki Fki Fki Fki Fkib Fki Fki FkiU FkiV Fki Fki Fki Fki۽ Fki FkiV Fki- Fki Fki8 Fki Fki Fki] Fki Fki Fkio Fki Fki Fki FkiM Fkiu ,Fki Fki Fki^ Fki Fki Fki Fki Fki Fki Fki Fki8 Fki Fki~ Fkiw Fki ,FkiF Fki1 Fki  You encounter a kobold. It is wielding a +0 dagger and quivering stones.Fki  #.............##.. #.............#..# # ##...........##..# ##. ##.........###..# #... ##.......## #..# #...#######.#######..## #........#...#........#Fki  ##.........#.#.........# K..#........#.# ########.##...#........#........#.##.#####.###.#####......#.# #.#FkiB #......#.#####%##..............# K   kobold (missile, asleep)#......#.#######Fki #....#.#.##....#.#.#Fki X.K87.0 (49.0)Fki NK)Fki &==Fki 8.0 (50Fki ;%Fki ( _The kobold shouts!Hki#.#..# # ###..# ##.###..# #..## #..# #...#######.#######..##........#...#........# ##..#.#..# .K.#..#..#.# ########@##...#.# .........#.##.#####.## #.#####......#.# #.#  #......#.#####%##..............##......#.####### #....#.#.##....#.#.# Hki Hki9((((((Hki......9/11 ------9.0 (1.0)Hki^9%HkiD _The kobold throws a stone. The stone hits you.Hki# ###..# ##.###..# #..## #..# #...#######.#######..##........#...#........# ##.........#.#...# .K.......#..#........#.# ########.##...#.# HkiY.......@.#.##.#####.## #.#####......#.# #.#  #......#.#####%# #........##......#.#######HkiY#....#.#.# #....#.#.# Hki?HkiP--90Hki6%HkipHkiN##.###..# #.....## #..# #...#######.#######..#Hkir;#........#...#........# ##.........#.#.........# .K.......#..#........#.# ########.##...#........# .........#.##.#####.## #.#####..@...#.# #.#  #......#.#####%# #........# #......#.########....#.#.##....#.#.##....#.#.##....#.#.##......#.#HkiHkin10/11==----1Hki;9%HkiHkiqL #..## #..# #...#######.#######..##........#...#........# ##.........#.#.........# .K.#..#........#.# ########.##...#........# Hki0M .........#.##.#####.## #.#####......#.# #.#  #...@..#.#####%# #........# #......#.####### #....#.#.##....#.#.# #......#.##.#####HkicM ##.#HkiS HkibT &2Hki`W HkiY Hki #...#######.#######..##........#...#........# ##.#.#.........# .K.#..#........#.# ########.##...#..# .........#.##.#####.## #.#####......#.# #.#  #......#.#####%# #........# #......#.####### #....#.#.# #....#.#.##....#.#.##....#.#.##......#.##.######.##. ..#HkiF Hki &3Hki 8%Hki Iki#........#...#........# ##..#.#..# .K.#..#..#.# Iki*X########.##...#.# .........#.##.#####.## #.#####......#.# #.#  #......#.#####%# #........# #.....@#.####### #....#.#.# #....#.#.# #....#.#.##....#.#.##....IkiWA.#.##.######.##. ..### #.#Iki0KIki~K   kobold (missile)4IkiͪIki Iki QIki]2IkiY3IkiL9Iki4;Iki@#...#######.#######..## ........#...#........# ##.........#.#.........# .K....K..#..#........#.# ########.##...#........# #.........#.##.#####.##.#####......#.# #.# Ikiǎ?#......#.#####%# #........# #......#.########....#.#.# #....#.#.##....#.#.##....#.#.##......#.#Ikif#.######.##. ..#Iki0KIki.K   kobold (missile)IkiəC==5Iki:%IkiIki7 #...#.#..## #..#...#........#  ##..#.#.........#  .K.....K.#..#........#.#  #.##...#........# #.#.##.#####.## Iki 8 #.#####......#.# #.# #......#.#####%# #.# #......#.# #....#.#.# #....#.#.##....#.#.#Iki18 #....#.#.##......#.##.#####IkiV8 L.# Iki: 0KIkiB .K   kobold (missile)1===6Ikij ?%Jki #...#.#..##  #.#...#........# ##.#.#.........# Jkic.K.#..#........#.# #K##...#........#  #..#.##.#####.##  #.#####......#.# #.# #......#.#####%# #.# #......#.# #....#.#.# Jki#....#.#.##....#.#.##....#.#.##......#.##.######.# Jki0KJki .K   kobold (missile)Jkig &7Jki8Jki3Jki:<#...#.#..## #.#...#..# .#.#...# K.#..#........#.# .##...#..# #.Jkik:sK.#.##.#####.## #.#####......#.# #.# #......#.#####%# #.# #......#.# #....#.#.# #....#.#.Jki:##....#.#.##....#.#.##......#.Jki:_##.######.# Jki<0KJki(C.K   kobold (missile)JkiC&8JkiI8%JkieKJki...#.#..## .#...#.# .#.#.# JkiX.#..#.#.# .##...#.# .#.##.#####.## .#####..K...#.# #.# Jki#......#.#####%# #.# #......#.# #....#.#.# #....#.#.# JkiJkiGJki&9JkiQ:%JkiJkipH#.#..## #...#.# #.#.# #..#.#.# .##...#.# #.##.#####.## Jki#####..K...#.# #.# #......#.#####%# #.# #......#.# #....#.#.# Jki3&Jki#JkiZ%N===100.0 (1.0)Jki@*Jki,Jki' $#.#Jki( P..## #...#..# #.#..# #..#.#.# .##...#........# #.##.#####.## ..K...#.# #.# Jki/) 2#......#.#####%# #.# #......#.#Jkik) a #....#.#.# Jki) &Jki/ JkiY0 &1Jki3 Jki5 Jkim e ##.......## #..# #######.#######..## #......# .#Jki ....# ....#..#........#.# ###.##...#........# ......#.##.#####.## ###..K...#.# #.# #......#.#####@# #........# #......#.#######  #....#.#.##......#.##.######.#Jki 2 _You see here a riddle talisman.Kki1KKkiMK   kobold (missile)3 _a - a riddle talismanKki aM##..##  ##.......## #..# #######.#######..##...#....KkiB ..#.#.........# ....#..#........#.# ###.##...#........ ......#.##.#####.## ###..K #.#####K.......Kkiw L#......#.#######Kki Kki &4Kkix Kki Lki4LkiLki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Lkiٷ Lki Gear: 1/52 gear slots (Left/Right to switch category) Talismans (go to first with %)Lkiع +a - a riddle talismanMkiScrolls:  Scrolls ?  c - a scroll labelled ALYSTR OFUYMYNkiDPotion Potion!  g - a potion of magicNki3/ Gear: 1/52 gear slots (Left/Right to switch category) Talismans%  a - a riddle talismanNkiAScrolls:  Scrolls ?  c - a scroll labelled ALYSTR OFUYMYOkiRPotion Potion!  g - a potion of magicOkip Scroll Scroll?  c - a scroll labelled ALYSTR OFUYMYOki4 Gear: 1/52 gear slots (Left/Right to switch category) Talismans%  a - a riddle talismanPki;PkiPkiz  ##.........###..#ludeguy the Apothecary##.......## #..#Octopode #######.#######..##Health: 11/11 ======================== .....#...#........#Magic: 3/3======================== ......#.#.........#AC: 1Str: 7 ....#..#........#.#EV: 12Int: 17 ###.##...#........#SH: 0Dex: 12 ......#.##.#####.##XL:  1 Next: 20% Place: Dungeon:1 ###..K...#.# #@#Noise: ---------  Time: 104.0 (0.0)#......#.#####.#-) Tentacles#......K.......#Cast: Poisonous Vapours#......#.########....#.#.##....#.#.##....#.#.##....#.#.##......#.#You encounter a kobold. It is wielding a +0 dagger and quivering stones. Pki a_The kobold shouts! _The kobold throws a stone. The stone hits you. _You see here a riddle talisman. _a - a riddle talisman _You can't see any susceptible monsters within range! (Use Z to cast anyway.)PkiPkiPkiBPki|Pki_ 3Pki` Pkish | _Pkil XPkim Pkim Pkin PkiAp Pki!r PkiLr Pkis Pkit Pki7v ,Pki#w Pkijx Pkiy ,Pkiz Pki{ XPki Pki ,Pki Pki Pki! ,Pki Pkiއ Pki h  A kobold comes into view.Pki  ##....## .............# # #.............# .# #.............# .## #......<# #..#.............###..# #.............##..#.............#. ##.....##..#...###..#.......## #.. #######.#######..## .....#...#........#K   kobold (missile) ......#.#.........# ....#..#........#K# ###.##.......#13.0 (9Pki> Pki 64.0 (10.0) _Pki Pki QkiQkiePut on or remove which piece of jewellery? Talismans (go to first with %) Qki a - a riddle talisman[?] describe selected [!] equip|wield|put onQki[tab] equip|unequip Qki8 a - a riddle talisman. An intricate puzzlebox containing an unknowable prize. Transforms the wearer into a riddle-loving sphinx. In this form, they are capable of wearing a cloak and barding, and their melee attacks cause powerful winds to strike their foe Qkie~which do increased damage for every open space next to them. They are also masterful enchanters, casting Hex spells much more easily and ignoring a portionof their foe's Willpower. Alas, their love of riddles is so compulsive that even the most hardened adventurer will be unable to resist posing them to new foes they encounter, no matter how unwise this may be. ____________________________________________________________Skill HP AC Airstrike Dmg -------------------------------------------- Min 17 +15% +7.0(1-4)d13 Max 25 +15% +7.0(1-4)d18 Qki2Cur 0.0 -89% +7.0 (1-4)d1 Barding: YesWill: +SInv: + Melds: Weapon, Offhand, Body Armour, Helmet, Gloves, Boots tkiPut on or remove which piece of jewellery? Talismans (go to first with %)  a - a riddle talisman  [?] describe selected [!] equip|wield|put on[tab] equip|unequip ukiEuki!uki' ##.........##ludeguy the Apothecary ##...........##Octopode #.............# #Health: 11/11 ======================== #.............# .#Magic: 3/3ukiM(h======================== #.............# .##AC: 1Str: 7 #......<......# #..#EV: 12Int: 17 #.............###..#SH: 0Dex: 12 #.............##..#XL:  1 Next: 20% Place: Dungeon:1 #.............#.@#uki(9Noise: ---------  Time: 114.0 (0.0) ##...........##..#-) Tentacles  ##.........###..#Cast: Poisonous Vapours##.......## #..# #######.#######..## uki).....#...#........#K   kobold (missile) ......#.#.........# ....#..#........#K# ###.##...#........# uki^)_The kobold shouts! _The kobold throws a stone. The stone hits you. _You see here a riddle talisman. _a - a riddle talisman _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _A kobold comes into view.uki-w ..#.#......... uki-....#..#........#K ###.##...#........#Okay, then.uki-uki1uki3. _ukiJukis Your spells (describe)TypeukigFailure Level  a + Poisonous VapoursAlchemy/Air10% 1 Select a spell to describe [?] help [!]/[I] toggle spell headersvki vki  ##.........##ludeguy the Apothecary ##...........##Octopode #.............# #Health: 11/11 ======================== #.............# .#Magic: 3/3vkic ======================== #.............# .##AC: 1Str: 7 #......<......# #..#EV: 12Int: 17 #.............###..#SH: 0vki NDex: 12 #.............##..#XL:  1 Next: 20% Place: Dungeon:1 #.............#.@#vki Noise: ---------  Time: 114.0 (0.0) ##...........##..#vki -) Tentacles  ##.........###..#vki Cast: Poisonous Vapours##.......## #..# vki ########.#######..## .....#...#........#K   kobold (missile) vki7 Y......#.#.........# vkiX z....#..#........#K# ###.##...#........# vki _The kobold throws a stone. The stone hits you. _You see here a riddle talisman. _a - a riddle talisman vki _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _A kobold comes into view. _Okay, then.vki~ 4vki vki wki ####  #### ###  #.# wki_. .#< #..####..###@.#..#..## ##.wkiD.##..  ##..###..  ##.......## #.. #######.#######..##...#wkik...#.#......... ....#..#..wki=#Kwki-.KwkiKwki.wkiK   kobold (missile).wki625.0 (1 _wkixwkiwkiͤ<##..## ##..## #..# #.#.##<#...##..# ##..# #.@## ####..#  ### #### #######.#######..## .....#...#......K..#.#..#..#........# ###.##...#.K.wkiwki&6wkiwki8wki[ _You can't see any susceptible monsters within range! (Use Z to cast anyway.)xki##..## #..# #.#xki4<#..#.##..# ##..# ..## ####.@#  ##xki# #### #######.#######.K## .....#...#........xkim.#.#.....#..#........# xki###.##...#........# ......#.##.#####.#xkixki:((xkin..9/11 -----=7Poisonous Vapoursxki9sxkiuD _The kobold throws a stone. The stone hits you.xki 5K.xkiI$ xki$ e2--------Contam: 10% xki% '-8xkiy( xki)+ O _You miscast Poisonous Vapours. Nothing appears to happen.xki K.  Poisonous fumes billow around the kobold!xki V , poisoned)xkiA }1----------------=9xki2 xkiH - _The kobold is poisoned.yki )Poisonous fumes billow around the kobold!yki&)ykiG10/11==---yki>e0----------------320ykiy;Poisonous VapoursykiykiؾJ _You kill the kobold!ykiykiyki~ykiK _You are out of magic!yki4ykiykiSyki_yki1f _ykiykiykiykiykiyki#1ykia=====--------ykiFykih 1 _HP restored.yki 98% yki ykiA yki 76yki ykiykiT74ykiykiykiU===2ykiykiykiFL1========1ykiiyki?ykiyki'ykiykiZ _Your magical contamination has completely faded away.ykiykiyki,ykiJykiV========yki yki yki!yki!yki"yki"yki$#yki $ykiH$yki-%yki&ykiG&yki&yki{'yki'ykiG(yki)yki=)yki)yki%+ykiV+yki+yki,,yki-yki%/ykiS/T2========yki0yki,1,yki 2yki]3yki3yki4yki5,yki6yki7yki7@========ykiO8yki;9ykip9yki9yki=;,yki*<yki=yki=yki>yki)@ykiX@ykiAykiaBykiBykiGCykiD,ykiEykiGykiWGyki8HykiIykiIT3========ykiJykiDMykiNykiOykiOyki~PykiQykiQyki$RykiRykiS,ykieTykiUykiVykiV*========ykiVyki>YykiIsykisykitykiuykiwykizc  You encounter a bat.ykiU .#  yki.. ... .b  ####.#### #..#.#  ##ykiz## #..#.## #.........###..#.. ##..#.# .#..#.# .##...# .. #@.##- ......<......# ##..# ......###..## .............##..##........#..## #...........##..# b   bat (asleep) ##.........###.)#  ##.......## #..# ######.#######..##ykic059.0 (39.0)ykisN-60.0 (40 _ykiykiykiiW  .# .. ... .b   #..#.#   #..#.## #..#..#..#.#ykiW #..#.##...# #@.## < ##..# ..## .##.##ykiW $.#)#  ykiX 2 #..##yki  .# .. ... .b   #..#.#   #..#.## #..#..#..#.##..#.##...# #@.## < ##..# ..## .##.##.#)#   yki ykiE yki yki}  yki L_A bat is nearby!zki5 R.# .. ...#.b  ####.#### #..#.# ##.zki6 b## #..#.## .###..#.. .##..#.# #..#.# ##...# # #.@## <......# ##..# zki6 ###..## ##..###..## .zki6 ##..# .###.)# zki 7 ##.## #..# zkiB N1.0 (1.0) _zkiF zkiH {ki.. ...#.b ####.#### #..#.# #.......## #..#.## ..#..#.. .#..#.# #..#.# ##...# {kiH# #..#<# ##.@# ......###..## ##..## #..####..####.)#{ki}## #..###.#######..# ..#...#........#{ki{kiX&2{kic{ki{ki+####.#### #..#.#.......## #..#.##..###..#..{kij..##..#.#..#..#.#.##...#.# #..##<......# ##..#..###.@##..##.. ###)# ## #.{kiN.# #####.#######.## ...#...#.......{kiѻ5.#..#.#.#{ki {kiq&3{ki{ki{kiyU.......## #..#.##..###..#....##..#.#..#..#.#.##...#.# #..##<......# ##..#..###..##.. {ki###.. ####)#  ## #..#####.#######..## ....#...#........#..#....##.{ki #.#{ki{ki&4{ki{ki{ki ..###..#....##..#.#..#..#.# #.##...# #{kih L.# #..## #<......# ##..# #.......###..## #. #{ki ;. ####.. {ki ####.)#  ##{ki q #..# #######.#######{ki" m.## .....#...#........#{kiA 5..#.....#{kia =#.#.# {ki 0###.##...#........#{ki {ki+ &5{ki' {ki: {ki+ ##..# #..#..#.##... #..##<{ki#..#.##..####..## ..## ###.@#  #####.) #### #.........# ......#.##.#####.##{ki*{ki&6{ki {ki |ki ..##... #..##<|ki X#..#.##..###..## ..## ###..# |ki2D ### ##|kiR## #.. #######.#######..##....#.#|kim.|ki.#####.## ###..K...#.# #.#|ki|ki&7|ki?|kib$  Things that are here:|kiK _a +0 dagger; 5 stones}ki"Pick up what? 1/52 gear slots (_ for help) Hand Weapons (select all with ))a - a +0 dagger Missiles (select all with ()b - 5 stones [Up|Down] select[Esc] exit Letters toggle [.|Space] toggle selected[top]}kiH  a + a +0 dagger[Enter] accept (1 chosen)}ki`}kiqe}kipk#.............#..#.#ludeguy the Apothecary #.............##...#Octopode #.............# #..##Health: 11/11 ======================== #......<......# ##..#Magic: 3/3======================== }kil#.............###..##AC: 1Str: 7 #.............##..##EV: 12Int: 17 #.............#..##SH: 0Dex: 12 ##...........##..#XL:  1 Next: 30% Place: Dungeon:1  ##.........###.@#Noise: ---------  Time: 167.0 (0.0)}ki>l##.......## #..#-) Tentacles #######.#######..##}kiblCast: Poisonous Vapours .....#...#........# ......#.#.........# }kil....#..#........#.# ###.##...#........# }kil......#.##.#####.## ###..K...#.# #.# }kile_HP restored. _Your magical contamination has completely faded away. }kil_You encounter a bat. _A bat is nearby!Things that are here: }kim6_a +0 dagger; 5 stones}kimtA8.0 (1}ki*y}ki{% _b - a +0 dagger~ki&  You have 8 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 1.0.~ki ~ki) ~kiԯ `  Your damage rating with unarmed combat is about 2 (Base [3 + 0 (UC)] x 92% ~ki >_(Str) x 100% (Fight)).kifkizWield or unwield which item (- for none)?  - - Tentacles (current attack) Hand Weapons (go to first with ))b - a +0 dagger[?] describe selected [!] equip|wield|put on[tab] equip|unequip ki-#.............#..#.#ludeguy the Apothecary #.............##...#Octopode #.............# #..##Health: 11/11 ======================== #......<......# ##..#Magic: 3/3======================== #.............###..##AC: 1Str: 7 #.............##..##EV: 12Int: 17 #.............#..##SH: 0Dex: 12 ##...........##..#XL:  1 Next: 30% Place: Dungeon:1  ##.........###.@#Noise: ---------  Time: 168.0 (0.0)##.......## #..#-) Tentacles #######.#######..##Cast: Poisonous Vapours .....#...#........# ......#.#.........# ....#..#....ki2 ....#.# ###.##...#........# ......#.##.#####.## ###..K...#.# #.# _a +0 dagger; 5 stones _b - a +0 dagger  You have 8 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 1.0.  Your damage rating with unarmed combat is about 2 (Base [3 + 0 (UC)] x 92% _(Str) x 100% (Fight)).5 (0.5b) +0 daggerki‹kiU. _b - a +0 dagger (weapon)ki_  You have 6 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 1.0.ki` kie kig c  Your damage rating with your +0 dagger is about 4 (Base 4 x 105% (Dex) x 100% kig 1_(Skill)).kiD3kiBEkiHkiJkiMP _kiNkiOkiOkiQkiR,kiwSkiTkiVkiVkitWki$YkiZ,ki[kiC]ki^O  A bat comes into view.ki_ki'd .#  .. ...#.b kiZdG ####.#### #..#.#  ##.......## #..#.## #ki}d###..#.. ##..#.# .kid#..#.# ...# ...kidb.# #@.## kid......<......# ##..# .............###..##........##..##kie.......#..## #...........##..# ki0edb   bat (asleep)kiOe.........###.(#  ##.......## #..#kine6###.#######..#kij.73.5 (5.0kij24.5 (6 _kimkiokiu .# .. ...#.b   #..#.# ki7k  #..#.## #..#..#..#.##..#.##...#kiVO #@.## < ##..# kiq8.## .##.##ki.#ki&(#   #..##ki"ki  .# .. ...#.b   #..#.#   #..#.## #..#..#..#.##..#.##...# #@.## < ##..# .## .##.##.#(#   ki# ki` kiQ ki  ki ki% 6_A bat is nearby!kiN kiwV  .# .. ...#.b   #..#.#   #..#.## #..#..#..#.##..#.##...# #@.## < ##..# .## .##.##.#(#   #..##ki  .# .. ...#.b   #..#.#   #..#.## #..#..#..#.##..#.##...# #@.## < ##..# .## .##.##.#(#   ki ki ki kiw Z _A bat is nearby!ki .# #..  .. ...#.b ##.#### #..#.# ## #..#.##ki ###..#.. ##..#.# #..#.# ##..@# ......###..## <# ##..# ###..##..## .ki U..# ....ki b# #..#.(ki #.......## #..#kiu ).b.ki/ ".kiK bki+ !.kiG bki: Nbki2 +5.5 (1kiQ #Poisonous Vapours _kia ki& kiI #.##  .. ...#.. ki ####.####  ### #..#.## kiA####..#b.ki(##....#kiR...# .ki6##..#ki8h< ##..#kiVr#..###..##.#..kit7## ..##.. #.ki-.###.(ki$.bkiki70---ki'=6kiFki[ _The bat misses you. The bat hits you.ki^   bat (poisoned)Poisonous fumes billow around the bat! The bat is poisoned.kiJ_]2--------7kibkid _The bat completely misses you. The bat barely misses you.ki .  You closely miss the bat. Your grab misses the bat.The bat is severely wounded.ki (ki --------48Poisonous Vapourski kiu G _You kill the bat!kic ki ki ki kiE ki {---ki  kis ki F1===kiI ki[ ki ki8 kij ki kig ki ki ki ki kiF ;===ki ki kiu kis kiJ ki ki( kiN ki kin ki ki >3========ki ki ki ki ki  ki ki8 ki ki ki ki" ki:% kiz% ki& ki( ki+ ki+ @========ki, ki. ki1 kiR1 kij2 ki5 ki8 c  You encounter a bat.kiA #.#.# #.#.b #.#.# # kiA ,#.#.#?# #.#.#.# kiB x#.#...#.# kiDB  .# #.......#.  .. ...#.@.......kipB - ####.#### #..#.###.#### kiB a### #..#.###.#kiB ....###..#.....###..#.######..#.# b   bat (asleep)kiC E##...#.ki:C h.## ....<......# ##ki`C !..#kioE >.b946.0)kiF &.bkiF !.kiF bkihP NbkiQ F-5.5 (17kiR #Poisonous Vapours _ki'Z ki\ kic .#.  #.#?#b#.#  #.#...#.# # #.ki̩_#.  .. ...#.........###.#### #..#.###.#### ### #..#.###.####..#.....##..#.#####..#...ki]#.##..#kit'.bki%.bkiki%9=6.0)kiki#Q _The bat closely misses you.ki@qp .  Poisonous fumes billow around the bat! The bat is poisoned.kiv(kiy2--------57Poisonous Vapourski~kiG _You kill the bat!ki.! ki! kiu& ki) H _No target in view!kiv3ki\kiVP _ki" Bki ,kiki6--------kinki!ki"ki`#ki'Bki(kiB*ki*T3========ki+ki.kiJ1ki1ki2ki5kiAkiBkiM,kiN@========kiNkiv[! ki[b #.# kig\ ki\b #.# ki] kiW]a#.#.# ki] ki^q#.#.#.# kiQ^ ki _g#.#.#.# ki`_ ki_G#.#...# ki` kiK`S#.#.#.# ki` kia kiHaR#.#.#@# ki{b1 -kien #.#.#.#   #.#...#.#   .# #.......#.  .. ...#.........# #.#### #..#.###.#####  ## #..#.###.#  ###..#.....#  ##..#.###  kiJj12125.0)kij!-kik%3.5 (16kiqkisd _d - a scroll labelled WUDUAD WOSIRHEkikikikikikiTXkikikiki! ki/"z You encounter a kobold. It is wielding a +0 whip.kih)#.#.# #.#.#.#.# #.#.#.#.# #.#...#.# #.#.#.#.# #.#.#.#.# #.#.#.#K# #.#...#.# .##.....@.#. .. ...#.........# .#### #..#.###.##### Poisonous Vapours ki*....## #..#.###.#  .....###..#.....#  ......##..#.#####   K   kobold (asleep)..#..#.#  .##...#  #..## kiD*- ki715.5 (2.0)ki826.5 (3 _kiAki?Eki>2 .KPoisonous fumes billow around the kobold!  The kobold is poisoned.kiH4K  poisoned)2--------====7.5 (1 _The kobold shouts!ki )  You barely miss the kobold. You grab the kobold. You squeeze the kobold.kiRki--------6=---8Poisonous VapourskikiLJ _You kill the kobold!kiuVP---kiF\ki^H _No target in view!ki=  _kiC BkieG Bki:M kiN ,kiQ BkiY kiY ki^ kif^ T3========ki_c kitf kij Bkik kiq BkiM} ki ki ki& kik ki ki4 @========ki ki ki+ kid ki ki ki kiW kip kiU ki* ,ki ki XkiC ki *   ).#   #.#   #.#   #.# #.# ki   #.# #.#  #.#.# #.#  #.#.#.#.#.#   ki  #.#.#.#.#@#  -379.0)ki j #.#...#.#.#  ki!  #.#.#.#.#.#  kiС ? #.#.#.#.#.#  #.#.#.#.#.#  #.#...#)#.#  #.......#.#  ...#.........#ki n ## #..#.###.##### kio ki3 F-8.5 (20kiɺ = _Found a hand axe.kiG Qki ,ki ki ki g  You see here a +0 hand axe. _ki kiki0,ki`2ki<]5  kikYou see here a +0 whip.ki!= _ki\kihXkikiܑ,kiړkiXki=kiJki###  .#.  [> #####  .. #.).#  .###.#.#.#  .?#.#.#.#  #.#.#.#.#  #@#.#.#.# 67.5 (29 #.#.#.#.#  #.#.#.#.#.#  #.#.#.#.#.# #.#...#.#.# #.#.#.#.#.# #.#.#.#.#.# #.#.#.#.#.# #.#...#)#.#8.5 (30ki;~[m _Found a robe. Found a stone staircase leading down.kiuIkiPkiB _d - 2 scrolls labelled WUDUAD WOSIRHE (gained 1)  You encounter a bat. b. ## #.#. ..#... ..####.... .....#...# .....[>.. ######....# #.).####@###.#.#.##.....#.#.#.##.#.#.#.#.#.##.#.#.#.#.#.##.#.#.#.#.#.#.#.#.#.#b   bat (asleep).#.#.#.#...#.#.##.#.#.#.#76.5 (8.0)7.5kiK/ (9 _kiZt.#... b... ### #.#. ..#...####....#...# .....[>..# #####...@# #.)####.####.....##.#.#.#.#.#.#.#.#.##.kiki+8.5 (1kikiS .#...  b...  ### #.#.  . ..#...  ..####.... .....#...# .....[>..# #####  #...@# #.).#  ####.#  #....  #.#.#.  #.#.#.#  #.#.#.#  #.#.#  #.#.#   ki֜h .#...  kib...  ### #.#.  . ..#...  ..####.... .....#...# .....[>..# #####  #...@# #.).# kiƝg ####.#  ki7S#....  #.#.#. #.#.#.#kiw #.#.#.#  #.#.#ki #.#.# kiО ki7kiSkikiAZ _A bat is nearby!ki4.# ##.#. b.. ######.#. ...#..####.... .....#...# .....[>.@# ##### #.#....## #.).# ####.###.#.#.# #.....#.#.#.##.#.#.#.#.#.# #.#.##.#.##.#.#.#ki8{J9 _kiy_4ki%bkie _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki<4ki?ki ki_You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiv ". # ##.#...# b.... #######.#.# ....#.....####....#....#..@# .....[>..# #####.#....## #.)####.##....##.#kiS kio %80 ki _ki ki ki/4kiki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki74ki]ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kimq##. ###.#...# b.... ########.#.#......#....#####..@.#....#...## .....[>..# #####.#....## #.)####.##.....#kiukiuI1Poisonous Vapours _ki|ki8~kiˬ### #.. #.##### ##.#...# .b....########.#.# .......#.@..#..####....#K#.....#...## # ki.....[>..# ######.#....## #.).#####.###.#.#.# #.....#.#.#.# K   kobold (asleep)#. kiA<2kiki _You encounter a kobold. It is wielding a +0 dagger of protection.ki##.  #.###########.#...# .......b....# ########@#.#.....#....####....#Kki@.#...##.#.....[>..# #####.#....## #.)####.##....kib.ki "b.kiMNbki'.=3kikiT _The bat completely misses you.ki. ##.  #.###########b# .......@....# ########.#.#.#.....#....####....#K#.#...##......[>..# #####.#....## #.)####.##...ki0 !b.ki1 "b.ki9 ki|: &4ki@ kicC Q _The bat closely misses you.ki###b  #.############@#...# ........... ########.#.#.#.....#....#####....#K#...##.# .....[>..# #####ki{#.#....## #.)####.##ki).b.kiki&5kikiL _The bat misses you. x2ki0 .  You hit the bat but do no damage. You grab the bat. You constrict the bat.ki_7 (ki: i76Poisonous Vapourski@ kiC G _You kill the bat!kif!M########......# #@###########.#...# ............#########.#.#.#...#ki(D-7ki.ki$0kid Iki%Bki(ki*kiZ-h  A kobold comes into view.ki6##########.......##.##### #######.#...# ........@...# -kiY7s########.#.#.# .......#....# Poisonous Vapours..####....#K#.....#...##.#.....[>..# .#####K   kobold (asleep)#.#....## .#.).# ####.###.#.#.# #.....#.#.#ki7#.#kiB&8kiF29.5 (2 _kiKkiPNki ##  #.  #.##### ki #######.#...#  ........@...#  ########.#.#.#  #....# ....#K# .....#...##.# .....[>..# .#####  #.#....## .#.).#  ####.###.#.#.#   kica  ##  #.  kia #.#####  #######.#...#  ........@...#  ########.#.#.#  #....# kiyb Q....#K# .....#...##.# .....[>..# .#####  #.#....## .#.)kib  ####.###.# ki&i kii kiEo kir ] _A kobold is nearby!kiT K.  Poisonous fumes billow around the kobold!  The kobold is poisoned.ki vK  poisoned)ki 2--------====90.5 (1ki ki ( _The kobold shouts!kix )Poisonous fumes billow around the kobold!ki)ki1----------------8=---1Poisonous Vapourski!kil$J _You kill the kobold!kiP---ki $ki& _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki_kiC`kidakiJdkijf _kilkim,kinkiqkiq(--------kirki,tkiB~ki~kikiJkiӅkikikikikiki5kiőki8kiokikikiT2========ki`kikikikikigkiСki%kiRkikikiƨ@========ki@ki;kiqkiحki߯kiNkikiųkikiVkiJkikikiki$ki6ki,ki\kiϿkikikitkikikiki%3kii/========ki#kiki*kijkiki   ######### #.......#  #.##### ki #######.#...#  ............#  ########.#@#.#  -.......#...)# ki ..####....#.# ki .....#...##.# ki .....[>..##.#####ki #.#....###.#.).#  kiJ  ####.###.#.#.#   kix#.....#.#.#.#   #.#.#.#.#.#.#  kiE ki& ##########........##### #######.#...#kil............#########.#.#.#.......#...@# ####....#....#...#ki3.. kih##.##.#.#.#.#.#.# kiE ki*1315.5 (24.0)kiF-6.5 (25ki&kiJ} _You see here a +0 dagger of protection.kifvyWield or unwield which item (- for none)?- - Tentacles Inventory Items Hand Weapons (go to first with ))  b - a +0 dagger (weapon) Floor Items ([,] to select) Hand Weapons a +0 dagger of protection[?] describe selected [!] equip|wield|put on[tab] equip|unequip ki^LkiRki^  ludeguy the Apothecary  Octopode#########  Health: 11/11 ========================#.......#  Magic: 3/3========================#.#####  AC: 1Str: 7#######.#...#  EV: 12Int: 17............#  SH: 0Dex: 12########.#.#.#  XL:  1 Next: 80% Place: Dungeon:1.......#...@#  Noise: ---------  Time: 316.5 (0.0)..####....#.#  b) +0 dagger.....#...##.# iC^40m Cast: Poisonous Vapours.....[>..##.##### #.#....###.#.).# ####.###.#.#.#  #.....#.#.#.#  #.#.#.#.#.#.#  #.#.#.#.#.#.#  The kobold is poisoned. _The kobold shouts!  Poisonous fumes billow around the kobold! _You kill the kobold! _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You see here a +0 dagger of protection.kiby  You unwield your +0 dagger.  Your +0 dagger of protection hums with potential!kicy7.5 (1c(protect)kiikij< _c - a +0 dagger of protection (weapon)kiS.3ki/ki1kiJ4ki7Bki8,ki9ki<ki=ki>ki>ki?kiMAkitAki BkipCkiDkiDkiREkiFkiGkiGkiHki..##.##### #.#....###.#.).# ####.###.#.#.#  ....#.#.#.#  kiR#.#.#.#.#.#.#   r   rat (asleep)ki9S#.#.#.#.#.#.#  #.#.#.#.#.#.#  #.#.#.#.#.#.# kiOS/ ki*Z,23.5 (6kiZ24.5 (7 _ki*`kiPbkiwq   .#  #.#####.#  ..#r#  ..#.#  .#.#.#  .#.#.#  #.#.#  #.@.#  .....[>..##.##### kiwh ).#      kiw/   kix+   ki0x' ki    .#  #.#####.#  ..#r#  ..#.#  .#.#.#  .#.#.#  kiq#.#.#  #.@.#  .....[>..##.#####  ).#    kiM     ki<    kikivki/kiZ _A rat is nearby!ki/  #########  #.......#   #.#####.#  #######.#...#r#  ............#.#  ########.#.#.#.#  ki0.......#....#.#.#  ..####....#.#.#@#  .....#...##.#...#  .....[>..##.#####  #.#....###.#.).# kiL0} ####.###.#.#.#  #.....#.#.#.# ki0 #.#.#.#.#.#.#  #.#.#.#.#.#.#  #.#.#.#.#.#.#  ki7ki825.5 (1 _ki^;ki<ki1 ###  ..#  #.#  #r#  #.#  #.#  #.#  #@#  #...#  .....[>..##.#####  ).#           ki0 f ###  ..#  #.#  #r#  #.#  #.#  #.#  kiL1 #@#  #...#  .....[>..##.#####  ).#     kiq1 A     ki1  kiz6 ki6 kiF: ki< Z _A rat is nearby!kijI u#######..... #.#####.#######.#...#r ........... ########.#.....#...####....#.#.#kiI #...##.#...  .....[>..##.######.#...)####.##...kiwO ki P I6Poisonous Vapours _kiT kiHV ki #######..... #.#####.#######.#...#r ........... ########.#.....#...####....#.#.##....  kiB .....[>..##.######.#...)####.##...ki ki &7ki ki ki& kiJ.  Poisonous fumes billow around the rat! The rat is poisoned.kitRkim2--------9=8ki;Poisonous VapourskikiuG _You kill the rat!ki4kiski H _No target in view!kiIkiSki _ki*kiki0ki>--------kikiBki,kikiV ki ki8!ki",ki+#kih$ki$ki\%ki&ki&ki1'ki[(j3========ki(kiA*ki*ki-+ki+ki,ki,-ki_-ki-kis.ki/kij/ki/ki_0ki1ki?1@========ki1ki2ki3ki/4ki4ki5kiN6ki~6ki 7ki7ki8,ki9kiz:ki;ki;kiV<kia=ki=>kij>ki>ki/HkiHkiJIkiJki+JkiJki?KkiLki3LkiLkiMkiO  You encounter a goblin. It is wielding a +0 dagger.kiSE ki0T#########  #.......#  #.#####.#  ...#########.#...#.#  .......@.........#.# - g..#########.#.#.#.#  .......#....#.#.#  kiTy..####....#.#.#.# .....#...##.#...# .....[>..##.##### g   goblin (asleep) #.#....###.#.).# ####.###.#.#.# #.....#.#.#.#kiX053.5 (25.0)ki]YM-4.5 (26 _kiw\ki3^kic        ...#########.#...#.#  .......@.........#.#  ki g..#########.#.#.#.#  .#.#  .#.#  ..#  ki 7.....[>  ).# ki &   ki' ! ki+ d       ...#########.#...#.#  .......@.........#.#  ki g..#########.#.#.#.#  .#.#  .#. . kiФ ~.....[>  )ki 9 ki  kiͫ ki2 ki) ki ] _A goblin is nearby!kiYh        ...#########.#...#.#  .......@.........#.#  g..#########.#.#.#.# kih { .#.#  .#.#  ..#  .....[>  kih 0).#   kih .  kil       ...#########.#...#.#  .......@.........#.#  g..#########.#.#.#.#  .#.#  .#. . .....[>  ) ki* kiki ki ki ] _A goblin is nearby!ki> # #.#. #.#####.#.#.#...#.#..........#.#.g..#.#.#.#.#. .#....#.#.# ..####....#.#.#.# .....#...##.#...# .....[>..##.#####  #.#....###.#.).#  ####.###.#.#.#  #.....#.#.#.#kiki85.5 (1.0) _ki ki7 ki>cV #. #.#.. #.#####.#.#.#...#.#.#.#.g..#.#.#.#.#.. .#....#.#.## ..####....#.#.#.#  .....#...##.#...# .....[>..##.#####  #.#....###.#.).#  ####.###.#.#.# kicK #.....#.#.#.#kijkisk&6ki3pkiqkih# n###.. ##... #.##.... #.#####.##.....#.#...#.##.#.##..g..#.#.#.#.##.... .#....#.#.#### ..####....#.#.#.#  .....#...##.#...# .....[>..##.#####  #.#....###.#.).# ki#  ####.###.#.#.#  #.....#.#.#.#ki_+ <7ki. ki0 ki6 ki ki ki& _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kio> ###### #..... # #..... #.# #..... #.#####.# #.....#.#...#.# #.#.# #..g..#.#.#.#.# #......#....#.#.# ####....####....#.#.#.#..ki......#...##.#...###.......[>..##.######.# #.#....###.#.).#.. ####.###.#.#.#  #.....#.#.#.#kioki I8Poisonous Vapours _kiakiki)a )Poisonous fumes billow around the goblin!  The goblin is poisoned.kir Wki{ ludeguy the ApothecaryOctopodeHealth: 11/11 ========================######Magic: 2/3================--------#.....######### AC: 1Str: 7#.....#.......# EV: 12Int: 17#.....#.#####.# SH: 0Dex: 12#.....#########.#...#.# XL:  1 Next: 100% Place: Dungeon:1#.....@.............#.# Noise: =--------  Time: 359.5 (1.0)#..)..#########.#.#.#.# c) +0 dagger (protect)#............#....#.#.# Cast: Poisonous Vapours####....####....#.#.#.#........#...##.#...###.......[>..##.##### ki|  #.# #.#....###.#.).# .. ####.###.#.#.# #.....#.#.#.#  _You encounter a goblin. It is wielding a +0 dagger. _A goblin is nearby! _A goblin is nearby! _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Poisonous fumes billow around the goblin!  The goblin is poisoned.ki~ _You kill the goblin!You have reached level 2!ki /  --more--ki 7/173/5----------2 0% Poisonous VapourskiH ki2 4 _ki0ki1kiN2ki4ki`4$ _ki7Xki8,ki8kim:N--ki;ki<ki =ki>ki0@kiT@ki|AkiQCkiCkiDki)Fki_FkiGkiGIkioIki2Jki Kki,KkiKkiLkiLQ4=====kisPBkiPkiR,kiSkiUkiUkiVkiWkiW======kiXkiZkiNZkib[ki],ki ^ki_,ki_ki`ki`kieaki-bkiPbkibkidki'dkidki,fkiXfO5=====ki)gkiikiikijkijkilkimkimkinkiokipkipkijqkiwrkiskis======kitkiukisv,kivkixkiykiykigzki{ki|ki|kiC}ki~ki  You encounter a kobold. It is wielding a +0 club.ki#.....#########.#...#.#...................#.#..)..#########.#.#.#. #............#....#.#.ki*v..######....####....#.#.#................#...##.#....#######.......[>..##.#########.###.#....###.#.)....kiQf#.####.###.#.#.-######.##.# ##.....#.#.#. #. .# #.#.#.#.#.#.kirN #. .# #.#.#.#.#.#.#. .# #.#.#.#.#.#. #. .# #.#.#.#.#.#. K   kobold (asleep)#. K# #.#.#.#.#.#.kiф .# #.#.#...#.#. #.#.#.#.#.#.kih088.5 (29.0)kiM-9.5 (30 _kikikiE #...... #..).ki¢- #.... ##. kiߢ.. #.ki%[> ######.###)ki0 ........@.# ki/)######.##.#  #. .# kiG* #. .#  #. .# ki` #. .#  kiy)#. K#  ki+.# ki'9E #...... #..). #.... ##. .. #.[> ######.###) ki9S........@.# ######.##.#  #. .#  #. .#  #. .#  #. .# ki9_ #. K# ki9: .# ki@ki@kivEkiH] _A kobold is nearby!kiKv #...... #..). #.... ##. .. #.[> ######.###) ........@.# ######.##.#  #. .#  #. .#  #. .#  #. .#  #. K#  kiSL+.# ki #...... #..). #.... ##. .. #.[> ######.###) ........@.# ######.##.#  #. .#  ki#. .#  #. .#  #. .#  #. K#  .# kikipkiki}] _A kobold is nearby!kiI #...................#.##..)..#########.#.#.#.##............#....#.#.#..######....####....#.#.#.#ki ...............#...##.#...#.#######.......[>..##.##### ######.###.#....###.#.)...........#.####.###.#.#.#######.##@# ##.....#.#.#.# #. #.# #.#.#.#.#.#.#ki #. #.# #.#.#.#.#.#.##. #.# #.#.#.#.#.#.##. #.# #.#.#.#.#.#.##. #K# #.#.#.#.#.#.# ..# #.#.#...#.#.#### #.#.#.#.#.#.##.#.#.#.#.#.#ki :90.5 (1kiF .0) _kin ki ki;B)..#########.#.#..........#.....######....####....#.............#...##.#..#######.[>### ######.###.#....###.#.)...........#.###########.##.# ##..... #. #@# #.#.#K ...##ki <# ki(ki&1kikiki]_ #..) ## . #.[> .###) ..# #.#  #. #@#  #. #.#  #. #.#  #. #.#  #. #K#  ..#  kiڏ7###  ki' #..) ## . #.[> .###) ..# #.#  #. #@#  #. #.#  ki'#. #.#  #. #.#  #. #K#  ..#  ###  ki/4ki5ki7] _A kobold is nearby!ki.N 4kiCT kia _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki5 *..........#.....######....####....#.............#...##.#..#######[>### ######.###.#....###.#.)...........#.###########.##.# ##..... #. #.# #.#.#K ...### ..#)ki# ki$ @2Poisonous Vapours ki$ _kiW* ki{, ki K.  Poisonous fumes billow around the kobold!  The kobold is poisoned.kivK  poisoned)kiX4-----====ki3kiki ( _The kobold shouts!ki )  Poisonous fumes billow around the kobold!  The kobold looks even sicker.ki Ski3----------4=---4Poisonous Vapourski2ki>J _You kill the kobold!ki ki ki; ki† Bki~ ki kiʈ kiC ki ki kik ki ;-----ki܎ kiQ kiÐ ki| ki ,ki kiB ,ki kiP ki ki kiu ki Q4=====ki ki؜ ki kiɝ ki kiF ki ki ,ki ki S=====ki ki. ,ki kip ,ki2 ki ki ki ki) ,ki ki. kiZ ki ki ,ki ki ki O5=====ki kiU ki ,ki ki kib ,ki ki <  You see here a +0 club.ki ki  _ki kii ki S=====ki ki kiU ki ki: ki[ ki& kic ki ki ki: ki ki` ki ki ki? ki ki ki kid kiS ki ki ki+ kiO ki ki1 kif ki kiF ki ki< ki ki kii ,ki ki ki{ ki kib ki ki ,ki ki+ ki  You encounter a kobold. It is wielding a +0 whip.kiv  #.##.# #.#.#.#.#.#. #.##)# #.#.#.#.#.#. ####.##.# #.#.#.#.#.#. #.......# #.#.#...#.#. #.##.#### #.#.#.#.#.#. ###.#..# #.#.#.#.#.#.......## K.#.#.#.#.#.#..#..#..###..###.#...#)#........#.#.@......#.......#.----......#...#.......#..........#######.#######..#.###.#####.......## #..#.###.###.........###..#....ki .###...........##..#.##### K   kobold (asleep)#.............#..#.##.............##...##.............###..##ki _.K429.5 (35.0)ki  MKki` 7===30.5 (36kiw ki  ( _The kobold shouts!ki} &#.##.# #.#.#.#.#.#.##.##)# #.#.#.#.#.#.#####.##.# #.#.#.#.#.#.##.......# #.#.#...#.#.##.##.#### #.#.#.#.#.#.####.#..# #.#.#.#.#.#.###......## ...#.#.#.#.#.##..#..#..###.K###.#...#)#.#.#.#..#.#.#......#...#.#.#.#######.#######..#.###.###.......## #..##...##....ki k##..#.##### #... ki K.Kkiw ki'! ;---1.5 (1.0)ki]! Poisonous Vapourski' ki$) kibT   #.##)#      #.# #.# ###.#..# #.# ##......## ...# #..###..###)  kiT#..@.K...#  #...#.......#  ##.#######..#  #..#        kiUH   ki   #.##)#      #.# #.# ###.#..# #.# ##......## ...# #..###..###)  #..@.K...#  kiU#...#.......#  ##.#######..#  #..#      ki+P---kiki] _A kobold is nearby!kiA   #.##)#      #.# #.# ###.#..# #.# ##......## ...# #..###..###)  ki+,#..@.K...#  #...#.......#  ##.#######..#  #..#           ki   #.##)#      #.# #.# ###.#..# #.# ##......## ...# #..###..###)  kit #..@.K...#  #...#.......#  ##.#######..#  #..#   ki3   kiki!ki!ki&ki)] _A kobold is nearby!ki  K.  Poisonous fumes billow around the kobold!kiT (poisoned)ki)`4-----=2kiki!- _The kobold is poisoned.kiD` e)  Poisonous fumes billow around the kobold!is poisoned.  You closely miss the kobold. You grab the kobold.  Your squeeze misses the kobold.The kobold is moderately wounded.  You constrict the kobold.ki/e (ki*h -----83Poisonous Vapours _You kill the kobold!kil kin h _Your Stealth skill increases to level 3!ki ki kiD) kil, H _No target in view!ki3kiki: _kiXkir,kikikiӞkikikiˠkikikiݢki8ki9,ki9kikiNki0kikiO5=====kiki!kikiTkiïki<  You see here a +0 whip.kiki _kikikiMkikipkikiki======kinkiakiOkivkiki*ki,kiekikiEkikikikiUkikikiki#,kikiki,kiaki<  You see here a +0 whip.kiki\ _kiDki0kikiAkikikikiki2ki8kiu,kikikikikiOkikikiGkikiki,ki_kiNki #.##.#.##.#.#. #.##)#.##.#.#. ####.##.#.##.#.#. #.......#.##.#.#. #.##.####.##.#.#. ###.#..# #.##.#.#. ##......## #....#.#. .####..#..#..###..###.#. ki.......@.#.#...)....#...-59.5 (26.0) ........#...#.#... ...#######.#######..#. > ##.......## .#.## ##.........###..#... ##...........##..#.##  #.......#..#.#  #.......##...#  #.......###..##kiE kikiDG-60.5 (27kiki9 _Found an escape hatch in the floor.ki3kikiJkikinkibkikikiJkikikikikiAkikikiki<kikikiki7kikikikiki<kiKkikikikikikikiki,kiTkiki,kiCkigki?,kiki ki; kik ki ki kiH ki ki kiA ki ki;kikiki,ki kiykikikikiki8,kikikiki>kiki& ki5"kio"ki#ki&ki)  You encounter a kobold. It is wielding a +0 dagger.ki1#.# #.# ##.#####.### ###########.##......# #..#...............# #.###...............# ##ki1#..........##.#####....#######.#####.####..#..# #.# #........ #@# #........#ki2K........##...#######>...........>..# ##....ki!2...........###..###........!.......# #..##...kiB2...........# #..#....... K   kobold (asleep)kif2############ ..##....... .###....... ki2k.# #......<ki9,80ki1:,1.5 (21ki>kiB; _Found a stone staircase leading down.kiW  #.# #.#  #.#  #######.##  #.........  ..........# kilW y .....##. #.#####. #.# #.. #@# #.......kiW N ..K........##... .>...........>..# kiW 9 ...........###. ...!.......#  kiW ,...........#  ############ ki...........>..#  ...........###. ...!.......#  ...........#  ############  .# <ki& 4ki ki% ] _A kobold is nearby!ki #.#####.### #########.##......# #.. #...............# #.# #.......# ###. #..........##.#####... #######.#####.# #.# #.......########.#####.#..K...@....##...########.>...>..# ##..#.###..##...!.# #..#....# #..############# ..## .### # #......kiki/2.5 (1.0) ki _kikikiȸ \ #.#####.###  #.##......# # #.........# #. #........# ###. #..........##.##### #.#####.####..# #.# #. #.#####.# #..K.##... #.>.>..# ## #.###..### #...!.# #..## #.# #..# # ..## .### .# # #kic ki ?3Poisonous Vapourski ki kiy .KPoisonous fumes billow around the kobold!kiuK  poisoned)ki`4-----=4ki kiV- _The kobold is poisoned.ki )Poisonous fumes billow around the kobold!  The kobold looks even sicker.ki Rki 3----------125Poisonous Vapourski ki J _You kill the kobold!kiFkiyFkiGkiIkiOnkiPkiwQkiRkiSkiT;-----ki:Uki6W,kiXkiJZkiZki[ki\,ki]ki_ki_ki`kiobkibQ4=====kidkiwekiekifkihkihki jkikkilkinmkioS=====kipkirkiTskitkivki wki xkiyki zki@{ki1}kiv}ki~kiv,kikikikikikihO5=====kikiki),kiDkikikiۓkikiZkickikikiJ#...............# #..........##.#### #######.#####.####. #.# #...... ########.#####.... #...).......##...#####.>...........>..# ## #...........###..###. #....# #..##..- ## #..#. ############# .. .### .# # # # ## ##kiC1508.5 (23.0)ki6f=====-9.5 (24kiki~Y _f - a viscous grey potionkihkiki|kikiKkiki,kikikikikipkikikikikiki8kikikikiTki<ki kikikiki ki ki| kiZ kib ,ki ki kiekikikikikiQkikikiPkikikiVkikiki_kikiQki|kiki1kikiDkikikiVkikiki,kikkiki*!ki!ki4"ki"ki#ki$ki%ki%ki'ki'ki'ki](ki)ki*,ki,,ki1ki.2ki3  You encounter a kobold. It is wielding a +0 dagger and quivering stones.ki8 #.K################## .......@..........# ##################.# # #.############.##.#..........#..........K   kobold (missile, asleep)#..........##.kiW9#######.#####.#.# #.ki??-31.5 (22ki@32.5 (23 _kiDDkicGkiy K##################  .......@..........#  #################.#  #. . . . . . #.# kig  K##################  .......@..........#  #################.#  #. . .kih  . . . #.# kin ki6o ki^t kiw ] _A kobold is nearby!ki{  #.K# #=...........# #.#.# # #.##### #.## #...... #...... #..........## #.##### #.# #ki 93.5 (1kil .0)ki@ ki̔ S _Found a brass ring.kii.K# .=.# #.kin#.#  #. #.## # # #. #. #.#kiTki%kiS4kikiIkiט...K#.=.##.#.# #. #.## # # #ki9. #.  #.#kikig&5kiQkikiW4kiNki! _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiX*....K#.=.##.#.# #. #.## # # # #.  #.#ki]kin^I6Poisonous Vapours _ki)akihbkiRu KK  poisonkiRSed)Poisonous fumes billow around the kobold!  The kobold is poisoned.  The kobold shouts!kiW:(((kiH..@kikiQ4-----====ki7kikin _The kobold throws a stone. The stone closely misses you.ki )Poisonous fumes billow around the kobold!  The kobold looks even sicker.ki (ki? 3----------6=---8Poisonous Vapourski ki J _You kill the kobold!kihki:---kiki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiA............)#.=.#.###.#.# #. #. # #  #  #.#  #.# ki#Iki|J5-9 _kiRkix###?#.#.....................)kip.=.#.###.#.# #. #. # #ki5 # #. #.ki!W-40kieki7g _Found a scroll labelled WUDUAD WOSIRHE.ki .###?#.##.#.#.#.#.#.).=#.###.# #. ##. #.. #.. #... #... # #ki kiF &1ki"" ki/ !  #.###?#.##  #.#  .#  #.#  #.#  #.#  #kie0 .)  .  #.###.   #.#   #.#   ..# #   ... #   ...#ki0  #   ...# ki0 4  kiD -----23.5 (2kixH kiJ . _d - a +4 ring of slayingkiJkiKPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|put on[tab] equip|unequip kiͱkikiAE ludeguy the Apothecary  #.###?#.##Octopode  #........#Health: 17/17 ========================  .........#Magic: 3/5ki)==============----------  #........#AC: 1Str: 7  #........#EV: 12Int: 17  #........#SH: 0Dex: 12  #.......)############### XL:  2 Next: 16% Place: Dungeon:1  .......@................ Noise: ---------  Time: 543.5 (0.0)  kiT###.###.################ c) +0 dagger (protect)  #.#Cast: Poisonous Vapours  #.#######  ..##.....  ...#.....  ...#ki#.....  ...#######  Poisonous fumes billow around the kobold!  ki@TThe kobold looks even sicker. _You kill the kobold! _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _Found a scroll labelled WUDUAD WOSIRHE. _d - a +4 ring of slayingkiki-4.0 (0.5kiki5 _d - a +4 ring of slaying (worn)ki 3ki kiX ki ki ki| ki] ki Q4=====ki ki ki ki6 ki ki ki: ki ki" kiZ ki2 kil 6=====kit ki? kiy ki ki^ ,ki ki ,kix ki ki ki+ ki ,ki ki  ,ki ki ki  #5ki# ,=====ki[ ki& ki/ kin ki kis ki    . [.#.#  #. #.#.#  #.###?#.##ki  ##..# ...# ki b #..# ki   #........#   ## 60.0 (16.ki1 0) kiS  #.......)####  ........................  kiu ~ #####.###.########  ki #. #.# #. #.# ####ki    # ..# #...ki1     ... #...   ...##... kiv! ki! %1.0 (17ki% ki( H _Found a ring mail.ki7F3kijHkiKki*RBkiSkiUkiV======kiWkiZki\ki]ki^kiakic,kikkimkis,kiduki.y,kizki4 _d - 3 scrolls labelled WUDUAD WOSIRHE (gained 1)kii3kiǂkioki0kimkibkikikikikikiAkiukikiki:kizkikiki2kinki~ki5kic  You encounter a bat.kie .#  #. #.#.#  #. #.#.#  #. #.#.#  #. ##.#.#  #.####....# ki]6 #b#.......#  #.#.##....#  #.@...[.#.#  ###.###.#.#   #.###.#.## Poisonous Vapours  ###........#  ...........# ki֥= ###........# b   bat (asleep)  #........# #........# #.......)########kiE-73.0 (12ki*34.0 (13 _kiki)W .#  #. #.#.#  #. #.#.#  #. #.#.#  #. ##.#.#  #.####....#  #b#.......#  #.#.##....#  #.@...[.#.#  ###.###.#.#  #.###.#.##  ###........#  ...........#  ###........#  #........#  #........#  )ki .#  #. #.#.#  #. #.#.#  #. #.#.#  #. ##.#.#  #.####....#  #b#.......#  #.#.##....#  #.@...[.#.#  ###.###.#.#  #.###.#.##  ###.....kiĿ ........ ###........#  #..... #...... )kikikinkiZ _A bat is nearby!ki'    #.. .#   #.# #.#.#  #.# #.#.#  #.# #.#.#ki=  #.# ##.#.#  #.####....#  #b#.......#  #@#.##....#  #.....[.#.# ###.###.#.  #.###.#.##  ###........#ki;  ...........# ###........#  #........#  #..#kiki85.0) _kiZkikiU  bb  poisoned)Poisonous fumes billow around the bat! The bat is poisoned.4-----=6ki Z ki\ T _The bat closely misses you. x2kiLv .  You hit the bat.  Your weapon exudes an aura of protection.kiz----- 8 207Poisonous VapourskikiG _You kill the bat!kih3kihkim 1 kinkiokiokipkir,kiski5uBkiv,kicwkix,kiyki{kiB{ki|ki}ki}O5=====ki~ki2kikikiЃkiYkiki<kikikiEkiuki̇kikiki5======kikiȌkikikiki4kiё,kikizki,kiukikikięki?kikiki)kiki[kiki&,kikiZki2,kikiskikiբkikiki,kikikiH,ki6kiki,kikikiBkirkiTki)kiײ,kigkiykiNkikikivki,ki{ki'ki,kiykiki,kikiYki,kikikiBkikikikikiki,kikiKkiGkikiki>ki'ki^kikioki_kikifkikikikikiki,ki4kikimkikikicki,kiRki~ki{kiki9kikiki!kikiki6kikikiSkikikiKkiki,kikiki,kikiki ,ki ki kiki-kikikidkiki _d - 4 scrolls labelled WUDUAD WOSIRHE (gained 1)kiAkikiki9ki ,kix kiv"ki#ki#ki %ki'ki),ki{*ki+ki,ki,ki-ki.ki0,kia1ki+3ki4ki4ki5ki7kiQ9,kiA:ki3<ki=ki3>ki>ki@kiB,kiCkiZHkiIki[JkiJkiMki{N,kiOkiPkiQ,kiRkiSkiT,kiUkiUkiVki'VkiVkiVkiuWkiWkiWkiXkiY,kidYkiSZki [Bki[ki\ki\ki0]ki^kiy^ki^ki^ki_ki&`,kigj-  You encounter a goblin. It is wielding a +0 club.      ###  #.#  #.# ###################.# g......@............#- .#########......###.# #.......#.####.# #.#kik #.#####.#.#..#. #.# #.# #.#.#..#.###.#### #.# #.#.#..#......... g   goblin (asleep) #.# ##.#.#..#......... #.####....#............ #.#.......#.##.........kiq1651.0 (74.0)ki^rM-2.0 (75 _kivkiyki.    ###  #.#  #.# #.#  #g.............#  #.#......###.#  #.......#.####.# #.#kiK   #.#####.#.#..#.# #.#  #.# #.#.#..#.###.  #.# #.#.#..#......  #.# ##.#.#..#......  #.####....#.........  #.#.#.##......ki"G3.0 (1.0)kiH(ki ###  #.#  #.#  ###############  #g.....@.......  #.#########....  ##.# #.#   #.#  #.#  #.#  #.# kiV### #.# #.#  ###############  #g.....@.......  #.#########....  ##.# #.#  ki  #.#  #.#  #.#   kiki6kiki] _A goblin is nearby!kiC  ###  #.#  #.#  ###############  #g.....@.......  #.#########....  ##.# #.#   #.#  #.#  #.#  #.# ki ### #.# #.#  ###############  #g.....@.......  #.#########....  ##.# #.#    #.#  #.#  #.# ki#   ki kis ki( kiK ] _A goblin is nearby!ki &    ###  #.#  #.#  #.#  #g.#  #.#......###.#  #.#.####.# #.#   #.#####.#.#..#.# #.#  #.# #.#.#..#.###.  #.# #.#.#..#  #.# ##.#.#..#  #.####....#  #.#.#.##ki ki5 -4 _ki- ki kiI4kiN$ kiVO_You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki%    ###  #.#  #.#  #.#  #g.#  #.#......###.#  #.#.####.# #.#   #.#####.#.#..#.# #.#  #.# #.#.#..#.###.  #.# #.#.#..#  #.# ##.#.#..#  #.####....#  #.#.#.##kiKkiI-5 _ki kiki[ ki ki ki8 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki, 4kiY kiz _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki       #.  #.  #.  #g.  #.#......###.  #.#.####.# #.ki]   #.#####.#.#..#.# #.  #.# #.#.#..#.###.  #.# #.#.#..#  #.# ##.#.#..#  #.####....#  #.#.#.##kim kiW I6Poisonous Vapours _ki ki ki2)You can't see any susceptible monsters within range! (Use Z to cast anyway.)You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Poisonous fumes billow around the goblin!  The goblin is poisoned.  The goblin shouts!kiORki4-----5====7Poisonous VapourskikiJ _You kill the goblin!kid|4kikiq _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki bki|bkiekigH _No target in view!ki| ki} ki} ki9 ki^ | _ki ,ki΅ ki) ki ;-----ki ki ki' ki* ki kiG ki kil ,ki ki ki9 ki ki2 ki` ki ki ki O5=====ki kiE kiH ki kik ki kiݛ ki ki ki֝ kiߞ ki ki ki kii ki ======ki kiܥ ki ,ki ki ki ki( ki+ nkil ki ,ki ki kiǵ ki kib ki ki ki kiȹ ki kiɽ ki ki ki ki| ,ki ki ki ,ki ki kiF kiw kiP kio ki ,ki ki ki ki8 ki ki ki ,ki ki ki ,ki ki ,kiP ki2 ki5 ki ki5 ki] ki; ki ki ki ki ki ki kio ki^ ki ,ki ki ki ,ki kib ki kiK ki ki ki ki ki ki} ki8 ki~ ki ki ki ,ki ki ki ki ki ki ki} ki ki ki ki ,ki ki ki, ki ki ,ki| ki ki ki ki? ki ki~ kiq kiz ki ki! ki" ki# ki@# ki# kiD$ ki$ ki"% kiq% ki' ki) kiS) ki* ki* ki+ ,ki, ki, kij- ki- ki- ki. kif/ ,ki0 ki1 ki1 ki1 kiw2 ki3 ki3 ki3 ki64 ki4 kiy5 ki5 ki5 ki'8 ki8 ki+9 ki9 ki!@ kiA ki7A kiA kiIB kiB kiC ki.........  #........##.#...........ki4d  #.#.......... #### #.#..........kid > ####...####.#### #......@....# ---- kid #.##...  #... #...kid  #... #...J   endoplasm (asleep)kie o #..J kiDe 8#... kii 1724.0 (67.0)kim f----5.0 (68 _kiq   #.# #.#   #.   #.#...)   #.#.>   #. #. #### #. ####...####.# #......@....#  #.##...######  #... #... #... #... #..J #...kiv k  #.# #.#   #.   #.#...)   #.#.>   #. #. #### #. ####...####.# #......@....#  #.##...######  #... #... #...kiL  #... #..J #... ki@kikikia _An endoplasm is nearby!ki%  #.# #.#   #.   #.#...)   #.#.>   #. #. #### #. kit&)####...####.# #......@....#  #.##...######  #... #... #... #... #..J #...kiw  #.# #.#   #.   #.#...)   #.#.>   #. #. #### #. ####...####.# #......@....#  #.##...######  kix_#... #... #... #... #..J #... kip}ki}kikia _An endoplasm is nearby!kic  #.# #.#   #.   #.#...)   #.#.>   #. #.ki:d #### #. ####...####.# #......@....#  #.##...######  #... #...kiVd #... kiod#... kid\#..J #...kiM  #.# #.#   #.   #.#...)   #.#.>   #. #. #### #. ####...####.# #......@....#  kiT#.##...######  #... #... #... #... #..J #... kikikikiza _An endoplasm is nearby!ki"'a #.# #.########.## #.# #.#...)...... #.# #.#.>. #.# #.#. #.###### #.#####...####.########### #...........#  #.##..@###### #...#  #...# #...#ki'W #...# #..J# #...# #...#kip+ki,86.0 (1.0) _ki.ki0ki 4ki# kil% b _No target in view! _You encounter an endoplasm. _An endoplasm is nearby! __You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiE ...)......>...#########...####.############...........# #.##...###### #..@# kiF -J.ki L kiL -7 _kisO kiP ki]zki{kiQki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki 4kiki~  _An endoplasm is nearby! _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _ki >...#########...####.############...........# .##...##### #...# kiJ.S   ball python (constriction, asleep)Skiki?8Poisonous Vapourskiki7 _You can't see any susceptible monsters within range! (Use Z to cast anyway.) __You encounter a ball python.kiki4-----Contam: 10% 9ki;kiO _You miscast Poisonous Vapours. Nothing appears to happen.kis J.  Poisonous fumes billow around the endoplasm!  The endoplasm is poisoned.kidJ  poisoned)kir3----------=30kikif^ _The endoplasm quivers.ki- j J.  Poisonous fumes billow around the endoplasm!ki71 Fvery poisoned)ki1 o2----------1ki4 kiE7 6 _The endoplasm looks even sicker.ki`0  #.#.>    #####  ####...# #...........#  #.##...######  #...# #..@# ki0#..J# #...# #...# #...# #...# #...# #S..#ki1kiW  #.#.>    #####  ####...# #...........#  #.##...######  #...# ki#..@# #..J# #...# #...# #...# #...# #...# #S..# ki kiki2z _There are monsters nearby!kiT~ .  You hit the endoplasm.  Your weapon exudes an aura of protection.kiA!S   ball python (constriction, asleep)ki$----- 8 92Poisonous Vapourski8(ki*M _You kill the endoplasm!ki8? #.# #.#. #.###### #.#####...####.########## #...........#  #.##...###### #...#  #...# #.@.# #...#ki9 #...#  #...#  #...# #...# #S..# #...#ki?kio?.-3ki*CkiDki u   #####  ####...## #...........#  #.##...######  #...# #...# #.@.# #...# #...# #...# #...# #...# ki ^#S..# #...#ki$ 6   #####  ####...## #...........#  #.##...######  #...# #...# #.@.# #...# #...# #...# #...# #...# #S..# #...# kiR) ki) 8-ki, kiY/ b _A ball python is nearby!ki05C#########...####.##########...........# ##...##### #...# Sg   goblin (.b   bat (asleep)gbS   ball python (constriction, asleep)ki<ki`=9 1 4kii@kiBa _You encounter a goblin and a bat.ki@#########...####.##########...........# ##...##### #...# S.gb.###ki$ki$&5ki})ki*ki4-4ki50ki1 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kib 4kid ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki-F ####...####.##########...........# ##...##### #...# S.gb.####. kijL kiM e8% 6Poisonous Vapours _kiV ki b.  Poisonous fumes billow around the ball python!  The ball python is poisoned.kix6b.ki6S.ki2 ng..bkiYgbwandering)S  poisoned)kih1-----6==ki. 7kikiA5 _The ball python hisses angrily.kiz †Poisonous fumes billow around the ball python!  The ball python looks even sicker.ki,lb.b.ki g.kiq6b.kiy)ki0---------433-8Poisonous VapourskiѝkiO _You kill the ball python!kiki1-kikiK _You are out of magic!kiƨ kiU kil ki K _You are out of magic!kikihkikiT!K _You are out of magic!ki9 .  You miss the bat. You grab the bat. You constrict the bat.g.ki>)kiA~1====279Poisonous Vapourski GkiIG _You kill the bat!kit...........# ##...##### #...# g..#.####..kikiGA140kiӚki[L _The goblin misses you.ki  You barely miss the goblin. Your grab misses the goblin.The goblin hits you with a +0 dagger.kiɳc3------1kiIkiK _Your magical contamination has completely faded away.ki? )You hit the goblin.  Your weapon exudes an aura of protection.kiq )ki ==== 8 412Poisonous Vapourski4 ki@ ki J _You kill the goblin!kirbkibkicki9dkiFh4=----- 1 kihki~jkijkikkip5===kifqkir,kiskitki4ukivkiwkixj==2=====kiykizki?{K6=kiO|ki(Bki,kikikie======kikikik9=kiCki9b7==kiokikikikiԍkikikikikikiHP==kikiVki;3=====kikikiki1,ki,kiki4=====kikiʡ,kiCkiO,kikin,kikikikiEki/,kikiCkikiwkikiQ4=====kiki4kikinki:BkiϷ,kikiki;======kikirkikiykiϾki7kiQXkiki4kiki,kikiki-kiki;e5=====kikiki"kikikiki.kikiki======kikikiHkikikikikiki,kikikiFkikikikikiki!ki,kipkih  You encounter a goblin. It is wielding a +0 club.kia  #...# ki7 #...#  #...#  #...#  #...# ki# #.).# g #...#  .#####.######...#  .......@........#- kiaa ######.#####.#### ... #.#Poisonous Vapours #.### #.# # #.#  #.#g   goblin (asleep) kio #.#  ..#ki"ki 093.0 (51.0)kiMM-4.0 (52 _kii kiki; .g  Poisonous fumes billow around the goblin!  The goblin is poisoned.kicg  poisoned)ki94-----kiI====5.0 (1.0)kiki( _The goblin shouts!ki )  You barely miss the goblin. You grab the goblin.  The goblin is heavily wounded.You constrict the goblin.ki(kiɞ-----5=---6Poisonous Vapourskiki6J _You kill the goblin!kiR0P---ki4ki7 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki4ki\kiH _No target in view!kikikikiki* _ki ,kikikiNki,kikiN,kikio,kiKkikikigkikiO5=====kikiki|,kikiki,kikikikiyki$kipi=====ki}ki<  You see here a +0 club.ki5 _ki9kiki ki0 ki! kiJ ki ki ki ki ki ,ki ki1 kiz ki ki ki ki ,ki] ki ki ,ki kig kiy ,ki ki ,kiO ki ki <  You see here a +0 club.ki kip  _ki: ki ki! kiv" kiD# ki*$ ki% ,ki& kii( ki<) ,ki) ki. Xkit/ ki7 ki7 ,ki39 kiD: ki; ki*< ,ki= kiJ> ki? ,kiD@ kiSA kiA ki9B ki&D kiE ,kiF kiF ki%H ,kiH kixJ kiJ ki#K kigK kiJL kiL ,kiL kiM kiO kiOO kiO kiKQ kiR ,ki/S ,kiS ,kiwT ki(U kiU ki V ki5V kiW kiX ,kimY kiMZ kiZ ki_[ ki[ ki\ ki] kig^ ki_ ki` ki.b ,kib kiMd kie kie kif ki*h kih ki#i kii ki]k kikl ,kil kim kin kin ki@o kip kip kiGq kiq ki~r kir kiCs kis kiv kiw Bkix ki2z ,ki{ ki| ki} ki} kiI~ ki@ ki ki kiΈ ki5 ki ki݌ ki Xki ki[     #.# ##### ki  #.# ####...#  #.# #.......  #.# #.##...#  #.# #.##...# ki  #.# #.##...#  #.# #.##...#  #@# #.##...#-  #.# #.##...# kii  #.# #.##...#  #.# #.##...#  #.# #####.##.).# ki  #.# #.....##...#   ##.#####)######...#   #.................# kiS   ########.#####.#### ki` 1853.0 (57.0)kiԡ F-4.0 (58ki ki? S _j - a purple potionki3kikiחkiki kinkikikiMkikiki,kiBki,kikikizkiɪkikikikiWki3ki԰,ki+kiײkióki>kikiki`kikikikir,ki*kiki,ki\kiekiEki,kikikikikikirkiki1ki7kiki,kikikiskiki kiki}kikikiki,kiki%kikiHkiNkikikikifkiki{ki ki kikikikikikikiki'kikifkikikiki#ki!ki ki ki^ kim kiki7kiki2kiki,kiki_ki=kikiukikiP ki ki"ki.ki0ki`1ki62kiB7ki!<Bki?kiAkiiBkiVCkibIkiIkiIJkiZKkibPkiRkiURki5SkinWkiY,kiZki^kie`ki`kiinkiHlkimkinkiokivrkiski7tkitkimwkiRykiykizki}ki~kikiYkitkikiskitkiBkikikikiōki2kiBkiZkiki>kinki8,ki5ki}kiki_kikiߛkikikiwkikiRkiUkiki_kikikiSkiتkikiEkikiki,kikikikiki&kinkikiVkikikiki!kikikiki',kikiki,kiki}kibkikikiki#kikikikiykikiUkikipkiki kikikikikiki,kikikikiki&kickiki,kiWkiki7,kikikikikiki-kikifki,kiE....# #.....# ....# ######### #.....## ....# ...$...# #............ ki....# >.....# #..)..####### ....# .....# #............ ....# ....######....####. ....# ................#. ....# ######.......[> ....# #######@#######.###.#...929.0 (75 ki*##### #.................#.### #.#####.######.##.#.##.. #..........#.##.#.## ######## #.###.####.#.##.#.## ki.......# #.# #... #.##.#.## ######.# #.# ##### #.##)#.## #.#####.### ####.##.#.## ######.##......# #.......#.##.ki kiR -30.0 (76kiIkiT; _Found a stone staircase leading down.ki8ki>Xki?ki@kiAki(BkiBkiwDkiEkiEkiFkiHki0IkimIki*JkiKkiLkiLkiNki6P,kiPkiUL _You now have 24 gold pieces (gained 4).kiV3kiWkiYkiZkiX[ki \ki]ki(_kib_kiB`kiakic,ki+dkioekiIg,ki:hki[ikiij,kikkilkinkisnkioki5pkigqkiqkiXrki;skiut,kitkiukivkivkiwki{ki{,kiA}ki+~ki,kiAkiSki7kidkikikiڄki.kikikiM,kikiƈki,ki4kikiӋkikikikiykikiWkiki,ki9kiVki!kidkiؔkikikikihkikiEkikikiikiRkikikikiAkikiơM _You now have 38 gold pieces (gained 14).kikikikkikikiƥkiOkiEkikiJkiͨkixki,kiwkiîkip,kikiki,kibkiųkikiOkiܴkiٵkiukiki7kiki۸kikiwkiBkiCL _You now have 43 gold pieces (gained 5).ki&IkikiJkixkiki,ki*Bki,kikiki1ki,kickinkikiEkiki]kik,kikiEkiki6kiwkikikikiWkikii,kiki1kimBkiki?kiS ,ki ki  ,ki kiD ki kiZ ki ki ki kis ,ki1 ,ki ki ,ki" ki kie ,ki ki ki ki5 ki ki" ki# ,ki&% ki& ,kil& ki& ki( ki$) ki) kiA* kiu+ ki+ ki, ki@- ki. ki/ Bki>1 ki2 ki[2 ki2 ki4 ki\5 ki5 ki6 ki7 ki8 kiH9 ki9 ki; ki< ki< ki_= ki> ki?? ki? kig@ kiA kiA ki====1kiki;f _The kobold throws a stone. The stone misses you.ki[0^  You miscast Poisonous Vapours. Nothing appears to happen.kip6](((((((ki_PJ!ki{k..@....kil3----------Contam: 10% =---2kivki$m _The kobold throws a stone. The stone barely misses you.kiO  #..##  ############  #....K?....#  #..........#  #..........#  #......@...# #...#  #..........# ).# #..........#  #..........# #..J......... #..!.......### #..........#  #######.####  #. kino   #..##  ############ ki p  #....K?....#  #..........#  #..........#  #......@...# #...#  #..........# ).# #..........# kiq  #..........# #..J......... #..!.......### #..........#  #######.####  #. ki| ki} ki\~ 3---ki߈ kiH d _There are monsters nearby!kiP~ )Poisonous fumes billow around the kobold!kiSQ'J.kiY)ki\x2----------503kickifJ _You kill the kobold!kirk J.  Poisonous fumes billow around the endoplasm!kivU (poisoned)kie1----------4kikiV0 _The endoplasm is poisoned.ki k J.  Poisonous fumes billow around the endoplasm!ki Fvery poisoned)ki a0---------5ki' ;Poisonous VapourskiV ki 6 _The endoplasm looks even sicker.kiki=kilkiK _You are out of magic!ki{  You hit the endoplasm.  Your weapon exudes an aura of protection.  The endoplasm is heavily wounded.ki|M 8 6kiAkiW _The endoplasm closely misses you.kil .  You hit the endoplasm.  The endoplasm is almost dead.kiXrSkinuB----8kiu 7kid|ki[M _You kill the endoplasm!kip kiq kiw kiy H _No target in view!kiD 3ki, ki kiU P _ki 98% kiu kie ki 76ki: kir ki 1==== 1 4ki ki kiO 72kiN kiu kiѳ 71kiq ki ki 'ki ki Z _Your magical contamination has completely faded away.ki <====kiͿ ki ki7 ki ki( ki~ ki ki> ki ki' ki ,ki> kiN ki ki/ ki 2=====ki: ki kiu ki ki ki ki ki ki ki ki kiE ======ki ki kiT ki ki ki> ki ki| nki ki kiC ki ki ki% ki ki kiM Q3=====ki ki kij ki ki kid ki ki ki ki ki ki ======ki ki ki5 ki ki ki  ki ki" ki" kis$ ki& ki' ki{( ki* ki* kiW, kia. ki. ki80 ki?2 ki2 Q4=====kib4 ki6 ki6 kic8 kiv: ki: kiF< kiP> ki> ki@ kiA ki;B ======kiC kiF kimF kiG kiP ki;Q kiR kiU ki2V kiX ki[ kiY[ ki\ ki^ kiC_ ki` kib ki)c kid kih ,kip {5=====kir kiw ki ki ki* ki kiy kiy kiP M..# #.#...........###..#### #.#...........# #..####### #.#...........###..##...####.##############..## ...........# ki O# .##...###### #..## # .##...###..# .##...# ############. .##...# #....)@....# ##..#..- .##...# #..........# #..##... .##...# #..........# ##..###.. .##...# #kib ....# #...# ## .##...# ## #...##### .##.).# #...# #........ .##...# #ki  !.#### ###...# #.....................# ......# #..!.......##########.#ki 089.0 (52.0)kib g=====-90.0 (53ki kiB c _e - a scroll labelled TACSIO LOMUTIkikiXkiA"ki+F #.##...# #....).....# ##..#  #.##...# #..........# #..##  #.##...# #..........# ##..##  #.##...# #..........# #...#  #.##...# #..........# #...## ###.##.).# #..........# #. ....##...# #..........####. ######...# #............... .........# #..@.......######### #####.#### #..........# #.. # #.# #######.#### #.#### # #.# #.iG39;49m  #.# #.#  #.# #####.# ......# #######8.0 (8.0)9.0 (9 _k - a fizzy emerald potionki ki BkiD kiq ki kir ki ki* ,ki ki/ ki ki ki ki ki kiF ki ki ki9 kik ki kiH ki kiD ki ki| ki ,ki ki& ki ,ki ki kiD ki ki ki ki ki ki> ki kiT ki ki ki( ki kiJ ki kii ki! kiX ki ki kiV ki ki kiA ki! kix ki ki kiF ki| ki ki ki ,ki ki kiR ki ki ki ki ki? ,ki1 ki ki kiF ki ki" kiW ki ki ki ki ki ki ki' kie ki) ki ki ,ki. ki ki kir ki kiI kiH ki kiC ki ki ki ki kio nki ,kiB! ki" ki# ki# ki\$ ki% ki% kiJ& ki& ki) ki* kiq* ki* ki, ki, ki- ki- ki. ki6/ ki/ kiP0 ki1 ki]2 ki2 ,ki4 ki4 ki4 ki/5 ki.6 ki6 ki17 kiq7 ki8 ki'9 kit9 ki9 kiZ ###.# #..............# ....# #......#.####### ##### #....#.#.# #....#.#.# #....#.#.# #....#.#.# #......#.# #.######.# #.......@#139.0 (4ki5[ 0.0) ########.# ###         ki[ ki#_ kia E _Done exploring.ki kiF 3ki .# #. ....# #.............0.0)ki ki ki:  kir 7_Done exploring.ki ikiikiQkkikihkiwkiAE _Done exploring.kiIkiϘkikikiϟE _Done exploring.ki?. ki. ki12 kin4 H _No target in view!ki 3ki kid ki ki B _ki[ ki| Bki ki% ki ,kiO ki ,kiM ki ki ,ki^ ,ki ki  kiT Bki ki ,ki ki ki ki ki( kid kiB" t......# ##...#........#..####.........#.#.........# .................#..#........#.# ki" J......##########.##...#........# ......# #.........#.##.#####.## ##.#### #.#####......#.# #.##.# #.# #......#.#####.##.#######.# #..............##.........# #@.....#.#######52.0 (13.0)  kiX# #.######### #....#.#.##.#....#.#.#####....#.#.##....#.#.# #......#.# #.######.# #........# ki# 5########.#ki$ ki( ki) kii ki kie ki kir ki  kim ki ki kip! ,ki! ki# kiq# ,ki# ki$ ki % kiP% kit% ki-& ki& ,ki' ki' kiw( ki( ki( ki-  ##..###......### ########## ##..##.......##.).....# ##..#.............#.....# #..##.....##.....# ##..###.........###.( .........# #...# ##.......## #.. .........# #...#######.#######.. .........# #........#...#....... ..####...@.........60.0 (8kia. .0) ....................#..#........# .........##########.##...#....... .........# #.........#.##.#####. #####.#### #.#####......#.# #.#.# #.# #......#.#####.#.#######.# #..............#.........# #......#.#######.######### #....#.#.#ki1 ki2 kiRkikiUkikickiBki$,kikirkijkikiBkiw kiy ki ki- ki: ki kiX ki kiki,kiOkihki$kigkikikikikipki#.#...).......##...#######.##  #.#.>...........>..# ##.##  #.#...........###..###..#  #.#...........# #..##..  #.#...........###..#..... ##.##############..##....ki2Z# ##..###.......... #### #..## #......< ##@.###....8  ############ ##..##....  #....).....# ##..#.....  #....# #..##.......... ki #..........# ##..###.........##..........# #...# ##.......## #..........# #...#######.##### #..# #....#... #..........####.........#.#.... kiCki"ki#kiGkiH3kirQkiQ,kiUnkifWki1XkisXkiXkiZki[ki[kio\ki]ki^ki^kis_ki`kiakibkibkiTdkibekiekifkiiP  There is an escape hatch in the floor here.kijki\k _kikkimkinkinkiokiqkiskiMskitki'vkiRwkiwkixkizki|,ki}kikikiTkiRkikikikiƆkikikikikikiki5kikiki kiNkiki(kiFkikiYkikiȕki kiΖkiȝF.#.#.# #######.##......# .....###########........ ....##.......# .....########.##..........##.#### .....# #.########.#####.#### .....# #.# #.# #..##.########.##### .....##.#...).......##...## .....##.#.@...........>..# 87.0 (19.0) ki"V.....# #.#...........###..## .....# #.#...........# #..## ########## #.#...........###..####...####.##############..##..# ##..###.kib##...###### #..## #.##...###..###kiz##...# ############ ##..##ki$kikic _There is a stone staircase leading down here.kiki3kickiB ki88.0) _kiXki7&2ki #####  ....#.#  ##.......  #@....#  #######  ki/!-9.5 (2.5ki%kiA'# _You climb downwards.ki)a _There is a stone staircase leading up here.kibJkiLRead which item? Scrolls  c - a scroll labelled ALYSTR OFUYMY  d - 4 scrolls labelled WUDUAD WOSIRHE  e - a scroll labelled TACSIO LOMUTI [!] read|quaff[?] describe selectedki  c - a scroll labelled ALYSTR OFUYMY  d - 4 scrolls labelled WUDUAD WOSIRHEki, kiY2 kiU9 ludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1Str: 7#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#kiT: Noise: ---------  Time: 1189.5 (0.0)#######c) +0 dagger (protect)Cast: Poisonous Vapours _Done exploring. _No target in view! _There is an escape hatch in the floor here. _There is a stone staircase leading down here. _You climb downwards. _There is a stone staircase leading up here.kir<  As you read the scroll labelled WUDUAD WOSIRHE, it crumbles to dust.  It is a scroll of identify.kiG /  --more--kikiQIdentify which item? (\ to view known items) Scrolls (select first with ?)  c - a scroll labelled ALYSTR OFUYMY  e - a scroll labelled TACSIO LOMUTI Potions (select first with !)  f - a viscous grey potion  j - a purple potion  k - a fizzy emerald potion[?] describe selectedkiskiWkiludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1Str: 7#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1189.5 (0.0)#######c) +0 dagger (protect)Cast: Poisonous Vapours _There is an escape hatch in the floor here. _There is a stone staircase leading down here. _You climb downwards. _There is a stone staircase leading up here.  As you read the scroll labelled WUDUAD WOSIRHE, it crumbles to dust.  It is a scroll of identify.kiki,90.5 (1kiki9{ _f -> c - a potion of curing; d -> i - 3 scrolls of identifykikisRead which item? Scrolls kibg i - 3 scrolls of identify  c - a scroll labelled ALYSTR OFUYMY  e - a scroll labelled TACSIO LOMUTI [!] read|quaff[?] describe selectedkiFkikiludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1Str: 7kiPy#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1190.5 (0.0)#######c) +0 dagger (protect)Cast: Poisonous Vapours _There is a stone staircase leading down here. _You climb downwards. _There is a stone staircase leading up here.  As you read the scroll labelled WUDUAD WOSIRHE, it crumbles to dust.  It is a scroll of identify. _f -> c - a potion of curing; d -> i - 3 scrolls of identifykiki`Identify which item? (\ to view known items) Scrolls (select first with ?)  c - a scroll labelled ALYSTR OFUYMY  e - a scroll labelled TACSIO LOMUTI Potions (select first with !)  j - a purple potion  k - a fizzy emerald potion[?] describe selectedkikiki$ludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1Str: 7#####EV: 12kih%xInt: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1190.5 (0.0)#######c) +0 dagger (protect)ki%Cast: Poisonous Vapours _There is a stone staircase leading down here. _You climb downwards. _There is a stone staircase leading up here.  ki &As you read the scroll labelled WUDUAD WOSIRHE, it crumbles to dust.  It is a scroll of identify. _f -> c - a potion of curing; d -> i - 3 scrolls of identifyki|/]  As you read the scroll of identify, it crumbles to dust.ki0+1.5 (1kiW4ki65 _j -> b - a potion of brilliancekiT(kiK)Read which item? Scrolls  i - 2 scrolls of identify  c - a scroll labelled ALYSTR OFUYMY ki) e - a scroll labelled TACSIO LOMUTI [!] read|quaff[?] describe selectedµkij µkiq µkiv }ludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1µkiov Str: 7#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1191.5 (0.0)µkiv P#######c) +0 dagger (protect)µki&w Cast: Poisonous Vapours _There is a stone staircase leading up here.  As you read the scroll labelled WUDUAD WOSIRHE, it crumbles to dust.  µkikw It is a scroll of identify. _f -> c - a potion of curing; d -> i - 3 scrolls of identify  As you read the scroll of identify, it crumbles to dust. _j -> b - a potion of brillianceµkix µkiz Identify which item? (\ to view known items) Scrolls (select first with ?) µki8z m c - a scroll labelled ALYSTR OFUYMY  e - a scroll labelled TACSIO LOMUTI Potions (select first with !)  k - a fizzy emerald potion[?] describe selectedõkifõkilõkixludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1Str: 7#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1191.5 (0.0)#######c) +0 dagger (protect)Cast: Poisonous Vapours _There is a stone staircase leading up here.  As you read the scroll labelled WUDUAD WOSIRHE, it crumbles to dust.  It is a scroll of identify. _f -> c - a potion of curing; d -> i - 3 scrolls of identify  As you read the scroll of identify, it crumbles to dust. _j -> b - a potion of brillianceõki]  As you read the scroll of identify, it crumbles to dust.õki+2.5 (1õki9õki8 _k -> e - a potion of enlightenmentõki4õki5Read which item? Scrolls  i - a scroll of identify õkiH6> c - a scroll labelled ALYSTR OFUYMY  e - a scroll labelled TACSIO LOMUTI [!] read|quaff[?] describe selectedĵkioyĵkiĵki>ludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5========================AC: 1Str: 7#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1192.5 (0.0)#######c) +0 dagger (protect)Cast: Poisonous VapoursIt is a scroll of identify. _f -> c - a potion of curing; d -> i - 3 scrolls of identify  ĵkiAs you read the scroll of identify, it crumbles to dust. _j -> b - a potion of brilliance  As you read the scroll of identify, it crumbles to dust. _k -> e - a potion of enlightenmentĵkiĵki Identify which item? (\ to view known items) Scrolls (select first with ?)  c - a scroll labelled ALYSTR OFUYMY ĵki e - a scroll labelled TACSIO LOMUTI[?] describe selectedĵki ĵkiR ludeguy the ApothecaryOctopodeHealth: 17/17 ========================Magic: 5/5ĵki F========================AC: 1Str: 7#####EV: 12Int: 17....#.#SH: 0Dex: 12##.......XL:  2 Next: 58% Place: Dungeon:2#@....#Noise: ---------  Time: 1192.5 (0.0)#######c) +0 dagger (protect)ĵkiI Cast: Poisonous VapoursIt is a scroll of identify. _f -> c - a potion of curing; d -> i - 3 scrolls of identify  ĵki As you read the scroll of identify, it crumbles to dust. _j -> b - a potion of brilliance  As you read the scroll of identify, it crumbles to dust. _k -> e - a potion of enlightenmentĵki ]  As you read the scroll of identify, it crumbles to dust.ĵki* +3.5 (1ĵkiA ĵki7 X _c -> V - a scroll of vulnerabilityŵki">ŵki>3ŵkiG@ŵkiB,ŵkivF,ŵki1Gc  You encounter a rat.ŵkiLŵkiMQ###. .#####.##### ....r......#.##...#<....#.#########Poisonous Vapoursr   rat (asleep)ŵkiS&4ŵkiT25.5 (2 _ŵkiXŵkiZŵkiM| ## #. .#####.#####  ....r......#.#.  ##@.......  #<....#.##  ####### ŵki ## #. .#####.#####  ....r......#.#.  ##@.......  #<....#.##  #######  ŵkiŵki>ŵkiŵki ŵkiZ _A rat is nearby!ŵkizr .#.#.# .## ##.. #.. #.#####.##### #....r.@....#.#.########........ #<....#.#########ŵkiy ŵkikz 26.5 (1 _ŵki ŵki Ƶkif .# .# .# # .##.# ##..r. #... #.#####.##### #....r@.....#.#. #. #<....#.## #######Ƶki9Yr 2 rats (asleep)Ƶki <7Ƶki Ƶki.T _You encounter a rat.ƵkiM †The helpless rat fails to defend itself.  You puncture the rat!  Your weapon exudes an aura of protection.Ƶkio   ratƵki 8 628Poisonous VapoursƵkiƵkiG _You kill the rat!Ƶki+.. .# .# .# #  .##.#####..r...# #.....# #.#####@##### #....†......#.#. ########........ #<....#.#########Ƶki,Ƶki4ƵkiP5?9Poisonous VapoursƵki=:Ƶki3<Ƶki  .. .# .# .# #  .##.###  ##..r...#  #.....#  #@#####  Ƶki#....†......#.#.  ########........  #<....#.##  ####### Ƶkil  .. .# .# .# #  .##.###  ##..r...#  #.....#  #@#####  Ƶkim #....†......#.#.  ########........  #<....#.# ####### Ƶkit ƵkiYu Ƶki8z Ƶki| Z _A rat is nearby!Ƶki ### #.. #.# #.# #.# # .##.### ##..r...#ƵkiZ  #.@...# #.#####.##### #....†......#.#. ########........#<....#.#########Ƶki% ƵkiO& /200 _Ƶki+ Ƶki- ǵkiO^### #.. #.# ###.# .#.# .# #.##.### ##..r...# #..@..# ǵki>_C#.#####.##### #....†......#.#. ######## # ǵki?fǵkif0 1 ǵkiLg 1ǵkilǵkimǵkio† _You kill the rat! _A rat is nearby!  The helpless rat fails to defend itself.  You puncture the rat!  Your weapon exudes an aura of protection.ǵki(ǵkiT 8 62ǵkiD;Poisonous VapoursǵkiPǵki G _You kill the rat!ǵki(ǵki)ǵki-ǵki_0H _No target in view!ǵkil Iǵki^n ǵkilp ǵkiZt : _ǵkiu _  You see here a rat corpse.ǵkiw ǵki&x 7 1 _ǵkiwx ǵkiy ǵkiz ,ǵki:{ ǵki| ǵki~ ǵki  ǵki} ǵkiD ǵki ,ǵki$ ǵkig ǵki1 ,ǵki ǵki ǵki ǵki ǵkiC ǵki ǵki ,ǵki| ǵkiz ǵki& ǵki ǵki$ ǵki ǵki ,ǵki ǵki ǵki ǵki ǵkiT ǵki ǵki ,ǵki ǵki ǵki ǵki] ǵki! ǵki. ǵki2 ǵki ǵki ǵki ǵkih c  You encounter a rat.ǵki0 R#.#########.##.....##.##.###.##.##.###.# ##..†...#.# #.....#.#.# #.#####.#####.#.# #....†......#.#.# ǵki =########......@.#  #<....#.###  #######.  ......... r   rat (asleep)..........rǵki 0164.0)ǵki ,7.5 (15ǵkiC ǵkia + _Found 13 gold pieces.ǵki0   #.##.....# #.##.###.# #.##.###.# ##..†...#.# #.....#.#.#  .#####.#.#  #....†......#.#.#  #......@.# #<....#.### #######. .. ... .... ..... .....rǵki"   #.##.....# #.##.###.# #.##.###.# ##..†...#.# #.....#.#.#  .#####.#.#  #....†......#.#.# ǵki  #......@.# #<....#.### #######. .. ... .... ..... ..... ǵki ǵkiz ǵki ǵki Z _A rat is nearby!ȵkiI  #.##.....# #.##.###.# #.##.###.# ##..†...#.# #.....#.#.#  .#####.#.#  #....†......#.#.#  #......@.# #<....#.### #######. .. ... .... ..... .....rȵkic%  #.##.....# #.##.###.# #.##.###.# ##..†...#.# #.....#.#.#  .#####.#.#  #....†......#.#.#  #......@.# #<....#.### #######. .. ... ȵki3F.... ..... ..... ȵki 4ȵki`ȵkiZ _A rat is nearby!ȵki #.##.....# #.##.###.# #.##.###.##..†...#.# #.....#.#.##.#####.#####.#.# #....†......#.#.# ########........# ȵki~ j#<....#@### #######.#  ..#......!r.......ȵki ȵki18.0)ȵkiȵkiT _Found a pink potion.ȵki=########..†........#.#.##.#####.#####.#....†......#.#.########........# #<....#.#########@# .................g.................!........r....g   hobgoblin (asleep)............#r   rat (asleep)#...!##ȵkiHi  You encounter a hobgoblin.ȵki|I&9ȵki0PȵkiR6 _Found a potion of enlightenment.ȵki` x##..†........##.#####.#####.#.#...†......#.#.########........ ȵki ?#<....#.#########.# ...........#g.......!..###r....#.....##...!#......?.ȵkie =20ȵki- ȵki  ȵki U_Found a scroll labelled GUUNGAOXEF.ɵki\p4ɵkivɵkiy _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ɵkiqRR##..†........##.#####.####...†......#######....... #<....#.#########.# ........####...#g.....!..###r....#.#...!#......?. .##ɵkiZɵki\I1Poisonous Vapours _ɵkibɵkicɵkiM $Poisonous fumes billow around the rat! The rat is poisoned.  The rat squeaks loudly. The hobgoblin shouts!ɵkiN r wYou kill the rat!ɵki^O A.gɵkiV w   dart slug (wandering)g   hobgoblinɵkiY w4-----70====ɵkiZ Z2Poisonous Vapoursɵkik` ɵkic Z _You encounter a dart slug.ʵki?^ʵki_ʵki.eʵkiYj _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ʵki  ##..†...#.# #.....#.#.# #.#####.#####.#.# #....†......#.#.# #........# #<....#.####.#.####ʵki u.#.g..!..###.$....#.##...!......## #.?.  #......w...##ʵki A.gʵki[ <----ʵki B3Poisonous Vapours _ʵki` ʵki ˵kiA w.  Poisonous fumes billow around the hobgoblin!g.˵ki^"U (poisoned)˵ki%#3----------=---4˵ki+˵ki-0 _The hobgoblin is poisoned.˵ki? †Poisonous fumes billow around the hobgoblin!  The hobgoblin looks even sicker.˵kid4w.˵ki)˵ki2----------95Poisonous Vapours˵ki˵kiAM _You kill the hobgoblin!˵ki>.....##.#####.#####.#.#...†......#.#.#######........ #<....#.##########.# .........####†......##......!..###$....# .##...!w.....#˵ki #.........?...###......#...[#˵kib'˵ki(.-6˵kiX.˵ki/M _Found a leather armour.̵ki%- _You can't see any susceptible monsters within range! (Use Z to cast anyway.)̵ki & #.#####.####...†......#######....... #<....#.##########.# .........####†......##......!..###$....# .##...!w.....# #.........?...###.......#...[#. ...#̵ki( 6w.̵ki1 Dw̵ki+3 I7Poisonous Vapours _̵ki: ̵ki< ̵kiF  (poisoned)  Poisonous fumes billow around the dart slug!  The dart slug is poisoned.̵ki `````The dart slug launches a dart at you.̵ki٘ ...@.1----------=8̵kiU ̵ki# O _The slug dart misses you.͵kiVo w.  Poisonous fumes billow around the dart slug!͵ki very poisoned)0---------9Poisonous Vapours͵ki6 _The dart slug looks even sicker.͵kiU4͵ki\͵ki_K _You are out of magic!͵ki~ .  You hit the dart slug.  Your weapon exudes an aura of protection.͵ki)͵kit---- 8 9530͵ki͵kiM _You kill the dart slug!͵ki&͵ki͵ki͵kiH _No target in view!͵ki4 I͵ki k  You encounter a ribbon worm.͵kij ww   ribbon worm (wandering)0͵ki) ͵ki :-1.5 (1 _͵ki ͵kic εkiF   #....†.#.#  ...#  #<....#.###  ########.# .........####  .....†......##.  w............... εkiT .......@..!..###  ........$....#  .............#  ##...!......##  #.........?..  #..........###  .......#...[#  ....... ...## εki   #....†.#.#  ...#  #<....#.###  ########.# εkit.........####  .....†......##.  w...............  .......@..!..###  ........$....#  .............#  ##...!......## εki&#.........?.. #..........###  .......#...[# εki@....... ...## εki εki1-εkiεkinb _A ribbon worm is nearby!εki&  #.#####.#####.#.# #....†......#.#.# #........# #<....#.####.#.####.†......##..w..!..###.$....#.####...!......##  #.?.. #.### .......#...[# .....##.wεki/ εkiJ0 f1==== 1 2 εki0 _εki8 εki9 ϵkib #.#####.#####.#.# #....†......#.#.# #........# #<....#.###.#.#.####ϵkizc.†......##..w..!..###.$....#.#+###...!......## #.?.. #.###  .......#...[#  .##ϵkiWeJ.wϵki)rU3Poisonous Vapoursϵkiلϵki9A #.#####.#####.#.# #....†......#.#.# #........#. #<....#.####.#.##.####.†......##..w.ϵkiB.!..###.$....#.##+###...!......## #.?.. #.### .......#...[# .##ϵki>CO.wϵkiRϵkiaS&4ϵki[ϵki\ϵki? ; wwpoisoned)  Poisonous fumes billow around the ribbon worm!0----=5Poisonous Vapoursϵki G ϵkiI 2 _The ribbon worm is poisoned.ϵki% \†The ribbon worm is poisoned.  You hit the ribbon worm.  Your weapon exudes an aura of protection.  You grab the ribbon worm. You squeeze the ribbon worm!  The ribbon worm is almost dead.  You constrict the ribbon worm.ϵki (ϵkiܴ ϵki #.#####.#####.#.#ludeguy the Apothecary#....†......#.#.#Octopode########........#Health: 17/17 ========================. #<....#.###Magic: 0/5------------------------#.#########.#AC:  8  Str: 7#...........####EV: 12Int: 17........†......##.SH: 0Dex: 12...................XL:  2 Next: 112% Place: Dungeon:2......†@.....!..###Noise: =--------  Time: 1236.5 (1.0)...........$....#c) +0 dagger (protect)................#Cast: Poisonous Vapours#+###...!......###.........[0;1ϵkiپ <0;1m?..#..........###.......#...[#...........## _The ribbon worm is poisoned.  You hit the ribbon worm.  Your weapon exudes an aura of protection.  You grab the ribbon worm. You squeeze the ribbon worm!  The ribbon worm is almost dead.You constrict the ribbon worm.ϵki _You kill the ribbon worm!You have reached level 3!ϵki /  --more--еki  Your experience leads to an increase in your attributes!Increase (S)trength, (I)ntelligence, or (D)exterity? ҵki K21/21693 6% ҵki ҵki S _You feel clever. x2ӵkiGӵkiIL Spells (Memorise)TypeFailure Level  a - Mercury ArrowConjuration/Alchemy 9% 2b - Mephitic CloudConjuration/Alchemy/Air 24% 3  c - Olgreb's Toxic Radiance Alchemy36% 4d - Sigil of BindingHexes45% 3  e - Sticky FlameӵkixJFire/Alchemy61% 4 5 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitԵki\Եki`Եkih#.#####.#####.#.#ludeguy the Apothecary#....†......#.#.#Octopode########........#Health: 21/21 ========================ԵkiMiZ. #<....#.###Magic: 0/6------------------------#.#########.#AC:  8  Str: 7#...........####EV: 12Int: 19ԵkiiM........†......##.SH: 0Dex: 12...................XL:  3 Next:  6% Place: Dungeon:2Եkiie......†@.....!..###Noise: =--------  Time: 1236.5 (0.0)...........$....#Եki jc) +0 dagger (protect)................#Cast: Poisonous Vapours#+###...!......###.........?..#..........###Եkij.......#...[#...........##You constrict the ribbon worm. _You kill the ribbon worm!You have reached level 3!Your experience leads to an increase in your attributes!Increase (S)trength, (I)ntelligence, or (D)exterity? _You feel clever. x2ԵkirP  Okay, then.ԵkisԵkiUzԵkid|. _Եki" Եki   Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   0.0   1.0   0   f + Spellcasting 2.2   3.6  -1          Եki H b - Unarmed Combat   0.0   1.0   0   g + Conjurations 1.4   2.0   0      h + Alchemy3.5   3.4  +1   c - Short Blades   0.0   1.0   0   i - Air Magic   0.0   1.0   0          d + DodgingԵki 2.3   3.0   0   j - Shapeshifting   0.0   1.2  -1  e + Stealth3.2   2.0  +4                  Եki                                 Եki !            Եkic s                Եki KThe relative cost of raising each skill is in cyan.  The species aptitude is in white.  [?] Help[=] set a skill target  Եki [/] auto|manual mode [*] useful|all skills [!] training|cost|targetsյkiyB յki[J#.#####.#####.#.#ludeguy the Apothecary#....†......#.#.#Octopode########........#Health: 21/21 ========================. #<....#.###Magic: 0/6------------------------#.#########.#AC:  8  Str: 7#...........####EV: 12Int: 19........†......##.SH: 0Dex: 12...................XL:  3 Next:  6% Place: Dungeon:2......†@.....!..###Noise: =--------  Time: 1236.5 (0.0)...........$....#յkiKc) +0 dagger (protect)................#Cast: Poisonous Vapours#+###...!......###.........?..#..........###.......#...[#...........## _You kill the ribbon worm!You have reached level 3!Your experience leads to an increase in your attributes!Increase (S)trength, (I)ntelligence, or (D)exterity? _You feel clever. x2 _Okay, then.յkiRյkiSյkiYյki[ֵkiqֵkiE Spells (Memorise)TypeFailure Level  a - Mercury ArrowConjuration/Alchemy 9% 2b - Mephitic CloudConjuration/Alchemy/Air 24% 3  c - Olgreb's Toxic Radiance Alchemy36% 4d - Sigil of BindingHexes45% 3  e - Sticky FlameFire/Alchemy61% 4 5 spell levels left ֵki^[!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitֵki ֵki #.#####.#####.#.#ludeguy the Apothecary#....†......#.#.#Octopode########........#Health: 21/21 ========================. #<....#.###Magic: 0/6------------------------#.#########.#AC:  8  Str: 7#...........####EV: 12Int: 19........†......##.SH: 0Dex: 12...................XL:  3 Next:  6% Place: Dungeon:2......†@.....!..###Noise: =--------  Time: 1236.5 (0.0)...........$....#c) +0 dagger (protect)................#Cast: Poisonous Vapours#+###...!......###.........ֵki H[0;10;1m?..#..........###.......#...[#...........## _You kill the ribbon worm!You have reached level 3!Your experience leads to an increase in your attributes!Increase (S)trength, (I)ntelligence, or (D)exterity? _You feel clever. x2 _Okay, then.Memorise Mercury Arrow, consuming 2 spell levels and leaving 3? Y - Yes  N - No׵ki׵ki#.#####.#####.#.#ludeguy the Apothecary#....†......#.#.#Octopode########........#Health: 21/21 ========================. #<....#.###Magic: 0/6------------------------׵ki#.#########.#AC:  8  Str: 7#...........####EV: 12Int: 19........†......##.SH: 0Dex: 12...................XL:  3 Next:  6% Place: Dungeon:2......†@.....!..###Noise: =--------  Time: 1236.5 (0.0)...........$....#c) +0 dagger (protect)................#Cast: Poisonous Vapours#+###...!......###.........?..#..........###.......#...[#...........## _You kill the ribbon worm!You have reached level 3!Your experience leads to an increase in your attributes!Increase (S)trength, (I)ntelligence, or (D)exterity? _You feel clever. x2 _Okay, then.׵ki:-7.5 (1 _׵ki׵kiA׵kiU| 1 -8.5 (2׵kiP׵ki+9.5 (3׵ki!׵ki$ _You start memorising the spell. You continue memorising. x2׵ki׵ki!׵ki#c _You finish memorising. Spell assigned to 'b'.׵ki@ ׵ki ׵ki ׵ki ׵ki5 $ _׵ki ׵ki ,׵ki ׵ki ׵ki L1====׵kiG ׵ki ,׵ki ׵ki ,׵ki ׵ki ׵ki ׵ki ׵kii ׵ki <====׵ki ׵ki ,׵ki ׵ki ,׵ki> ׵kiL ,׵ki ׵ki ,׵ki/ ׵ki ,׵ki ׵ki ׵ki V2====׵ki$ ====׵ki& ,׵ki( ׵kit, ,׵ki. ׵ki1 ׵ki2 V3====׵kiN; ׵kil? ,׵kiD ׵kiH ,׵kiK ׵ki6N ,׵kiP ׵kiS ׵kiT <====׵ki W ׵kiY ׵ki#Z ׵ki[ ׵ki_ ׵ki` ׵kiHb ׵kiie ׵kie ׵ki"h ׵kik ,׵kin ׵kiGr ,׵kix |4====׵ki"z ׵ki} ׵ki~ ׵kic ׵kic ,׵ki ׵ki ,׵kij ׵kiw ׵ki <====׵ki ׵kin ,׵ki ׵ki ,׵ki& ׵kio ,׵ki ׵ki6 ,׵ki{ ׵ki% ,׵ki: ׵ki ׵ki] P5====׵ki ׵ki ׵kik ׵ki: ׵ki ׵kix ׵ki ׵ki ׵kiI ׵ki ׵ki R====׵ki ׵ki ,׵ki ׵ki ,׵ki ׵kij ,׵ki. ׵ki ׵ki ׵ki ׵kik ,׵kiN ׵ki d6====׵ki ׵ki 4 _Magic restored.׵ki 3׵ki< ׵kii ׵kiC ,׵ki ׵ki ׵kia  You encounter a goblin. It is wielding a +0 club.׵kiG  . #<....#.###  #.#########.#  #...........####........†......##..........................†......!..###....$....# ..# #+###....##  #..?..  ### .......#...[#.....####...#... g   goblin (asleep)g.... ...####.##..... ##׵ki 094.5 (55.0)׵ki 35.5 (56 _׵ki ׵ki ] _You see here a potion of enlightenment.׵ki  . #<  #.#########.#  #...........####  ........†......##.  ...................  ......†......!..###  ...........$....#  ׵ki: ................#  #+###...@......##  #.........?..  #..........###  .......#...[#  .............##  ##.........#...  g.......... ...  ####.##..... ## ׵kid . #<  #.#########.#  #...........####  ........†......##.  ...................  ......†......!..###  ...........$....#  ................#  #+###...@......##  #.........?..  #..........###  .......#...[# .............## ##.........#...  ׵kiWfg.......... ... ####.##..... ## ׵kil׵ki`m׵kiq׵kirs] _A goblin is nearby!׵ki7/[ #.#########.#  #...........#### †......##. ...... †!..### ...........$....#  ................# #+###...!# #?.. #..###..#...[# .......######... g.....#####.##......## #. ......׵ki8׵ki9W====6.5 (1.0) _׵ki@׵kiAصki    #...........####  ........†......##.  ...................  ......†......!..###  ...........$....#  ................#  #+###...!......##  #..@......?..  #..........###  ........#...[#  ..............##  ###.........#...  g..............  #####.##......##  #. ......# صki~   #...........####  ........†......##.  ...................  ......†......!..###  ...........$....#  ................#  #+###...!......##  #..@......?..  #..........###  ........#...[#  ..............#صki ###.........#.. g..............  #####.##......# #. ......# صki*صkiΈصkiXصkiђ] _A goblin is nearby!صkiv #...........#### †......##. ....... ......†!..### ...........$....#  ..........# #+###...!# #...?.. #..###.....#...[# .......#######... g.....#####.##......## #. ...... .. #.....صki.صki-7 _صkiȚصkiٵkiٵki48Wield or unwield which item (- for none)?- - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)ٵkiub - a +0 dagger[?] describe selected [!] equip|wield|put on[tab] equip|unequip ڵkizڵkiڵki#...........####ludeguy the Apothecary........†......##.Octopode...................Health: 21/21 ========================......†......!..###Magic: 6/6========================...........$....#AC: 1Str: 7................#EV: 12Int: 19#+###...!......##SH: 0Dex: 12#.........?..XL:  3 Next:  6% Place: Dungeon:2#.@........###Noise: ---------  Time: 1297.5 (0.0)...........#...[#c) +0 dagger (protect)...............##Cast: Poisonous Vapours####.........#...g...........ڵki ...#####.##......##g   goblin (asleep)#. ......#.. #..... _You finish memorising. Spell assigned to 'b'. _Magic restored. _You encounter a goblin. It is wielding a +0 club. _You see here a potion of enlightenment. _A goblin is nearby! _A goblin is nearby!ڵkiP  Okay, then.ڵki5ڵkiڵkit. _۵ki ۵kiS Dungeon Crawl Stone Soup 0.34-a0-2034-g5d7b2d6c54  Esc - Return to gameS - Save and exit  # - Generate and view character dump  ~ - Edit macros  ? - Help and manual  / - Lookup info  Q - Quit and abandon characterݵki vEditing macros.  ~ - Create/edit macro from key  - - Clear all macros Current macros  NP5 - .  F5 - zd.  F4 - zc.  F3 - zb.  F2 - we  F1 - wh Arrows/[enter] to select, [bksp] to clear selected, [?] for help [!] edit keymapsߵki Current macro for \{-265} (F1): wh  r - redefine ߵki~> R - redefine with raw key entry  c - clear  a - abortkiA[?25h[?0c[?25l[?1c Input new macro for \{-265} (F1):  r - redefine Input a key sequence. Use \{n} to enter keycode n. [esc] for menukiI&zkie&akiͩ&.ki,Editing macros.  ~ - Create/edit macro from key  - - Clear all macros Current macros  NP5 - .  F5 - zd.  F4 - zc.  F3 - zb.  F2 - we  F1 - za. Redefined macro '\{-265} (F1)' => 'za.'. kiװ!Arrows/[enter] to select, [bksp] to clear selected, [?] for help [!] edit keymapski Current macro for \{-266} (F2): we  r - redefine  R - redefine with raw key entry  c - clear  a - abortki 'zb.'. Arrows/[enter] to select, [bksp] to clear selected, [?] for help ki/E[!] edit keymapskiAkiW#...........####ludeguy the Apothecary........†......##.Octopodekir...................Health: 21/21 ========================......†......!..###Magic: 6/6========================...........$....#AC: 1Str: 7................#EV: 12Int: 19#+###...!......##SH: 0Dex: 12#.........?..XL:  3 Next:  6% Place: Dungeon:2#.@........###Noise: ---------  Time: 1297.5 (0.0)ki...........#...[#c) +0 dagger (protect)...............##Cast: Poisonous Vapours####.........#...g..............#####.##......##kigg   goblin (asleep)#. ......#.. #..... _Magic restored. _You encounter a goblin. It is wielding a +0 club. _You see here a potion of enlightenment. _A goblin is nearby! ki_A goblin is nearby! _Okay, then.kiz kiDungeon Crawl Stone Soup 0.34-a0-2034-g5d7b2d6c54  Esc - Return to game  S - Save and exit  ki# - Generate and view character dump  ~ - Edit macros  ? - Help and manual  / - Lookup info ki,T Q - Quit and abandon characterkiikiKl#...........####ludeguy the Apothecary........†......##.Octopode...................Health: 21/21 ========================......†......!..###Magic: 6/6========================...........$....#AC: 1Str: 7ki`X................#EV: 12Int: 19#+###...!......##SH: 0Dex: 12#.........?..XL:  3 Next:  6% Place: Dungeon:2#.@........###Noise: ---------  Time: 1297.5 (0.0)...........#...[#c) +0 dagger (protect)...............##Cast: Poisonous Vapours####.........#...g..............#####.##......##g   goblin (asleep)#. ......#.. #..... _Magic restored. _You encounter a goblin. It is wielding a +0 club. ki_You see here a potion of enlightenment. _A goblin is nearby! _A goblin is nearby! _Okay, then.kiUkikikiR  _You see here a potion of enlightenment. _A goblin is nearby! _A goblin is nearby! _Okay, then.  Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiwJkiA _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiJ ( †......##. ............. ......†!..###kiK  ...........$....#  ..........####+###...!#..... #...?........#..###......#...[# .....#######kiL ]#... g.....#####.#### #.. ......g 2 goblins (1 launcher, asleep) ..# #..... #.# ..gkiY kizZ +8.5 (1kiic kiYf _You encounter a goblin. It is wielding a +0 dagger and carrying a +0 sling.ki ...... ......†ki5n!..### ...........$....#  ................#####+###...!#......#...?..#......#..####......#...[# #.....#########... g.....kirU#####.#### #.. ...... ..#.#.....ki #.#. ..g .# #kiki&9ki,Poisonous Vapourskikiki...................ludeguy the Apothecary......†......!..###Octopode...........$....#kiHealth: 21/21 ========================................#Magic: 5/6====================----####+###...!......##AC: 1Str: 7#......#.........?..EV: 12Int: 19#......#..........###SH: 0Dex: 12kiJq#............#...[#XL:  3 Next:  6% Place: Dungeon:2#......@.........##Noise: ---------  Time: 1299.5 (0.0)######.........#...c) +0 dagger (protect)g..............Cast: Poisonous Vapours#####.##......###.. ......#..#.#.....gg 2 goblins (1 launcher, asleep)ki,#.#. ..g..# # _You encounter a goblin. It is wielding a +0 dagger and carrying a +0 sling.ki Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a goblin, wielding a +0 club (asleep)ki\Contam: 10% 300.5 (1kihki yasting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  kiPress: ? - help, Dir - move targetAim: a goblin, wielding a +0 club (asleep) _You miscast Poisonous Vapours. Nothing appears to happen.ki  ...................  ludeguy the Apothecary ......†......!..###  Octopode ...........$....#  Health: 21/21 ======================== ................#  Magic: 4/6================-------- ####+###...!......##  AC: 1ki Str: 7 #......#.........?..  EV: 12Int: 19 Contam: 10%  #......#..........###  SH: 0Dex: 12 #............#...[#  XL:  3 Next:  6% Place: Dungeon:2 #......@.........##  Noise: ---------  Time: 1300.5 (0.0) ######.........#...  c) +0 dagger (protect) .g.............  Cast: Poisonous Vapours #####.##......##  #.. ......#  ..#.#.....  gg 2 goblins (1 launcher, asleep) #.#. ..g.  .# # Confirm with . or Enter, or press ? or * to list all spells.ki HAiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a goblin, wielding a +0 club (asleep)  Poisonous fumes billow around the goblin!  The goblin is poisoned.ki;    ......†......!..###  ...........$....#  ................#  ki b####+###...!......##  #.........?..  #......#.......  #.....#...[#  #.........##  ######.........#...  ........  #####.##....kiM  #.. .... ..#.#..... g1 asleep, 1 po…) #.#.  .# # ki J====1.5 (1ki ki Aiming: Poisonous Vapours (safe; 8% risk of failure)  ki3 Press: ? - help, Dir - move target  Aim: a goblin, wielding a +0 club (asleep)  Poisonous fumes billow around the goblin!  The goblin is poisoned. _shouts!kiZ ...................  ludeguy the Apothecary ......†......!..###  Octopode ...........$....#  Health: 21/21 ======================== ................#  Magic: 2/6========----------------ki:| ####+###...!......##  AC: 1Str: 7 #......#.........?..  EV: 12Int: 19 Contam: 10%  #......#..........###  SH: 0Dex: 12 #............#...[#  XL:  3 Next:  6% Place: Dungeon:2 #......@.........##  Noise: ====-----  Time: 1301.5 (0.0) ######.........#...  c) +0 dagger (protect) ki.).............  Cast: Poisonous Vapours #####.##......##  #.. ......#  ..#.#.....  gg 2 goblins (1 launcher, 1 asleep, 1 po…) #.#. ..g.  .# # Confirm with . or Enter, or press ? or * to list all spells.kiAiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a goblin, wielding a +0 club (heavily wounded, poisoned, chance to weaken:100%)  The glob of mercury hits the goblin. The goblin looks weaker.kia7   ki......†......!..###  ...........$....#  ................#  ###......##  ki#.......?..  #..... kiD #...#...[#  #.......##  ki######*........#...  .......  ...ki #.. .... ..#.#..... g   goblin (launcher, asleep) ki#.#.  .# # kiMrAiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a goblin, wielding a +0 club (heavily wounded, poisoned, chance to weaken:100%)  The glob of mercury hits the goblin. The goblin looks weaker.  kiM?You kill the goblin!ki8V .r   quokkag   goblin (launcher, asleep)kipY8==--2.5 (1Poisonous VapourskiYkidm _You encounter a quokka.kiT$  †!..### ...........$....#  ................#####+###...!# #......#...?.. #......#..###kiv%  #......#...[#  #.....## #######.........)........######.#### #r.>...... ..#.#..... #.#.#..g .# # ki7' Br.kim0 ki1 j----3Poisonous VapourskiA kiC ; _Found a stone staircase leading down.kiP ......†......!..###  ludeguy the Apothecary ...........$....#  Octopode ................#  Health: 21/21 ======================== ####+###...!......##  Magic: 1/6====-------------------- #......#.........?..  AC: 1Str: 7 #......#..........###  EV: 12Int: 19 Contam: 10%  #............#...[#  SH: 0ki^RDex: 12 #................##  XL:  3 Next:  8% Place: Dungeon:2 ######@........#...  Noise: ---------  Time: 1303.5 (0.0) ......).r...........  c) +0 dagger (protect) ...######.##......##  Cast: Poisonous Vapours #..>......#  ..#.#.....  #.#.#..g.  r   quokka .# # Casting: Mercury Arrow (safe; 9% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a quokka  Poisonous fumes billow around the quokka!ki] †!..###  .....$....#  .....  ####+###...!..  #......#.........?..  #......#......  #..ki^...#...[#  #.........##  ######@........#...  .............  ...######.##......##  #..>... ..#.# #.#.#..g.  (poisoned) .# # ki_3=4.5 (1ki'gkiionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  Aim: a quokka  Poisonous fumes billow around the quokka! _The quokka is poisoned. The quokka closely misses you.ki~2k †!..###  .....$....#  .....  ####+###...!..  #......#.........?..  #......#......  #............#...[#  #................##  ######@........#...  ......).r...........  ...######.##......##  #..>......#  ..#.#.....  #.#.#..g.  .# # kiU †!..###  .....$....#  .....  ####+###...!..  #......#.........?..  #......#......  #............#...[#  #................##  ######@........#...  ......).r...........  ...######.##......##  #..>... ..#.# #.#.#..g.  ki:_.# # kikiAki.ki] _A quokka is nearby!ki] { .  You hit the quokka.  Your weapon exudes an aura of protection.kif )kij  8 125Poisonous Vapourskirq kibt J _You kill the quokka!kiS 4ki ki^ H _No target in view!ki5ki6kiX;kiE>H _No target in view!kiw _8% kiz 1 6kibki^2====4ki&kioki72ki!kiki71kikiki'kikiZ _Your magical contamination has completely faded away.ki<====ki|kiki+ki#kikiMki#kil,ki|ki ,kiki,kikikilV3====ki=Bkiki,ki~ki^,ki"kinki<====ki#kiUkikikikiSkiIkiki8ki%kipkikiki,kikiGkiP4====kikikiLkikki ki7 ki ki6 ki kikiZki<====ki9kis,kiki7,kikiK,kikid!,ki*"ki#kiu$kiQ%ki&f5====ki:)ki*,ki,ki/BkiT2,ki2ki5R====ki7ki9,kik;ki=ki;>kiO?kiB,kiCkiE,ki|GkiI,ki3KkiMd6====kiMkiOkiRh  A goblin comes into view.ki Z#....... ......†......!..###...........$....#  .......... ####+###...!## #......#.?.. #......#....####.#...[# #.......## -######.#... ......)....... ...######.##......##..>......#..#.#....g   goblin (launcher, asleep)#.#.#..g..# #kiZki`049.5 (44.0)kiaN-50.5 (45 _kiQikiiki}n   ......†......!..###  ...........$....#  ................#  ####+###...!......##  #......#.........?..  #......#.......  #............#...[#  #......@.........##  ######.........#...  ......).............  ...######.##......##  #..>......#  ..#.#.....  #.#.#..g.  .# # ki`7   kiwa,......†......!..###  ...........$....#  ................#  ####+###...!......##  #......#.........?..  #......#.......  #............#...[#  #......@.........## kiZb ######.........#...  ......).............  ...######.##.... #..>.... ..#.#.....  #.#.ki c\ .# # ki>lkigmkiys _A goblin is nearby!kiȨ 3   ki ......†......!..###  ...........$....#  ................#  ####+###...!......##  #......#.........?..  #......#.......  #............#...[#  #......@.........##  ######.........#...  ......).............  ...######.##......## ki  #..>......#  ..#.#.....  #.#.#..g.  .# # kiA =   ......†......!..###  ...........$....#  ................#  ####+###...!......## kiB  #......#.........?..  #......#.......  #............#...[#  #......@.........##  ######.........#...  ......).............  ...######.##....ki.C } #..>.... ..#.#.....  #.#. ki}C W.# # kiJ ki=K kipO kiQ ] _A goblin is nearby!kiZ    ......†......!..###  ...........$....#  ................#  ki[ ####+###...!......##  #......#.........?..  #......#.......  #............#...[#  #......@.........##  ######.........#...  ......).............  ...######.##......##  #..>......#  ..#.#.....  #.#.#..g.  .# # ki\ kiUU   ......†......!..###  ...........$....#  kiD................#  ####+###...!......##  #......#.........?..  #......#.......  #............#...[#  #......@.........##  ######.........#...  ......).............  ...######.##.... #..>.... ..#.#.....  #.#. .# # kikikiI kiO] _A goblin is nearby!ki.†##. ............. ......†......!..###...........$....#  .......... ####+###...!## #......#.?.. ki #......#....####.#...[# #........## ######.#... ......)..........######.##......##..>......#..#.#....#.#.#..g..# #ki`ki281.5 (1.0) _kikivki 1..........†!..### ...........$....# .........# ####+###...!## #......#.........?.. #......#.####......#...[# #....## #######... ......).... ...######.#### #..>.#..#.#..... #.#.#..g.##.# #....# ki ki 2kikiki}z......†!..### ...........$....# .........# ####+###...!## #......#.........?.. #......#.####......#...[# #....## ######kix{8#... ......).... ...######.####  #..>......#..#.#.#.#.#..g.###.#.# #....## ....#kinki.E====3ki`kiki .....$....# .....# ####+###...!......## #......#.........?.. #......#..####......#...[# #....## #######... ......).... ...######.####  #..>......# ..#.#.kiYp.#.#.#..g.####.#.#+#....# # ....# ki%kir&&4ki,ki.ki/.....# ####+###...!## #......#.........?.. #......#.####......#...[# #....#########..........).....######.####  #..>......# #...#.#..ki#.#.#.#..g.#####.#.#+#....## .....#  .....#....##kie gg)The goblin shouts!  The goblin unwields a +0 dagger. The goblin wields a +0 sling.ki[)))))))ki|i....@..ki^====5Poisonous Vapourskiki{ _The goblin shoots a sling bullet. The sling bullet barely misses you.kix ................#ludeguy the Apothecary####+###...!......##Octopode#......#.........?..Health: 21/21 ========================#......#..........###Magic: 5/6kiz ====================----#............#...[#AC: 1Str: 7#................###EV: 12Int: 19######.........#....SH: 0Dex: 12......)..............XL:  3 Next: 12% Place: Dungeon:2...######.##.@....##Noise: ====-----  Time: 1355.5 (0.0)#..>......#c) +0 dagger (protect)#...#.#........Cast: Poisonous Vapours#.#.#.#..g.#####.#.#+#....## .....#g   goblin (launcher, poisoned).....#....##Casting: Poisonous Vapours (safe; ki{ 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a goblin, wielding a +0 sling and carrying a +0 dagger  Poisonous fumes billow around the goblin!=---6.5 (1ki ki، onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  Aim: a goblin, wielding a +0 sling and carrying a +0 dagger  Poisonous fumes billow around the goblin! _The goblin is poisoned.ki ................#  ludeguy the Apothecary  ####+###...!......##  Octopode  #......#.........?..  Health: 21/21 ========================  #......#..........###  Magic: 3/6============------------  #............#...[#  AC: 1Str: 7  #................###  EV: 12Int: 19  ######.........#....  SH: 0Dex: 12  ......)..............  XL:  3 Next: 12% Place: Dungeon:2  ...######.##.@....##  Noise: =--------  Time: 1356.5 (0.0) #..>......#  c) +0 dagger (protect) #..kiB.#.#........  Cast: Poisonous Vapours #.#.#.#..).####  #.#.#+#....#  # .....#  g   goblin (launcher, poisoned) .....#  ....## Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a goblin, wielding a +0 sling and carrying a +0 dagger (moderatelywounded, poisoned, chance to weaken: 100%)  The glob of mercury hits the goblin! The goblin looks weaker.ki   #...!......##  #......#.........?..  #......#..........###  #.......ki4[#  #.......###  ######.....  ).....  ##  #..>..*...#  #...#.#.*......  #.#### # # .....#kiu .....# ....## ki5t-..kizv4=7.5 (1Poisonous Vapourski|ki~1  Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a goblin, wielding a +0 sling and carrying a +0 dagger (moderatelywounded, poisoned, chance to weaken: 100%)  The glob of mercury hits the goblin! The goblin looks weaker. _You kill the goblin!kia ki[ ki,kikiki"kikiki-ki"ki#ki%ki*c  You encounter a bat.kii4--b   bat (wandering)bki>5,60.5 (3ki5"b.ki6#b.kiJki,LM--1.5 (4 _kiXkiYki2   #...!......##  #......#.........?..  #......#..........###  #............#...[#  #................###  ######.........#....  )..............  #.@....##  #..>......#  #...#.#........  #.#.#.#..).####  #.#.#+#b...#  # .....#  .....#  ....## ki   #...!......##  #......#.........?..  #......#..........###  #............#...[#  #................###  ######.........#....  )..............  #.@....##  #..>......# kiP #...#.#........  #.#.#.#..).#### #.#.#+#b...# # .....#  .....# ....## kikikiTkirZ _A bat is nearby!ki;   ki})#...!......##  #......#.........?..  #......#..........###  #............#...[#  #................###  ######.........#....  )..............  #.@....##  #..>......#  #...#.#........  #.#.#.#..).####  #.#.#+#b...#  # .....#  .....# ki> ....## kieK   #...!......##  #......#.........?..  #......#..........###  #............#...[#  #................###  ######.........#....  )..............  #.@....## kiLF #..>......#  #...#.#........  #.#.#.#..).#### #.#.#+#b...# # .....#  .....# ....## ki1X4ki\ki&` ki"jT_A bat is nearby!ki/E @................#ludeguy the Apothecary####+###...!......##Octopode#......#.........?..Health: 21/21 ========================#......#..........###Magic: 1/6====--------------------#............#...[#AC: 1Str: 7#................###EV: 12Int: 19######.........#....SH: 0Dex: 12......)..............kiN BXL:  3 Next: 14% Place: Dungeon:2...######.##.@....##Noise: ---------  Time: 1361.5 (0.0)#..>.*....#c) +0 dagger (protect)#...#.#*.......Cast: Poisonous Vapours#.#.#.#*.).#####.#.#+#*...## .....#b   bat (wandering).....#....## _A bat is nearby!Casting: Mercury Arrow (safe; 9% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a bat (wandering, hasn't noticed you, chance to weaken: 100%)kiU nb.b.b.ki ;ki M==2.5 (1Poisonous Vapourski w  Casting: Mercury Arrow (safe; 9% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a bat (wandering, hasn't noticed you, chance to weaken: 100%) _The glob of mercury misses the bat.ki^ ................#  ludeguy the Apothecary  ####+###...!......##  Octopode  #......#.........?..  Health: 21/21 ========================  #......#..........###  Magic: 0/6------------------------  #............#...[#  AC: 1Str: 7  #................###  EV: 12Int: 19  ######.........#....  SH: 0Dex: 12  ......)..............  XL:  3 Next: 14% Place: Dungeon:2  ...######.##b@....##  Noise: ==-------  Time: 1362.5 (0.0) #..>......#  c) +0 dagger (protect) #...#.#........  Cast: i`mPoisonous Vapours #.#.#.#..).####  #.#.#+#....#  # .....#  b   bat .....#  ....## Casting: Mercury Arrow (safe; 9% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a bat  You miscast Poisonous Vapours. Nothing appears to happen..b.kii   #...!......##  #......#.........?..  #......#..........###  #............#...[#  #........kij.###  ######...#....  ).......  #.@....##  #..#  #...#.#........  #.#.#.#..).#### #.#.#+#....# # .....#  .....# ....## kikContam: 10% -3.5 (1Poisonous Vapourskiski vQ _The bat closely misses you.ki   #...!......##  #......#.........?..  #......#..........###  #............#...[#  #................###  ######.........#....  )..............  #.@....##  #..b......#  #...#.#........  #.#.#.#..).####  #.#.#+#....#  # .....#  .....#  ....## ki   #...!......##  #......#.........?..  #......#..........###  #............#...[#  #................###  ######.........#....  )..............  #.@....##  #..b......#  #...#.#........  #.#.#.#..).#### #.#.#+#....# # .....#  .....# ....## ki8N-kiki Z _A bat is nearby!kie} *  Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki ki e _You don't have enough magic to cast this spell.ki]  .# ####+###...!......## #......#...?.. #......#.### #.#...[# #.### ######.#.... ......). ...######.##@.....## #..b......# #...#.#. #.#.#.#..).#### #.#.#+#....# # .....# .....# ....##ki C>bki5 '.bki( k0--4kij/ ki.2 ' _The bat hits you.kib5 ####+###...!#......#.........?........###.........#...[# .............########...ki6 a#..........)..........######.####  #..> #...#.#........#.#b#..).#####.#.#+#...# .# ...#ki7 $b.kiE 1====5Poisonous Vapourski J ki0M L _The bat misses you. x2kiz †  You hit the bat.  Your weapon exudes an aura of protection.ki.)ki 8 66Poisonous Vapourski"ki[&G _You kill the bat!kiIkiJkiQkiLUH _No target in view!kiIki ki: _ki1== _HP restored.==== 1 ki,ki.kiMO8% kiki76kikimkiT==4ki`kiki_72kikiki'ki p _Your magical contamination has completely faded away.ki2 V2====ki0 kiki5kiLkikiki}kiki}ki ki$ki$<====kix'ki+ki+ki*.ki1ki2kiB4ki7kij8ki:ki!>ki>kiIkiTOkihPki`SkiWki4XV3====kiZki*_ki_kiakieki3fki{hkitlkimki*okirkiEs<====kiuki{,kiki~,kiki٢kiuP4====kiIki},kikkiŭ,kiBkiEkiki8<====ki<kiki$ki\ki,ki"kiikikikiekikikikikikikilP5====kiwki@kikiQkikiki kikimkiUkiR====kiki,kickiBki%kiki ki ki kigkikiki9,kikikiN6====ki~ki$kiB(ki(ki*kiA.ki1ki2ki4ki7ki;ki;kil=ki@kiDki6E<====ki)GkiuJkiMkizNkiFPkiDSkiV,kiXki5[kia^ki_ki`kil#.#########.# #...........#### ........†......##. ............. ......†......!..### ...........$....# ................# ###+###...!......####### ......#...........- ......#..........####### ............#...[# ................#### #####.........#....... kim....)..............### .######.##......##....#..>......# #####...#†#........kiu1422.5 (56.0)kimvF-3.5 (57ki}ki` _c - a scroll labelled GUUNGAOXEFkiO 3ki| kiS$ ki. nkiL/ ki.1 ki4 ki6 ,ki8 kiED j  You now have 56 gold pieces (gained 13).kiUG ki Y _ _You see here a rat corpse.kid\ ki] kia ,kiMc kic kiNe kizp ^#.#####.#####.#.##....†......#.#.#########........#  . #<....#.###  #.#########.# ... #..#### #... ki]q †##....  ...............  ......†......@..###  ....†....#  .......# ####+###...!......####### #......#................. #......#..........####### #............#...[# #................#### ######......kiq )...#.......kiy 19.5 (6.0)kiy ,30.5 (7ki g _d - a pink potionkii 3kiJj kim ki~p ,ki[v ,kix kix ki'z ki} ki ki( kiN ki ki kiI ki4 ki ki? Bki kiW kiI kiߞ N _e - 2 potions of enlightenment (gained 1)kiF 3ki kix ,kif ki ki\ ki kij ,ki ki} ki ki kiZ ki ,ki kiy kig ki kiq ki kiZ ki ki4 ki ki, ki ki ki ki ki ki ki; ki kiD ki ki ki` ,ki ki kiU ,ki ki ki3 ki ki ki ki ,kiS ki ki ki ki ki8 ki ,kiN ki ki ki! ,ki" kiz# ki# ki$ ki)   You encounter a hobgoblin.kie1  ### #.. #.# #.#  #.#  #.# ## ####.### +...@..'.... ####.#.#.g..### #.# # .#.. #.# #.####### #.# #.##..... kiY2 ]#.# #.##.###. g   hobgoblin (wandering) #.# #.##.###. #.# ##..†...#. #.# #.....#.#.ki3 Kg59.5 (29.0).ki,: ki; 460.5 (30 _ki"@ kiA ki: ### #.. #.# #.# #.# #.# ##  ####.###....  +...@..'.g..  ####.#.#....###  #.# # .#..  #.#  #.#  #.#  #.#  #.# ##..† #.# kiS ### #.. #.# #.# #.# #.# ##  ####.###....  +...@..'.g..  ####.#.#....###  #.# # .#..  #.#  #.#  #.#  #.#  #.# ##..† #.# kiZYkiWZkiA^kiJ`` _A hobgoblin is nearby!ki-Y Read which item? Scrolls  V - a scroll of vulnerability  c - a scroll labelled GUUNGAOXEF  e - a scroll labelled TACSIO LOMUTI [!] read|quaff[?] describe selectedki  kiludeguy the Apothecary###Octopode#..Health: 21/21 ========================#.#Magic: 6/6========================#.#AC: 1Str: 7#.#EV: 12ki Int: 19#.# ##SH: 0Dex: 12####.###....XL:  3 Next: 16% Place: Dungeon:2+...@..'.g..Noise: ---------  Time: 1460.5 (0.0)####.#.#....###c) +0 dagger (protect)#.# # .#..Cast: Poisonous Vapours#.##.########.##.##.....#.##.##.###. g   hobgoblin (wandering)#.##.##.###.#.# ##..†...#.ki #.# #.....#.#.You now have 56 gold pieces (gained 13). _You see here a rat corpse. _d - a pink potion _e - 2 potions of enlightenment (gained 1) _You encounter a hobgoblin. _A hobgoblin is nearby!kiUP  Okay, then.kikixki|. _kip ### #.. #.# #.# #.# #.# ######.###....#+....@.'.g..'####.#.#....### #.#.# ..#.. #.#.# #.##.#.# #.##.....#kiq #.#.# #.##.###.##.#.# #.##.###.##.#.# ##..†...#.##.# #.....#.#.#kir 6g.kiy kisz 21.5 (1 _kiu ki kiB1ludeguy the Apothecary###Octopode#..Health: 21/21 ========================#.#Magic: 4/6================--------#.#AC: 1Str: 7#.#EV: 12Int: 19#.# ###SH: 0Dex: 12####.###*g..#XL:  3 Next: 16% Place: Dungeon:2+....@**....'Noise: ---------  Time: 1461.5 (0.0)####.#.#....###c) +0 dagger (protect)#.#.# ..#..Cast: Poisonous Vapourski2l#.#.# #.#########.#.# #.##.....##.#.# #.##.###.# g   hobgoblin (weak)#.#.# #.##.###.##.#.# ##..†...#.##.# #.....#.#.#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a hobgoblin (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the hobgoblin. The hobgoblin looks weaker.  The hobgoblin is severely wounded.kiK.gkit'..'..ki\N===2.5 (1Poisonous Vapourskiſki  Aiming: Mercury Arrow (safe; 9% risk of failure)  kiRPress: ? - help, Shift-Dir - straight line  Aim: a hobgoblin (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the hobgoblin. The hobgoblin looks weaker.  The hobgoblin is severely wounded. _The hobgoblin shouts!kiR  ludeguy the Apothecary ### Octopode #.. Health: 21/21 ======================== kicZ#.# Magic: 3/6============------------ki"[  #.# AC: 1Str: 7 #.# EV: 12Int: 19 #.# ###  SH: 0Dex: 12 ####.###....#  XL:  3 Next: 16% Place: Dungeon:2 kiq[ +....@.'†...'  Noise: ===------  Time: 1462.5 (0.0) ####.#.#....###  c) +0 dagger (protect) ki]Z#.#.# ..#..  Cast: Poisonous Vapours #.#.# #.######## #.#.# #.##.....# #.#.# #.##.###.# g   hobgoblin (weak) #.#.# #.##.###.# #.#.# ##..†...#.# #.# #.....#.#.#Casting: Mercury Arrow (safe; 9% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a hobgoblin (severely wounded, weak)  Poisonous fumes billow around the hobgoblin!kie ### #.. #.# #.# #.# #.# ###  ####.###....#  +....'  ####.#.#....###  #.#.# ..#..  #.#.# # #.#.#  #.#.#  #.#.#   #.#.# ##..†  #.#  ki;ib20--3.5 (1Poisonous VapourskikkiznkipSonfirm with . or Enter, or press ? or * to list all spells.kiqAiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  Aim: a hobgoblin (severely wounded, weak)  Poisonous fumes billow around the hobgoblin! _You kill the hobgoblin!ki kikikiki:ki$kiki=ki kikiki(|4====kiQ&====ki(,ki^),ki+,ki+ki9-ki-ki.kiV35====ki(4,ki4ki"6ki6ki6ki8ki'9<====ki9kiB;ki;kiK<ki=,ki%>ki>ki^?ki?ki@kiwAkiAkiCkiC,kiDkibEN6====kiEkiGkiHkiIkiIkiKkiuLkiLkihMkiO%  kiOThere is an open door here.kiPkiQ _kidRkiUe  You see here a hobgoblin corpse.kiWkimXC==== _ki/YkiRZkip[ki[ki5\ki^]ki^ki|_ki_ki`kibkibkibki e ki}e: There is an open door here.kifkig _kihki'jkikkilkilki?mki^nkinkiLokiokipkiwq,ki skioz<############ #......)...# #.# #@# ---502.5 (39.0)#.# #.# #.# #.# #.# ######.#####.###....#.######+......'†...'........####.#.#....#########kie{t#.#.#....#..#.#.#....#.########kimkiF-3.5 (40kikid# _Found a club.kiki3kikikirki,kiNkiki[ki4kiMkikiKkiki,kigkikkikiYkikiki,ki0kikiNkikiukiki^kikiki~kiki,kikiZki&,ki`kiskiE,kikijki,kiki?ki,kiXkiki,kikikiki8 ki ki 7 _You open the door.kie ######## ...)...# ######.##.##.# ######.# ####### #....#.##########....... '†...'..........@.......19.5 (16 #....############....... #....#..  ....... #....#.######## ....... ######.##.....# ....... # #.##.###.# .[..... # #.##.###.# ....... # ##..†...#.# .......#.....#.#.#kiki-20.5 (17kin"ki#< _Found a robe.ki&Q _There is an open door here.kikikiki~ki | _kikiBkiF$,ki%ki'ki*,ki+,kiA1nki-2ki3ki|5kiX7,ki8ki4:ki;,ki<ki>ki?kiO@ki@kiAkiCkikCkiCkicEki5GkiGkiHki Kki;MkiMkiNki|PkiTR,kiESkifUkiTW,kiXkiZki]ki]ki^kiA_ki`,kiakibkidkiQeki1fkihkijkickki3lkimkio,kigpkiskiu,kivkiyBkizki{ki ~,ki~kiXkikikiBkilki:kiWkiki͒ki%ki`kikikikikikikiki@,kiIkiw,ki;kikikiwki!  You encounter a kobold. It is wielding a +0 club and quivering stones.kiҾ#######.# #.# #.#  ######.############### ##....#.##########............# ki.'†...'..........'............+ .#....############............# .#....#......K...#............# .#....#.########@#............# .######.##.....#.#............# .# #.##.###.#.#.[..........#Poisonous Vapours .# #.##.###.#.#............# .# ##..†...#.#.#............# #.....#.#.#.#............#K   kobold (missile, asleep) .#####.#####.#.#.#............# ki....†......#.#.#.#............. #######........#.##.......####.ki-50.5 (30ki 31.5 (31 _kikikiÍ ki C  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   0.0   1.0   0   f + Spellcasting 2.2   3.6  -1      ki      b - Unarmed Combat   0.0   1.0   0   g + Conjurations 1.5   2.0   0      h + Alchemy3.5   3.4  +1   c - Short Blades   0.0   1.0   0   i - Air Magic   0.0   1.0   0          d + Dodging2.3   3.0   0   j - Shapeshifting   0.0   1.2  -1  e + Stealth3.3   2.0  +4    kiƔ                                                                           The relative cost of raising each skill is in cyan.  The species aptitude is in white.  [?] Help[i 3m=] set a skill target  [/] auto|manual mode [*] useful|all skills [!] training|cost|targetskiLkitMki8Uki]#######.#ludeguy the Apothecary#.#Octopodeki^#.#Health: 21/21 ========================######.###############Magic: 6/6======================== ##....#.##########............#AC: 1Str: 7 .'†...'..........'............+EV: 12Int: 19 .#....############............#SH: 0Dex: 12 .#....#......K...#............#kii_XL:  3 Next: 20% Place: Dungeon:2 .#....#.########@#............#Noise: ---------  Time: 1551.5 (0.0) .######.##.....#.#............#c) +0 dagger (protect) .# #.##.###.#.#.[..........#Cast: Poisonous Vapours kiQ`>.# #.##.###.#.#............# .# ##..†...#.#.#............##.....#.#.#.#............#K   kobold (missile, asleep) .#####.#####.#.#.#............# ....†......#.#.#.#............. #######........#.##.......####. _There is an open door here. _Found a club. _You open the door. _Found a robe. _There is an open door here. _You encounter a kobold. It is wielding a +0 club and quivering stones.kigki4hkiEokiqki$~JkiF _Unknown command.kiϴ #######.# ludeguy the Apothecary #.# Octopode #.# Health: 21/21 ========================  ######.# ##############  Magic: 4/6================-------- ##....#.##########............#  AC: 1Str: 7 .'†...'..........'............+  EV: 12Int: 19 .#....############............#  SH: 0Dex: 12 .#....#......)...#............#  XL:  3 Next: 20% Place: Dungeon:2 .#....#.########@#............#  Noise: ---------  Time: 1551.5 (0.0) .######.##.....#.#............#  c) +0 dagger (protect) .# #.##.###.#.#.[..........#  Cast: Poisonous Vapours .# #.##.###.#.#............# ki^ 5.# ##..†...#.#.#............#  #.....#.#.#.#............#  K   kobold (missile, asleep) .#####.#####.#.#.#............# ....†......#.#.#.#............. #######........#.##.......####. Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a kobold, wielding a +0 club and quivering stones (asleep, chance to  weaken: 100%)  The glob of mercury hits the kobold! The kobold looks weaker.kis Z #.# #.#     †'...... ###. ....)**. . .  [....  . ##..†. #.#.....#.#....†#.#....##.kiK ..ki1O w2==2.5 (1Poisonous VapourskiU ki;X   Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a kobold, wielding a +0 club and quivering stones (asleep, chance to  weaken: 100%)  The glob of mercury hits the kobold! The kobold looks weaker. _You kill the kobold!kif  Casting: Mercury Arrow (safe; 9% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki.ki/ki4ki$7 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki _kinkiWkikif5====kikikixkikikikikikin 5====ki7 kig ki ki kiki,kiki*kiN6====kikikikikiki"kig$ki$ki_%ki&ki',ki*(ki.)ki*kih*<====ki*ki+ki,,ki:-kiA.ki20ki0ki1ki2ki3ki3kiL4ki4ki5,kip6ki6ki7kiB8ki8ki9ki;kix;ki;ki=ki>kiM?ki?ki@ki$BkiBki=CkiUEkiFki7GkiGkiIkiJkiKki5LkiNkiP,kiQkiT7 _You open the door.kiUki@VkiYWki[@  There is an open door here.ki$]ki] _ki^ki`ki'bkibkiWckidkiBfkifkiCgkiiki.jkij,kifkkilkil,kimkinq  You encounter a bombardier beetle.kis......#.##.......####. ..#.###.##.......# ###.# #..........+ ....######.......##. ÷......##........... ................## # .......####'##### B.. ..÷....# #.######..### .......# #....@....... --kiyt......###########.#.#.. ............. .. ......####### ##.#...[# ......####B   bombardier beetle (asleep)...#............### ......##....kiuh.B92.5 (40.0)kiyOBki zN--3.5 (41 _ki)kiـki6. . #.... ÷. . # '##### ... ÷....# #.######.B###  #....@....... #######.#.#..  ..  ## ki7P[###..ki . . #.... ÷. . # '##### ... ÷....# #.######.B###  #....@....... #######.#.#..  ..  ##[#kii ki< ki% kip h _A bombardier beetle is nearby!kii . . #.... ÷. . # '##### ... ÷....# #.######.B###  #....@....... #######.#.#..  ..  ## kii P[###..kij . . #.... ÷. . # '##### ... ÷....# #.######.B###  #....@....... #######.#.#..  ..  ##[#ki ki ki ki ki h _A bombardier beetle is nearby!ki  Casting: Mercury Arrow (safe; 9% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki4kiWkiR _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki......#.##.......####.ludeguy the Apothecary ..#.###.##.......#Octopode ###.# #..........+Health: 21/21 ======================== ....######.......##.Magic: 4/6================-------- ÷......##...........AC: 1Str: 7 .................## #EV: 12kiVInt: 19 ........####'##### ...SH: 0Dex: 12 ...÷....# #.######*B###XL:  3 Next: 22% Place: Dungeon:2 ........# #....@**.....Noise: ---------  Time: 1593.5 (0.0) .......###########.#.#..c) +0 dagger (protect) .............. ..Cast: Poisonous Vapours .......######### ..#...[# ......####B   bombardier beetle (weak) ....#....... .........### ......##....Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a bombardier beetle (chance to weaken: 100%)  The glob of mercury hits the bombardier beetle.  The bombardier beetle looks weaker.kiU.Bki"'.....kiM==4.5 (1Poisonous Vapourski:ki  Aiming: Mercury Arrow (safe; 9% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a bombardier beetle (chance to weaken: 100%)  The glob of mercury hits the bombardier beetle.bombardier beetle looks weaker. _The bombardier beetle is moderately wounded.kiV ......#.##.......####.ludeguy the Apothecary ..#.###.##.......#Octopode ###.# #..........+Health: 21/21 ======================== ....######.......##.Magic: 3/6============------------ ÷......##...........AC: 1ki Str: 7 .................## #EV: 12Int: 19 ........####'##### ...SH: 0Dex: 12 ...÷....# #.######..###XL:  3 Next: 22% Place: Dungeon:2 ........# #....@..B....Noise: ==-------  Time: 1594.5 (0.0) .......###########.#.#..c) +0 dagger (protect) .............. ..Cast: Poisonous Vapours .......######### ..#...[# ......####B   bombardier beetle (poisoned, weak) ....#....... .........### ......##....Casting: Mercury Arrow (safe; 9% risk of failure)  ki Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a bombardier beetle (moderately wounded, weak)  Poisonous fumes billow around the bombardier beetle!ki4 3-5.5 (1ki ki !onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  ki Aim: a bombardier beetle (moderately wounded, weak)  Poisonous fumes billow around the bombardier beetle! _The bombardier beetle is poisoned.ki......#.##.......####.  ludeguy the Apothecary ..#.###.##.......# Octopode ###.# #..........+ Health: 21/21 ======================== ....######.......##.  Magic: 2/6========---------------- ÷......##...........  AC: 1Str: 7 .................## #  EV: 12kiYInt: 19 ........####'##### ...  SH: 0Dex: 12 ...÷....# #.######..###  XL:  3 Next: 22% Place: Dungeon:2 ........# #....@.B.....  Noise: =--------  Time: 1595.5 (0.0) .......###########.#.#..  c) +0 dagger (protect) .............. ..  Cast: Poisonous Vapours .......####### ## ..#...[# ......#### B   bombardier beetle (poisoned, weak) ....#....... .........### ......##....Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetkiAim: a bombardier beetle (heavily wounded, poisoned, weak)  Poisonous fumes billow around the bombardier beetle!ki#. . #.... ÷. . # '##### ... ÷....# #.######..###  #..... #######.#.#..  ..  ##ki$[# very poisoned, weak)kir%$6.5 (1ki+/2onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  Aim: a bombardier beetle (heavily wounded, poisoned, weak)  Poisonous fumes billow around the bombardier beetle! _The bombardier beetle looks even sicker.ki!......#.##.......####.ludeguy the Apothecary ..#.###.##.......#Octopode ###.# #..........+Health: 21/21 ======================== ....######.......##.Magic: 1/6====-------------------- ÷......##...........AC: 1Str: 7 .................## #EV: 12Int: 19 ........####'##### ...SH: 0Dex: 12 ...÷....# #.######..###XL:  3 Next: 22% Place: Dungeon:2 ........# #....@.B.....ki5iNoise: =--------  Time: 1596.5 (0.0) .......###########.#.#..c) +0 dagger (protect) .............. ..Cast: Poisonous Vapours .......######### ..#...[# ......####B   bombardier beetle (very poisoned, weak)....#....... .........### ......##....Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a bombardier beetle (severely wounded, very poisoned, weak)  Poisonous fumes billow around the bombardier beetle!kiǪ+7.5 (1kiki"onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  Aim: a bombardier beetle (severely wounded, very poisoned, weak)  Poisonous fumes billow around the bombardier beetle! _The bombardier beetle looks even sicker.kiN ......#.##.......####.  ludeguy the Apothecary ..#.###.##.......# Octopode ###.# #..........+ Health: 21/21 ======================== ....######.......##.  Magic: 0/6------------------------ ÷......##...........  AC: 1Str: 7 .................## #  EV: 12Int: 19 ........####'##### ...  SH: 0Dex: 12 ...÷....# #.######..###  XL:  3 Next: 22% Place: Dungeon:2 kinQ ........# #....@.†.....  Noise: =--------  Time: 1597.5 (0.0) .......###########.#.#..  c) +0 dagger (protect) .............. ..  Cast: Poisonous Vapours .......####### ## ..#...[# ......#### B   bombardier beetle (very poisoned, weak)....#....... .........### ......##....Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a bombardier beetle (almost dead, very poisoned, weak)  Poisonous fumes billow around the bombardier beetle!kiX . . #.... ÷. . # '##### ... ÷....# #.######..###  #..... #######.#.#..  ..  ##[#kiBY kiY kih $ki.j ;......#.##.......####.kij 4ludeguy the Apothecary kik ?..#.###.##.......#kil Octopode ###.# #..........+kio Health: 21/21 ======================== ....######.......##.Magic: 0/6------------------------ ÷......##...........AC: 1Str: 7 .................## #EV: 12Int: 19 ........####'##### ...SH: 0Dex: 12 ...÷....# #.######..###XL:  3 Next: 118% Place: Dungeon:2 ........# #....@.†.....ki˂ Noise: =--------  Time: 1598.5 (1.0) .......###########.#.#..c) +0 dagger (protect) .............. ..Cast: Poisonous Vapours .......######### ..#...[# ......#### ....#....... .........### ......##....Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: a bombardier beetle (almost dead, very poisoned, weak)  Poisonous fumes billow around the bombardier beetle!  Aim  Press: ? - help, Dir - move target: a bombardier beetle (almost dead, very poisoned, weak)  Poisonous fumes billow around the bombardier beetle! _You kill the bombardier beetle!  You have reached level 4!  --more--ki ~7/27740% Poisonous Vapourski ki 4 _kiykiz3ki}kiӁ: _kiLkiԃkicki,kikie,kikikiD1===kiukiVkiݎkiFki,kikikiZkiHkioki ;===kikiښki,kibki,kikiGkikikiki(ki2===ki,ki<ki),kiŲkikiki&kikiC;===kiֻkivki~,ki,ki}ki,kiki>Bki ,kikiAkiV3====kiTki,kikid,kikiBki,R====kikiBki%ki,ki[kikiikiBkikikikiLe4===kikiki,ki8ki=g===kiki,kiBkiBkiX,kiki!,kikikif5====kikikikikikikiki1kikiki<====kiMkiBkiki ki ki kiW ki& ki ki,kiV,kidkiEkiM6===kiZkikiki ki;===ki kih!,ki"ki#,ki$ki&ki&ki'ki(ki(ki)ki^*ki*kif+kiy-ki.G7====ki.ki0ki=  You see here a bombardier beetle corpse.ki?5 _kiBkiKDkiD<====kifEkivIki>LkiLki_MkiQkiRkiZSkiQTkiWkiYj  You encounter an endoplasm.kiHa#.#.#.....# #.#.#.....# .#.#.#......#.##.......####. # .###.##.......#### J## #..........+..# .. ki"b######.......##.##.# .##..............# .......##@####...-####'######...... ÷....# #.######..####..# #......†.....#..###########.#.#..#............#....#J   endoplasm (asleep)##########.### ##.#kib[# #.###### #.#kij1669.5 (71.0)kikN-70.5 (72 _kiskiuki&... # .....#### J#  .....+..# .. .....##.##.# ...........# . #@# #........ ÷....# #..####..  #......†.....# .#.#..# ....#....# #.### ##.# [# #.# #  #.#ki ... # .....#### J#  .....+..# .. .....##.##.# ...........# . #@# #........ ÷....# #..####..  #......†....#.#.....#....# #.### ##[# #.#  ki ki kig ki a _An endoplasm is nearby!ki &... # .....#### J#  .....+..# .. .....##.##.# ...........# . #@# #........ ÷....# #..####..  #......†.....# .#.#..# ....#....# #.### ##.# [# #.# #  #.#kiB F.ki@D b.. # .....#### J#  .....+..# .. .....##.##.# ...........# . #@# #........ ÷....# #..####..  #......†....#.#.....#....# #.### ##[# #.#  kih4--4.5 (1kiwnkip _You hear an angry hiss.asting: Mercury Arrow (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  kiqYou encounter Natasha, Servant of Life and Death. _You encounter a hobgoblin.ki [ .#.#............# ludeguy the Apothecary .#.#............#.. Octopode .#.#............#.# Health: 27/27 ======================== .#.#..............# #  Magic: 3/7==========-------------- .#.##.......####..#.#  AC: 1Str: 7 ##.##.......#### .#.#  EV: 12Int: 19  #..........+..# ..h  SH: 0Dex: 12 #####.......##.##.# XL:  4 Next: 13% Place: Dungeon:2 ..##............@.# .  Noise: ---------  Time: 1674.5 (0.0) ............##.####...  c) [0;10;ki ^ 1m+0 dagger (protect) ...####'######........  Cast: Poisonous Vapours ...# #.######..####.. ...# #......†.....# ..###########.#.#..#  h   Natasha ................#....#  g   hobgoblin (wandering) ..###########.### ##.# .[# #.# # Casting: Mercury Arrow (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 8% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a hobgoblin (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the hobgoblin. The hobgoblin looks weaker....#.# #   .#.#   ..h ...... . ...    †  ##.#[# #.# kij Ch.ki <5==5.5 (1ki ki "onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 8% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a hobgoblin (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the hobgoblin. The hobgoblin looks weaker. _You kill the hobgoblin! ki.#.#............# ludeguy the Apothecary .#.#............#.. Octopode .#.#............#.# Health: 27/27 ======================== .#.#..............# #  Magic: 2/7======------------------ .#.##.......####..#.#  AC: 1Str: 7  ki##.##.......#### .#.#  EV: 12Int: 19  #..........+..# ...  SH: 0Dex: 12 #####.......##.##h# XL:  4 Next: 15% Place: Dungeon:2 ..##............@.# .  Noise: ==-------  Time: 1675.5 (0.0) ............##.####...  c) +0 dagger (protect) ...####'######........  Cast: Poisonous Vapours ...# #.######..####.. ...# #......†.....# ..###########.#.#..#  h   Natasha ................#....# ..###########.### ##.# .[# #.# # _You kill the hobgoblin!Casting: Mercury Arrow (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. kiAiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: Natasha ki...#.# # .#.# #### .#.#  +..# ...  ki{@...##.##h#.......@.# . ...##.####... #   † (poisoned) kiU ##.#[# #.#  ki3-6.5 (1 ki ki4"  Casting: Mercury Arrow (safe; 8% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  ki"xAim: Natasha _Poisonous fumes billow around Natasha! Natasha is poisoned. ki] ^.#.#............#ludeguy the Apothecary .#.#............#..Octopode .#.#............#.#Health: 27/27 ======================== .#.#..............# #Magic: 1/7===--------------------- .#.##.......####..#.#AC: 1Str: 7 ##.##.......#### .#.#EV: 12Int: 19  #..........+..# ...SH: 0 ki^ ]Dex: 12 #####.......##.##h#XL:  4 Next: 15% Place: Dungeon:2 ..##............@.# .Noise: =--------  Time: 1676.5 (0.0) ............##.####...c) +0 dagger (protect) ...####'######........Cast: Poisonous Vapours ...# #.######..####.. ...# #......†.....# ..###########.#.#..#h   Natasha (poisoned) ................#....# ..###########.### ##.# .[##.## _Poisonous fumes billow around Natasha! Natasha is poisoned.  Casting: Poisonous Vapours (safe; 8% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move targetAim: Natasha (lightly wounded, poisoned) ki_ 19--------Contam: 10% =7.5 (1 kie  kih P  Casting: Poisonous Vapours (safe; 8% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 8% risk of failure)  Press: ? - help, Dir - move target  Aim: Natasha (lightly wounded, poisoned) _You miscast Poisonous Vapours. Nothing appears to happen. Natasha claws you! ki+55   cerulean imp (polearm, summoned)  Aim: Natasha (lightly wounded, poisoned) _You miscast Poisonous Vapours. Nothing appears to happen. Natasha claws you!  You closely miss Natasha. Your grab misses Natasha.  Your squeeze misses Natasha.  Natasha is lightly wounded.  Natasha mewls in sadness. ki&8 ki kic _Natasha mumbles some strange words. kiV §Natasha mumbles some strange words. grab Natasha. You squeeze Natasha!  Natasha is almost dead.  You constrict Natasha.  You kill Natasha!  Natasha yowls pathetically as she dies! kiW . ki] 8. kiBc f 57-9Poisonous Vapours  kic n_The cerulean imp disappears in a puff of smoke! kii  kik m _Your Conjurations skill increases to level 2! ki 3 ki  kiO  ki _20=------- ki  ki U2=== ki#  ki  ki  ki=  ki  ki 98%  ki  kin  ki |1==6 ki  ki  ki U===4 ki*  ki  ki 72 ki  kir  ki2 = ki _Your magical contamination has completely faded away.= ki  ki  ki K2= ki  ki   ki  ki"  kin 93 ki I==== ki  ki$ , ki  ki- h3== ki  ki:  ki , kiG  ki R==== ki| , ki  ki!  ki! a4== ki!  ki #  ki#  ki$$  kiA& , ki&  ki(  ki(  ki(  ki.*  ki* 5==4=== ki/+  kio,  ki,  ki-  kiu.  ki.  kiR/  kil0  ki0  kiQ1  kiX2  ki2 6===== kiV3  ki4  ki05 , ki6  ki7 , ki7  ki8 , ki'9  ki9 h7== ki9  ki:  kiU;  ki;  ki<  ki<= P5==== ki=  ki?  ki@ , kiHA  kiA 9= ki>B  kihC , ki*D  kiDE  kiE R==== kiXG  kiH , kieI  ki J , kiPK  kiK , kiM  kiN , ki%P  kiP , ki1R  kiR M6=== kidS  kinT  kiT , ki_V , kiV  ki{W  kiW , kiX  ki)Y Q=== kiY  kiCZ  kiZ  ki[  ki\  ki]  ki]  ki^ , ki)`  kia , ki b B kijc z7==== kid  kie  kiSf  kif  ki$h  kiri  kii  kiKj  ki[m  kio , ki:p  ki^q  kir  kiYs K==== kiwt  kiu  ki5v  kiv  kiw  ki`x  kix , ki~ ...#.# ....#.#.#  ............#....  . ki k...........#.#.####  ..............#.#..  #.......####..#.#.#  #.####..#.#.#  ........+..#..... #.......##.##.#.@.#   ki --.....#...#  .....##.####...#  ###'######........#   #.######..####..#   ki  #......†.....#..#    #########.#.#..#..#   ..........#....##    #########.### ##.#    kiz  ki 1738.5 (59.0) kie F-9.5 (60 kik  ki \ _f - a sedimented cyan potion ki$  ki% 3 ki(  ki*  kij+  kim. , ki. , ki/  ki1  ki3  kiH4  ki 5  ki6  kiv8  ki8  ki9  ki];  ki=  ki=  ki">  ki)@  kiA , kipV #  #  #  #  #.#.#  ..#.#  .....  #.#.#######.# ...#.#...@...# ####..#.#.####### ####..#.#.#  ....+..#......#  ....##.##.#...#  ....#...#  ....##.####...#  ######..#  ..####..#  46.5 (7.0)7.5 (8 kiX  kiZ d _h - a scroll labelled GETAEGREE VIBEki@okip3kiuqki skis,ki1xnkix,kijykizkiv{ki|,ki}kiki,kikiki,kiki8kiʄ,kikikiʇ,kiki ki,kikiki,kiEkiۏ,kinkikiВkil,kikiki,kiki~ki,kiki ki,kikiki,kiki,kikipki,ki}kiUkiRki,kiEkiki,kikiBkiki%ki,kikija # #####  #.#. ...# ki #....##.#####  #...@.....# 69.5 (22.0) #...#.###.# ########### #...#.# #.# ......# #...#.# #.# ......+..>..#.# #.# ki#.#...#.# #.# ......#.#...#.# #.# ..........# #####.# #.# ..........# ..# #.# kieki-70.5 (23kiki; _Found a stone staircase leading down.ki < kiB kiD XkiF kiO kitR nkiS ,kiZ nki[ ,kik] ki_ kiga ,kib kie kij Xkiqk kik ki]l kim ki2o kio ,kiq kix #............#.#...#.# #.# '............+..>..#.# #.# #............#.#...#.# #.# #............#.#...#.# #.# #............#.#####.# #.# #............#.......# #.# kiy '#.[..........#...##### #.# #............#.#.# #.# #............#.#@# #.# 85.5 (15 #............#.......<.#.# ............#.#.#######.# #.....#.#.......# ######..#.#.####### ki(z ######..#.#.#+..#......# ####.##.#...# #.....#...#ki ki ,6.5 (16kḯ ki 9 _Found a stone staircase leading up.kiki3kiZkiėki6,ki kio,kikikicki,kiԦkiki6kiԨki۩ki=kikiYkizkiki kikiki˱ki0kikikikiyki*kiHki,ki ki,kiFkiki+ki^kiqkikizkiAkiCkiki2ki=kiAkikikiTki ki,kikiki,ki:kiEBki4kibki,kikic,ki kilkiki`,kiukiki~,kikix,kiWki kicBkiki)ki,kiki,kiHki!kikiki3ki{Xkikikikikiki,ki9 ki ki, ki ki kikkikiPkiki[.# #....#..# ###########.#.#..#..# ..#....## ##########.######.#  #.# #...# ## #######.####.### ........# ..#########.#####  #.......  #### #........# ki*9.. ............# # ....##########  #### ki .816.5 (30kiy!,7.5 (31ki9%ki8'Z _j - a bubbling grey potionkiki3kiԥkidki>,kiBkibkirkiHki,kiòkih,ki#kikikiZ,kikiXki,kiѾkiPkikikiki,kiykikizki<,kikikiki+ki kikiki3kikikivki>kikiuki)kikikikiBkikikiH,kikikiki,kikixkikiki&ki,kikiki,kikiIkid&........#............# ..............#########.###### ##.####.......#........#  #..>......##.#........# ...#†#.......................# .#.#.#..).####......########## .#.#+#....# #.######### kiI .....# #.#...<.... .....# ##.#36.5 (19  ....## #... ...# # #.... #....##....##.....#......#...##..kiki,7.5 (20kiki9 _Found a stone staircase leading up.kiO3kikikiki,kiXki ki ,ki ki:ki,kikieP  There is a stone staircase leading up here.kizkiC _kikikikiskikiTkiw,kiFkiki!ki!kiA"ki$,ki%ki(L _You now have 65 gold pieces (gained 9).ki*3kiQ+ki&-ki/,ki/ki1ki2ki3ki&4ki~5kiF7ki7kiz8ki9ki:kij;ki(<ki<ki>ki~?kiN@kiBkiDkiDkiFEkiFkiG,kivHkiIki1KkiKki@LkiMkiFOkiOki-PkitQkiRkiSkiSkiTki=V,ki!WkiWki-YkiY,kiZkic\ki],ki^ki_ki`,kiakiYbkic,kickidkie,kifkihkih,kiikijkiqk,kiblki`mkin,kinki(pkip,kiqkirkios,ki)tkiXukiv,kivkiwkikx,kiyki{Bki|ki~ki~,kiki{ki2,kikiFki,ki܄ki̅ki,kijkikiP,ki3kiYki$,ki7ki%kiގ,kiڏkikȋ,kikiki̔,kikiki,kiykiSki$,ki͚kiNki,kikiki,kikikiI,kiki.ki,kikiski+,kikiDki,kiѪki?ki,kiɮkiki,kikiki³,kikiki,ki`kiwkiN,kiHkikiJ,kiǽki,kiki:kikiIkiki$ki<kikiki\kikiUkikikilkikikikiki,kikioBki/kiEkikikiZkikid,kikiki,ki=kiki,kiki,kikiki@Xki.,kikikiki7ki"ki kiki)kiki ,ki ,ki ki ,ki ki ki# ,ki ki ki ki ki ki  ki ki/ ki kiO" ki# ki$ kix$ kin) Xki!, P  There is a stone staircase leading up here.kiL- ki-  _kio. ki 0 kie1 ki1 ki<2 ki3 ki*5 ki5 ki6 ki:8 ki9 kiM: ki: kih< ki= ki= kid> ki? ki%A kiA kiA kicC kiE ,kiIF ki$H kiI ki:J ki#K kiVL kiM ,kiN kiP ki7R ,ki#S ki U kiV kiW ki X kiY ki[ kii\ ki<] ki _ ki` ,ki1b kic kie kif kif kiJh ki"j kij kiUk kim kin kiro ki p kiuq ki/s kis kiut kix kiy ki.z kiz kiL| ki~ ki~ kiY ki ki[ ki kie ki ki ,ki_ ki ki ki ki kiߌ ki ki ,kiM ki- ki ,ki^ kiS kiߔ ,kiǖ 7 _You open the door.ki! ki 3kiN @  There is an open door here.kiʝ kib  _kiߞ ki kij ki kil ki @  There is an open door here.ki ki  _ki~ kiߨ kiJ ki kil kiw kix ki kim kiװ ki ki" ki ki ki ki ki4 ki kiS kiغ kiM ki ki ,kif ki, ki ki ki[ ki ki' F ...######.##......##. #.... ###..>......### ###.... #...#†#........ ......$ #.#.#.#..).#### ##..... #.#.#+#....# # .....>. #.#........# # kiP #.!.... #.#........# ## .......###.........## #. .....$.@...#.......# #.953.5 (116.0) .......###.#.#####.# #. ....... #.#.##....# #........ #.#..'....# #........ #.####...## #........ #.# #...# #. ...#### #.# #...# #. ... #.# ##### #.  ## ki ki ,47ki ki 2 _Found an escape hatch in the floor.ki Q _There is an open door here.ki ki ki( kiU ki  You encounter a goblin. It is wielding a +0 club.kiE  ...######.##......## #....# ###..>......#....# #...#†#....... ......$# #.#.#.#..).#.....# #.#.#+#....# .>.# #.#........# .#.!....# #.#........# .###.........## #.$@'...#.# #.###.#.#####.# #g.. #.#.##....# #..##.#..'....# #..##.####...## #..##.# #...# # g   goblin (asleep).####.##.# #...# kiě  ##... .##.# ##### # #ki ,0.0)ki% 25.5 (1 _ki; ki kiF #....# ###..> ####....# #...#† ......$# ) ###.....#   ......>.#   .#.!....# #.#..  ........###....  ......$@'...#  ........###.#  g........   .........#  .........#  .........##.# #...#  ....####.##.# #...#  #... .##.# ##### kid #....# ###..> ####....# #...#† ......$# ) ###.....#   ......>.#   .#.!....# #.#..  ........###....  ......$@'...#  ........###.#  g........   .........#  .........#  .........##.# #...# ki$ ....####.##.# #...#  #... .##.# ##### kikiekiki] _A goblin is nearby!ki F #....# ###..> ####....# #...#† ......$# ) ###.....#   ......>.#   .#.!....# #.#..  ........###....  ......$@'...#  ........###.#  g........   .........#  .........#  .........##.# #...#  ....####.##.# #...#  #... .##.# ##### kiʴq #....# ###..> ####....# #...#† ......$# ) ###.....#   ......>.#   kiY.#.!....# #.#..  ........###....  ......$@'...#  ........###.#  g........   .........#  .........#  .........##.# #...#  ....####.##.# #...#  #... .##.# ##### kikikiPki~] _A goblin is nearby!ki  Casting: Poisonous Vapours (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki} 4ki ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki'D ...######.##...... #....# ###..>...... ####....# #...#†# ......$# #.#.#.#..).#.....# #.#.#+#....#.>.# #.#.##.#.!....# #.#..# #.###.## ki)#......@.'...#.# #.###.#.#####.# #g.##.#.##....# #.##.#..'....##.##.####...###.##.# #...# .####.##.# #...##... .##.# # ki-!.gki6Rgki7/==6kiG>kiy@! _The goblin shouts!kiWBR _You see here 15 gold pieces.ki>  Casting: Poisonous Vapours (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki4ki:ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiU' W ...######.##...... #....# ###..>...... ####....# #...#†# ......$# #.#.#.#..). ####.....# #.#.#+#....# .......>.# #.#.#ki(  #.#.!....# #.#.# #.###.## #$.'...#.# #.###.#.#####.# #.g.##.#.##....#  #.##.#..'....#  #.##.####...## #.##.# #...#......####.##.# #...####... .##.# #####ki7* !.gki1 ki3 R--7Poisonous Vapours _ki9: ki; kie  ...######.##...... ludeguy the Apothecary #....# ###..>...... Octopode ####....# #...#†#..... Health: 27/27 ======================== ......$# #.#.#.#..).# Magic: 5/7=================------- ####.....# #.#.#+#....# AC: 1Str: 7 .......>.# #.#........# EV: 12Int: 19 #.#.!....# #.#........# SH: 0Dex: 12 #........###.........## XL:  4 Next: 57% Place: Dungeon:2 #.....@$.'...#.......#  Noise: ---------  Time: 1957.5 (0.0) #........###.#.#####.#  c) +0 dagger (protect) #..)kik [39;49m......##.#.##....#  Cast: Poisonous Vapours #.........##.#..'....#  #.........##.####...##  #.........##.# #...#  g   goblin ......####.##.# #...#  ###... .##.# ##### Casting: Poisonous Vapours (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a goblin, wielding a +0 club (chance to weaken: 100%)  The glob of mercury hits the goblin. The goblin looks weaker. #....# ###..> ####....# #...#† ......$# ) ##  ..  #.  #.#.. #...#  #...**...###.# [11;10ki H #.  #. #. #.........##.#  ......####.##.#  ###... .##.#  ki "..ki w9==8.5 (1Poisonous Vapourskio& ki( onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a goblin, wielding a +0 club (chance to weaken: 100%)  The glob of mercury hits the goblin. The goblin looks weaker. _You kill the goblin!kiX  Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kib4kimki, _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiy{]...######.##......##....# ###..>......#####....# #...#†#.......$# #.#.#.#..).#####.....# #.#.#+#....# .......>.# #.#.# #.#.!....# #.#.# #.###.## #..'...#.kiU}# #.###.#.#####.# #..)......##.#.##....# .#ki1ki6--9 _kiPkikiՖG--60.5 (2kiלki$> _You now have 80 gold pieces (gained 15).ki9  ...######.##...... #....# ###..>...... ####....# #...#†# ......$# #.#.#.#..). ####.....# #.#.#+#....# .......>.# #.#.# #.#.!....# #.#.# #.###.## #.'...#.# #.###.#.#####.# #..)......##.#.##....#  #.##.#..'....#  #.##.####...##  #.##.# #...# ......####.##.# #...#[ki; 40m ###... .##.# #####kiA kiB +1.5 (1kipH kiI ki= ......).... •...######.## #....# ###..>####....# #...#†#.... ......$# #.#.#.#..).#####.....# #.#.#+#.... .......>.# #.#. #.#.!....# #.#.. #ki,.###..# #.'...#.......# #..##.#.#####.# #..)......##.#.##....# #.##.#..'....# #.##.####...## #.........##.# #...# ......####.##.# #...####... .##.# #####ki%ki%&2ki+ki-+ _Found 3 flux baubles.ki ###### ......).... •...######.## #....# ###..>####....# #...#†#.. ......$# #.#.#.#..)#######.....# #.#.#+#..........>.# #.# #.#.@....# #.#. #.###.. #.'...#....... #..ki-##.#.#####. #..)......##.#.##.... #.##.#..'....  #.##.####...#  #.........##.# #...#  ......####.##.# #...# ki߶ki&3ki۽kiAki +4.5 (2kigkib _c - 2 potions of curing (gained 1)kiuD#........######.#.......)......•...######.##. #....# ###..>..####....# #...#†#.... ......$# #.#.#.#..)#######.....# #.#.#+#........@.>.# #.#.###.## #.##.###...##.'...#.......##........###.#.#####.##..)##.#.##....##.##.#..'....##.##.####...###.........##.# #...#kiFUkiV+5.5 (1kia]ki _kiS[#.#....#..........######.#........)......•...######.##. #....# ###..>..######....# #...#†#.... .........$# #.#.#.#..).########..@..# #.#.#+#....#..........>.# #.#.####.## #.#kirU #.###...##.'...#.......##........###.#.#####.##..)##.#.##....##.##.#..'....##.##.####...#ki\\ki]&6kiakihckiu #......#.......#.#...[......#.......#......######.#kiq L.........).......•...######.##......# #....# ###..>......#######....# #...#†#...... ........@$# #.#.#.#..).########.....# #.#.#+#....# ..........>.# #.#.# ###.## #.###.###...##.'...#.......##........###.#.#####.#ki #..)##.#.##....##.##.#..'....#kiz kiD #6ki 3===7ki@ ki kin#......#.#......#.#...[#......#.#......######.#...........)..•...######.##......##....# ###..>......#######....# #...#†#..# #.#.#.#..).##.....# #.#.#+#....# .>.# #.#.# kipI###.#......# #.#.# ##.###.## ##.'...#.# # #.###.#.#####.# # #..)......##.#.##....# # #.##.#..'....# # kiykiz&8ki kiUki+9.5 (2ki7ki]= _You now have 84 gold pieces (gained 4).kiK...#......#. ......##.......... h.....##...[ ......#.......########...........)........•...######.##...... #....# ###..>#kiM@ ######..@.# #...#†#...... ..........# #.#.#.#..).## #######.....# #.#.#+#....#..........>.# #.#.####.#......# #.#..# #.###..## h   Natasha (wandering) #.'...#.......# #..###.#.#####.# #..)......##.#.##....#kiNkiV  You encounter Natasha, Servant of Life and Death.ki[a/  --more--kisHG.hkiPWhkiQ,70.5 (1kiXki Y- _Natasha hisses angrily.ki  Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiI4kiki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki]  ...####+###.#......#.##...............##...h....#.....K#######............)......$...•...######.##...... #.@..# ###..> ######....# #...#†#..... ..........# #.#.#.#..).# #######.....# #.#.#+#....#......ki@_ ^>.# #.#.####.#......# #.#..# #..###..## K   kobold (wandering) #.'...#.......# #..#.#.#####.#kib .hYou encounter a kobold. It is wielding a +0 short sword.kib 2K.kih kiHj D===1kio kivr + _Found 17 gold pieces.ki5H...####+###......... ludeguy the Apothecary.......#......#......... Octopode.......#......#......... Health: 27/27 ========================.......#............#... Magic: 4/7=============-----------.K.h...#................ AC: 1Str: 7....*..######.........#. EV: 12Int: 19.....*......)........... SH: 0Dex: 12.$...•*..######.##...... XL:  4 Next: 59% Place: Dungeon:2#.@..# ###..>...... Noise: ---------  Time: 1971.5 (0.0)######....# #...#†#.....[kiI37m c) +0 dagger (protect)..........# #.#.#.#..).# Cast: Poisonous Vapours#######.....# #.#.#+#....#..........>.# #.#........####.#......# #.#........# h   Natasha (weak)#........###.........## K   kobold (wandering)#........'...#.......##........###.#.#####.#Casting: Mercury Arrow (safe; 7% risk of failure)  ki|Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Natasha (chance to weaken: 100%)  The glob of mercury hits Natasha. Natasha looks weaker.ki.KAim  Press: ? - help, Shift-Dir - straight line: Natasha (chance to weaken: 100%)  The glob of mercury hits Natasha. Natasha looks weaker.  Natasha is heavily wounded.kobold shouts!ki~k5...5   cerulean imp (polearm, summoned)K   kobold==2.5 (1kiMki!V _Natasha casts a spell.ki ...####+###......... ludeguy the Apothecary .......#......#......... Octopode .......#......#......... Health: 27/27 ======================== ....§..#............#... Magic: 2/7======------------------ ...h...#................ AC: 1Str: 7 ..K....######.........#. EV: 12Int: 19 ............)........... SH: 0Dex: 12 .$...•...######.##...... XL:  4 Next: 59% Place: Dungeon:2 #.@..# ###..>...... Noise: ==-------  Time: 1972.5 (0.0) ######....# #...#†#..... c) +0 dagger (protect) ..........#ki[34m #.#.#.#..).# Cast: Poisonous Vapours #######.....# #.#.#+#....# ki..........>.# #.#........# ###.#......# #.#........# h   Natasha (weak) #........###.........## 5   cerulean imp (polearm, summoned) #........'...#.......#  K   kobold #........###.#.#####.# Press: ? - help, Shift-Dir - straight linekiAim: Natasha (heavily wounded, weak, chance to weaken: 100%)  The glob of mercury hits Natasha! Natasha looks even weaker.  The mercury splashes! The kobold looks weaker. The cerulean imp looks weaker.  You kill Natasha!Natasha yowls pathetically as she dies!ki1†kia$ ....... ....... ....§.. ... ..K.* .....*ki%) .$...•*  ###..>  #...#†  )     ###.#......# K   kobold (weak) #........# #........' kiMF.Kki +...kiki'...####+###......... ludeguy the Sneak.......#......#......... Octopode.......#......#......... Health: 27/27 ========================....§..#............#... Magic: 2/7======------------------...†...#................ AC: 1Str: 7.......######.........#. EV: 12kiOzInt: 19...K........)........... SH: 0Dex: 12.$...•...######.##...... XL:  4 Next: 101% Place: Dungeon:2#.@..# ###..>...... Noise: ==-------  Time: 1973.5 (1.0)######....# #...#†#..... c) +0 dagger (protect)..........# #.#.#.#..).# Cast: Poisonous Vapours#######.....# #.#.#+#....#..........>.# #.#........####.#......# #.#........# K   kobold (weak)#........###.........###........'...#.......##........###.#.#####.#kiThe glob of mercury hits Natasha! Natasha looks even weaker.  The mercury splashes! The kobold looks weaker. The cerulean imp looks weaker.  You kill Natasha!Natasha yowls pathetically as she dies! _The cerulean imp disappears in a puff of smoke!Your Stealth skill increases to level 4!kiJYou kill Natasha!  kiNatasha yowls pathetically as she dies! _The cerulean imp disappears in a puff of smoke!Your Stealth skill increases to level 4!  Your Alchemy skill increases to level 4! have reached level 5!ki>/  --more--kiV)31/31kiWD2/885 0% ki^ki`R _You feel stronger.ki)W ...####+####.#......#.#......#$....§..#.#.†...#.######.#.K..).$...•...######.## #@...# ###..> ######....# #...#†# ..........# #.#.#.#..). #######.....# #.#.#+#.... ..........>.# #.#. ###.#......# #.#. #..###.  #.'...#.#  #.###.#.#####.#.KkiMkiH--4Poisonous VapourskiHki{+ _Found 18 gold pieces.ki#  ...####+###........ ludeguy the Sneak #.......#......#........ Octopode ........#......#........ Health: 31/31 ========================ki %  $....§..#............#.. Magic: 0/8------------------------ ....†...#............... AC: 1Str: 8 ........######.........# EV: 12Int: 19 .............).......... SH: 0Dex: 12 ..$..)•...######.##..... XL:  5 Next:  0% Place: Dungeon:2 #@...# ###..>..... Noise: ---------  Time: 1974.5 (0.0) ######....# #...#†#.... c) +0 dagger (protect) ..........# #.#.#.#..). Cast: Poisonous Vapours #######.....# #.#.#+#.... ki& ..........>.# #.#........ ###.#......# #.#........ K   kobold (weak) #........###.........# #........'...#.......# #........###.#.#####.#Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a kobold, wielding a +0 short sword (weak, chance to weaken: 100%)  The glob of mercury hits the kobold! The kobold looks even weaker.ki+  #.......# ........# kin, $....§..# ... ...## ....) ..$..)*  ###..>  #...#†  )ki, Z     ###.#......#  #........#  ki- #........'   ki $.•ki 91==5.5 (1Poisonous Vapourski ki_ %onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight line  ki Aim: a kobold, wielding a +0 short sword (weak, chance to weaken: 100%)  The glob of mercury hits the kobold! The kobold looks even weaker. _You kill the kobold!kin}X #......... #.####+#####.#......#..##.....$.......##†...#.....######............).......$..)@...######.##..######....# ###..>ki5 ######....# #...#†#.. ..........# #.#.#.#..) #######.....# #.#.#+#..........>.# #.####.#......# #.#. #........###.. #.'...#.......kiki0/--6kiki\R _You see here 3 flux baubles.ki ki܆ \1==--7ki5 ki ( _g - 3 flux baubleski # #.####+####.#......#.#......#.$.#.#ki.†...#.######.).$..@....######.##.######....# ###..> ######....# #...#†# ..........# #.#.#.#.. #.....# #.#.#+# ...>.# #.# ###.#......# #.# #........### #.'...#kiki&8kiki$  Things that are here:ki9w _a +0 short sword; a kobold corpseki # #.####+####.#......##.#......##..$.#ki.#......†...##.######.)#....$.@)....######.###...######....# ###..># ######....# #...#†# ...# #.#.#.# #.....# #.#.#+# .>.# #.# ###.#......# #.# #.### #.'...#kiki-9 _kikizki|M X # #.####+### ####.#......# #.#......#kiN  #..$.# #......†...##.######.) #....$@.)....######.## #...######....# ###..> #. ######....# #...#†# .# #.#.#.# #.....# #.#.#+# .>.# #.# ###.#......# #.# #.### #.'...#kiV kiW '80ki\ ki_ kiHq X # #.####+### ####.#......# #.#......#kisr  #..$.# #......†...##.######.) #....@..)....######.## #...######....# ###..> #.. ######....# #...#†... .# #.#.#.### #.....# #.#.#+ .>.# #.# ###.#......# #.# #.### #ki1s #.'...#ki ==12.5 (2 _You now have 101 gold pieces (gained 17).kikiEkiki*kiJ,ki,kiUki6kikikikiK2===kiki,kikiS,kirkikikiikiki;===kicki,ki ki,ki]kikiqkiMkikikibkik3===kiki6kiki_kiki'ki ki},ki{ki ki8 ;===ki% ki,kikiki$kikiRkikikikiakiSkikiT4==kiki!ki!ki\"ki!%ki%ki;&ki;(ki(ki+)ki[+ki,:==ki,ki./ki/ki0kin3,ki4ki6ki7ki7ki9ki7:ki';ki=e5===ki9>kiU@,ki5AkiBki1CkiCkiEkiFkiFki6IkiI;===kiJkiMkiYNkiNki/QkiQkiwRkiTkiwUkiUVkiXki}Yki)Zki\ki;]O6===ki1^ki_ki`ki`kihakiakiMbkicki4dkidkiekie;===kifkihkitikiKjkil,kikmkinki\okiokir,kitki;7ki)==kiki,kikikiPki_kiCkiߍkiki kiS:==kikikiki˖kiGkicki}kiܞ,kikiݢkiki1kikiLM8===kizki~,kikikikiOki`,kikiki;===kikiظ,ki#kiRki kikikikikikiJki2kikikiki>n _You start resting.Magic restored.kiki22049.5 (67.0)kid9===50.5 (68 _kiki=ki kia ki ki ki ki kik nkiB ki ki ki ki5 kiL ki ;===ki ki\ ki ki ki N _You now have 119 gold pieces (gained 18).ki ki9 ki ki ki& ki ,ki ki kiN Bki Bki:   You encounter an adder and a frilled lizard.ki   #   ######...   #.###   ####.   #....#   #..........#  ki  #.#### #......†...#   #.....###..........####  #.....@................  #.....###.......)....##  #..... #...######....#  l...... #...######....#  ..... ...............#  #.....###########.....# S   adder (asleep)  #..... ..........>.# l   frilled lizard (asleep)  ##S... ###.#......#  kiU R #........#ki! 19.5 (9.0)ki" 760.5 (10.0) _ki& ki' ki]H  #..... #.#### #......† #.....###..... #.....@....... #.....###.......) #..... #...## l......  ##.....  #..... #..... > ##S...  ki #..... #.#### #......† #.....###..... #.....@....... #.....###.......) #..... #...## l......  ##.....  #..... #..... > ##S... ki 4kik kiq d _There are monsters nearby!ki #..... #.#### #......† #.....###..... #.....@....... #.....###.......) #..... #...## l......  ##.....  #..... #..... > ##S...  ki#..... #.#### #......† #.....###..... #.....@....... #.....###.......) #..... #...## l......  ##..... ki #..... #..... > ##S... ki4ki kid _There are monsters nearby!kih0  #   ######   #.   ####.#  . #.#  ≈≈ #..........#   #.##### #......†...#   #.....###...   #....@...... kiej #.....###.......)....   #.....# #...######....  ~l......# #...######....  #.....+.   #.....##.....   #...... .>.   ##S...# ###.#......   #.kiqkir#1kit.0) _kixkizki ###### #. #.......## #.#####.#. .~~ #...#  ≈≈. #ki.#  #.##### #......†...#  #.....###..........##  #..........  #...@.###.......)  #.....# #...######... ≈~l......# #...###### ###.....+..........  #.....###########  #...... ..........>  ##S...# ###.#....  #....# #.  #kiki&2kikiqki   Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki4kiki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki  #. #.......#  #.#≈.####.  .~~≈ #...#  ≈≈. #.#  #.##### #†...#  #.....###..........#ki F  #............  #.....###.......)  #..@..# #...######  #≈~l......# #...######  #~###.....+..........  #.....###########  #...... ......  ##S...## ###.#....  #....# #.  #....# #  #ki ki -3 _ki ki0 kii  #. #.......# ludeguy the Sneak #.#≈. ####.......# Octopode .~~≈ #..........# Health: 31/31 ======================== ≈≈. #..........# Magic: 7/9==================------ #.##### #......†...# AC: 1Str: 8 #.....###..........# EV: 12Int: 19 kij #................... SH: 0Dex: 12 #.....###.......)... XL:  5 Next:  1% Place: Dungeon:2 #..@..# #...######.. Noise: ---------  Time: 2063.5 (0.0) #≈~.......# #...######.. c) +0 dagger (protect) #~###.....+............. Cast: Poisonous Vapours #.....###########... #...... .......... ##S...## ###.#.... S   adder (asleep) #....# #...... l   frilled lizard (asleep) #....# #...... #......Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a frilled lizard (asleep, chance to weaken: 100%)  The glob of mercury hits the frilled lizard.  The frilled lizard looks weaker.[10;1ki/l 4Hkip U #.  #.#≈.  .~~≈  ≈≈.   kiq 2† #.. . ) #**@..#  #≈~.*  #~#    ##S...##  #....#  #....# ki (...ki 4==4.5 (1kiAkiv  Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a frilled lizard (asleep, chance to weaken: 100%)  The glob of mercury hits the frilled lizard.frilled lizard looks weaker. _You kill the frilled lizard!ki  Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiF4kiki] _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki  Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kir kis kix kiz }  Casting: Mercury Arrow (safe; 7% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) ki{ { Casting: Mercury Arrow (safe; 7% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki6  #.#≈.####.  .~~≈ #...  ≈≈. #.  #.##### #†...  #.....###..........  #.......... kiI7# #.....###)  ##≈~#.....# #...######  #≈~...@...# #...######  #~###.....+..........  #.....###########  #....... ......  ##S...### ###.#  #....# #.  #....# #  #....# #  #..)ki>ki?6--5 _kiEkiFkiH] .~~≈... ≈≈. #.#####†....###.#ki^0...#~###)##≈~ #...######≈~..#~###.@...+........... ###########...........#S...#### ###.# #....# #........).kiekifZ--6Poisonous VapourskikkiAmki q .~~≈ #.......... ludeguy the Sneak ≈≈. #.......... Octopode #.##### #......†... Health: 31/31 ======================== #.....###.......... Magic: 5/9=============----------- kiC# #.................. AC: 1Str: 8 #~ #.....###.......).. EV: 12Int: 19 ##≈~#.....# #...######. SH: 0Dex: 12 #≈~.......# #...######. XL:  5 Next:  1% Place: Dungeon:2 #~###.@...+............ Noise: ---------  Time: 2066.5 (0.0) #.....###########.. c) +0 dagger (protect) #.................. Cast: Poisonous Vapours ##†...#### ###.#... #....# #..... #....# #..... S   adder (asleep) kib#....# #..... ...... #..).. #.....Casting: Mercury Arrow (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an adder (asleep, chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker.ki .~~≈  ≈≈.  #.##### † #.....### # . #~ ki) ##  #   #.* #.*....... ###    #....#   #....#  ki; ...... #..)  ki..10==7.5 (1Poisonous Vapourskikionfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an adder (asleep, chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker. _You kill the adder! ki ki)3 ki ki ki_X ki, ki ki  ki  ki\  ki  kiuO6=== ki) ki kiq ki* ki, ki ki kia ki ki ki];=== ki  ki, kiA ki  ki! ki! ki2# ki# kiL$ ki', ki5( ki* ki+d7== ki!. ki. ki/ ki1 ki1 ki2 ki3 ki4 ki5 ki6 ki7:== ki_8 ki: ki>; ki; ki=, ki> ki}@ kiA kiA kiC kiWD kiD kiG kiGM8=== ki2H kiLJ kiJ kimK ki/M, ki?N kiP ki\Q kiQ kiS ki5T;=== kiT kiVV, kiEW kiY, kiY ki\, ki\ ki^ kiy_ ki` kib kibM9=== kic kiIf kig kih ki8i kij kim kim ki]n kiOo kir ki=s<Water  kis ki wA _You enter the shallow water. ki y kiy;=== kiz ki{ ki}SWater  ki;~ ki ki kiR, kiIWater  _You enter the shallow water.Water  kiԙ, ki, kiB ki8 ki ki, ki3 kij ki     #>......   #......#   #......# #  # kiP# #  #......# #  ###......#   ##..#   #..#@.....# #--112.5 (45.0) #.#≈.##########.... #.~~≈# # #.≈≈.# #...... #~≈#.##### #......† #~~#.....###.... #~.#............ kiΰ  #~.#.....###.......)  ##≈~#.....# #...###### ki2 ki2G--3.5 (46 ki+ ki; _Found a stone staircase leading down. kiL ki?3 ki ki kiX kiJ, ki6, ki ki ki ki ki_ ki ki ki  ki ki ki ki ki$ ludeguy the Sneak  kiOctopode ##.Health: 31/31 ======================== ..hMagic: 9/9======================== ###.#AC: 1Str: 8 ##....###EV: 12 kiInt: 19 #>.......SH: 0Dex: 12 #......#XL:  5 Next: 10% Place: Dungeon:2 #@.....# ki#. Noise: ---------  Time: 2117.5 (4.0) #......##. c) +0 dagger (protect) #......##. Cast: Poisonous Vapours ###......##. ##........# ######.  ki.#..#......# #...... h   Natasha (wandering) #.#≈.##########...... #.~~≈# #.........  kiD#.≈≈.# #.........The glob of mercury hits the adder! The adder looks weaker. _You kill the adder! _You enter the shallow water. _You enter the shallow water. _Found a stone staircase leading down.  ki&[You encounter Natasha, Servant of Life and Death. ki/  --more--!ki!ki!ki-1h.!kiF.h!ki!kiq; 8.5 (5 _!ki1!ki!kiZ ludeguy the Sneak Octopode ##.Health: 31/31 ========================!ki ...Magic: 7/9==================------ ###h#AC: 1Str: 8 ##..*.###EV: 12Int: 19 #>.*.....SH: 0Dex: 12 #.*....#XL:  5 Next: 10% Place: Dungeon:2 #@.....##. Noise: ---------  Time: 2118.5 (0.0) #......##. c) +0 dagger (protect) !ki#......##. Cast: Poisonous Vapours ###......##. ##........# ######. #..#......# #...... h   Natasha (weak) #.#≈.##########...... #.~~≈# #......... #.≈≈.# #.........Confirm with . or Enter, or press ? or * to list all spells.!kigAiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Natasha (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits Natasha! Natasha looks weaker.  Natasha is almost dead.!ki7 K.h!ki ,..!ki M==9.5 (1Poisonous Vapours!ki !ki7   Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: Natasha (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits Natasha! Natasha looks weaker.  Natasha is almost dead. _Natasha hisses angrily."ki5r  ludeguy the Sneak  Octopode ##.  Health: 31/31 ======================== ...  Magic: 5/9"kis=============----------- ###.#  AC: 1Str: 8 ##....###  EV: 12Int: 19 #>.......  SH: 0Dex: 12 #......#  XL:  5 Next: 10% Place: Dungeon:2 #@.....# #. Noise: ==-------  Time: 2119.5 (0.0) #......# #. c) +0 dagger (protect) #......# #. Cast: Poisonous Vapours ###......# #. ##........# ######. #..#......# #...... h   Natasha (weak) #.#≈.##########...... #.~~≈# #......... "kit#.≈≈.# #.........Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Natasha (almost dead, weak, chance to weaken: 100%)  The glob of mercury hits Natasha. Natasha looks even weaker.  You kill Natasha!"ki,y##. ... "kiyF ###.#  ###  #>.*.....  #.*....#  .#  .#  .#  .#  .#  #..#......# "kiz #.#≈.######  #.~~≈#     "ki*...."kip3320.5 (1Poisonous Vapours"ki "kiT   Aiming: Mercury Arrow (safe; 7% risk of failure)  Press: ? - help, Shift-Dir - straight line  "ki wAim: Natasha (almost dead, weak, chance to weaken: 100%)  The glob of mercury hits Natasha. Natasha looks even weaker.  You kill Natasha! _You feel Natasha's spirit has finally been put to rest."ki4"kiy"ki"ki\"kiX"ki"kim"ki"ki "kiy"ki"ki"ki"ki1"ki֘"ki}"ki"ki"ki"kiTO6==="ki"kiƠ"ki9"kiQ"kiŤ,"ki"ki"ki"ki`"ki"ki2;==="ki3"kiԭ"ki]"ki"ki"ki]"kiݱ"kif"ki"ki"kin"ki"ki"ki<"kiȹN7=="kiӺ"ki*%  "kiIYou encounter a frilled lizard."kiHl--."kiF....l   frilled lizard (wandering)"ki/366.0)"ki"ki"--"ki<,7.5 (17 _"ki"ki ] ##l  "ki ...  ###.#  ##....###  #>.......  #......#  #@.....#  #......#  #......#  ###......#  ##........#  #..#......#  #.#≈.###### #.~~≈#   "ki= 2##l ...  ###.#  ##....###  #>.......  #......#  #@.....#  #......#  #......#  ###......#  ##........#  #..#......#  #.#≈.###### #.~~≈#   "kiB "ki D "kiyG "kiI e _A frilled lizard is nearby!#ki]X ##l #kik_ ...  ###.#  ##....###  #>.......  #......#  #@.....#  #......#  #......#  ###......#  ##........#  #..#......#  #.#≈.###### #.~~≈#   #ki0##l ...  ###.#  ##....###  #>.......  #......#  #@.....#  #......#  #......#  ###......#  ##........# #kib #..#......#  #.#≈.###### #.~~≈#   #ki#kie _A frilled lizard is nearby!#ki # #  ###kiOL ##l#  ...# ##.# # ##....##### #>..# #.@....#  # #......# #. #......# #.  #......# #. ## #. ##........# ###### #..#......# #. #.#≈.########## #.~~≈# #.#ki.#ki"#ki0#ki#8#kif.0) _#kij#ki#ki  #. #.  #ki` #.  ##. ###.  ...#. ##.# #. ##....######. #>...# #......#### ## #......# #. #......# #.  #......# #. ## #. ##........# ###### #..#......# #.##ki Z #.#≈.############ki #ki, &9#kiP #kia #ki9  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.#ki #ki= #kiT #ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)#ki #.# #.# #.#  #kiA5#.#  ##.# ###.##.#  ...#.# ##.# #.# ##..@.##### #.. #>....# #......##### ### #......# #. #......# #.#ki  #......# #. ## #. ##........# ######.... #..#......# #.##ki0l#ki7"l   frilled lizard (wandering)#ki#K==40 _#ki'#ki)$kiԱy #.# ludeguy the Sneak #.# Octopode #.# Health: 31/31 ======================== #.# Magic: 5/9=============----------- # #.# AC: 1$ki1#Str: 8 ###†# #.# EV: 12Int: 19 ... #.# SH: 0Dex: 12 ####.# #.# XL:  5 Next: 33% Place: Dungeon:2 ##..@.##### #.. Noise: ---------  Time: 2140.5 (0.0) #>.......... ### c) +0 dagger (protect) #......##### ### Cast: Poisonous Vapours #......# #.... #......# #.... #......# #.... l   frilled lizard (wandering) ###......# #.... ##........# ######.... #..#......# #.......##Confirm with . or Enter, or press ? or * to list all spells.$kiJzAiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a frilled lizard (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the frilled lizard.  The frilled lizard looks weaker.$ki# $ki###†# .**  ####*#    ...  ###      #......#  ###......#  $ki] ##........#     $ki{>....$kiA&==$kiuB1.5 (1$kiJ  Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a frilled lizard (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the frilled lizard.frilled lizard looks weaker. _You kill the frilled lizard!$ki #.#. #.#. #.#. #.#.  #.#.  # #.#  ####†##.#.  #....##.#. ###@# #.## ##....##### #... #>.......... # #......##### #### #......# #. #......# #.  #......# #. ## #. ##........# ######.....$kiS$ki/--2$ki*$ki%ki.%ki1SGear: 4/52 gear slots (Left/Right to switch category) Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)b - a +0 dagger Jewellery (go to first with "=)  d - a +4 ring of slaying (worn) Talismans (go to first with %)%ki2+a - a riddle talisman%kiU= %ki,z %ki; %ki  #.#. ludeguy the Sneak  #.#. Octopode  #.#. Health: 31/31 ========================  #.#. Magic: 5/9=============-----------  #.#. AC: 1Str: 8  ##.# EV: 12Int: 19  ####†##.#. SH: 0Dex: 12  #....##.#. XL:  5 Next: 33% Place: Dungeon:2  ####@##.## Noise: ---------  Time: 2142.5 (0.0)  ##....######... c) +0 dagger (protect)  #>..........#### Cast: Poisonous Vapours  #......#########  #......#[13;2%ki 8H#.....  #......##.....   #......##.....   ###......##.....   ##........# ######..... Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a frilled lizard (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the frilled lizard.  The frilled lizard looks weaker. _You kill the frilled lizard!%ki %ki %ki* %kiȓ &kia&kikA6===&kimB&kiog===&ki5q&kiq,&kiRs&ki%t&kiu&kivB&kix&kiNy,&kiz&ki{d7==&ki}&ki~,&ki&ki_,&ki&kiQ,&kiև==&ki,&ki&kiLB&ki&kib,&kic8===&kiǑ&ki,&ki&ki,&kiS&ki[,&ki&kiÙQ===&ki&ki,&ki&ki,&kiޞ&kiB&ki &ki,&kis&ki@M9===&kis&kiJ,&kií&kia&ki&ki&kiȰ&kiR&kih&ki;===&ki&kii&ki&kiI,&ki &kid You see here a frilled lizard corpse.&kiX&kiG _&ki&ki &ki,&kiI&ki  There is an open door here. _&kia&ki &ki&ki&ki&ki,&ki&kiu,&ki!&ki@  There is an open door here.&kiGw _&ki&ki&ki&ki&ki&ki4&ki"&ki&ki+&ki&kix&ki&kiW&ki&ki&kiw&ki &ki&ki&kiD&ki&kix&kiZ&ki&ki6,&ki&ki&ki,&ki&ki],&ki&ki&ki&ki&kiH&ki &ki &ki &ki &ki&ki&kiI&ki&ki&kiS,&ki&ki&kiK&ki&kiZ&ki2&kih&ki&ki&kif&ki &ki!&ki"&ki#&ki$&kid%&ki%&kiH'&kim(&ki(&ki)&kis*&kip+&ki,&ki,&ki1&ki2&ki3&ki3&ki4&ki 6&kiz6&ki7&ki|8&ki9&kiR:&ki:&ki\;&ki<&ki<,&ki>@  There is an open door here.&kiB@&ki@ _&kiyA&ki0E&ki-F&kiF&kiG&kiXO&ki$P,&kiLWn&ki$Y@  There is an open door here.&kiZ&kiZ _&kiN[&ki[&kis\&ki\,&ki]&ki^&ki_,&ki_&kipbB&ki=c&kiyd,&ki%e&kiOg &ki4h1_You open the door.&kih&kii3&kirl@  There is an open door here.&kim&kin _&ki&o&kip&kiWq&ki%r,&kis&ki*u&kiu&kiPv&kiMx&kiby&kiy&ki},&ki~,&kiJ&kiǀ&ki&ki&kik&ki̎&ki?&ki,&kiY&kir,&ki<&ki&ki&kiP,&kih&kic&ki&ki&ki&kiu&ki&ki{&kiݰ&kiq&ki&kic&ki&kiӹ&ki,&ki&ki*&ki&kiF&ki&ki&ki,&ki&ki,&ki &kiV&ki,&ki|&ki&ki,&ki&ki&ki,&ki&ki&ki&ki ,&ki0&ki&ki&ki&ki'&ki}&ki-&ki&ki&ki&kio&kiO&kiR&ki,&ki&ki&ki&ki&ki',&kiNB&ki&kip&ki&kiJ&ki&ki4&ki&kiE&ki&ki&kix&ki&ki&ki&kis&ki&ki &ki&&ki&ki &ki&ki&ki&ki&ki&ki,&ki&ki&ki>&ki\&ki&ki6&ki,&ki.,&ki 0&kik4&ki7&ki7&ki&9&ki4<&ki;>&ki>&ki?&kiCC&kiD,&kiE&kiG&kiHI&kiI&kiJ&kiM&kiN&kiO&kiP&kiFUX&kiV&kiW,&kiX&kiY&kiy[,&kiS\&ki0]&ki^&ki^&kix_&ki a&kib&kic&kid&ki f&ki-gB&kih&kihB&kii&kik  You encounter a kobold. It is wielding a +2 short sword of venom.&ki`r...######....# #...#÷#.......... &kis.............# #.#.#.#..).####.. ########.....# #.#.#+#....# #.## ...........>.# #.#........# # ###.#......# #.#........# #  #........###.........## #....  #........'...#.......# #...  #........###.#.#####.# #...  #..)......##@#.##....# #....  #.........##.#..'....# #.  #.........##.####...## #....  #.........##.# #...# #.... &kit ......####.##.# #...# #...#  ###... .##.# ##### #...# K   kobold (asleep) #.#  ##### #K# &ki@y2264.5 (122.0)&ki3z353 _&ki&kib&ki3R #...#÷#. #.#.#.#..) #.#.#+#....# &ki>.# #.#........# #  #.#...  ##....  ..#  #.#  #..)#@#  #.#  #.#  #.# #...#  #.# #...#   .##.# #####  #.#  #K#&kiIyt #...#÷#. #.#.#.#..) #.#.#+#....# >.# #.#........#   #.#... &kiz  ##....  ..#  #.#  #..)#@#  #.#  #.#  #.# #...#  #.# #...#   .##.# #####  #.#  &ki|J#K# &ki;&ki &kif&ki] _A kobold is nearby!&ki@~ #...#÷#. #.#.#.#..) #.#.#+#....# >.# #.#........# #  #.#...&kiB  ##....  ..#  #.#  #..)#@#  #.#  #.#  #.# #...#  #.# #...#   .##.# #####  #.#  #K#&ki #...#÷#. #.#.#.#..) #.#.#+#....# >.# #.#........#   #.#...  ##....  ..#&ki  #.#  #..)#@#  #.#  #.#  #.# #...#  #.# #...#   .##.# #####  #.#  #K# &ki&ki&ki&ki] _A kobold is nearby!&ki #...#÷#. #.#.#.#..) #.#.#+#....# >.# #.#........# #  #.#...  ##....&kis  ..#  #.#  #..)#@#  #.#  #.#  #.# #...#  #.# #...#   .##.# #####  #.#  #K#&kiL o #...#÷#. #.#.#.#..) #.#.#+#....# >.# #.#........#   #.#...  ##....  ..#  #.#  #..)#@#  #.#  #.#  #.# #...#  #.# #...#   .##.# #####  #.#  #K#  _A kobold is nearby!'ki......#.#.#..).#### ########+#....# #.## ...........>..... # ###.#......# 'ki‘ #..##.........## #...'...#.. ###.#.#####)......##.#.##.....'###...# #...# ......########... ### #.# ####K#.'ki'kig86.0) _'ki3'ki'ki ########+#....# #.## ...........>.... # ###.#.....#  #..##..'ki ## #...'...# ###.#.#####)...........'###...# #...# ......########... ### #.# ####K ..'ki 'kiϑ &7'ki& 'ki 'kiva  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.'ki+ 4'ki90 'ki3 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)(ki@u  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.(ki<4(ki@(kiFC  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)(kiAZ...........>.... # ###.#.....#  #..##..## #...'...# (kiC)###.#.#####)...........'###...# #...# ......########... ### #.# ####K#..##(kiH(kiI-8 _(kiN(kiFP(ki~-...........>.# #.#........# #.#. ludeguy the Sneak # ###.#......# #.#........# ##.#. Octopode  #........###.........## #.... Health: 31/31 ========================  #........'...#.......# #.... Magic: 7/9==================------  #........###.#.#####.# #.... AC: 1Str: 8  #..)......##.#.##....# #.... EV: 12Int: 19  #.........##.#..'....# #.... SH: 0Dex: 12  #.........##.####...## #.... XL:  5 Next: 33% Place: Dungeon:2  #.........##@# #...# #.... Noise: ---------  Time: 2268.5 (0.0)  ......####.##.# #...# #...# c) +0 dagger (protect)  ###... .##.# ##### #...#[40(kiA/Vm Cast: Poisonous Vapours #.# ##### #)# #.# K   kobold (asleep) ..# ###Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a kobold, wielding a +2 short sword of venom (asleep, chance to weaken:  100%)  The glob of mercury hits the kobold! The kobold looks weaker.(kiI2<>.#    #.#  #..  ..#    #..)       #...#  *# #...#  (ki63 .##*# #####  #*#  #)# #.# ..# ### (ki0...(ki<4==9.5 (1(ki(ki  Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a kobold, wielding a +2 short sword of venom (asleep, chance to weaken:  100%)  The glob of mercury hits the kobold! The kobold looks weaker. _You kill the kobold!)kiQ # ###.#.....#  #..##..## #...'...# ###.#.#####)...........'###...# #...# ......########... ### #.# ####)kicS)ki#T0--70)ki+X)kiY)kiO\   #..##..## #...'...# ###.#.#####)...........'###...# #...# ......########... ### #.# ####) )kia )kiua A--1)kie )kif )kiAN '...# ###.#.#####)...........'###...# #...# ......########... ### #@# ####) .)ki )kiQ &2)kiu)ki *ki###.#.#####)...........'###...# #...# ......########... ### #.# #### ..### *ki3*ki&3*ki*ki$  Things that are here:*kiW  _a +2 short sword of venom; a kobold corpse*ki *ki *ki *ki *ki6 f _*ki B*ki *ki2 ,*ki *ki *ki' 78===*kiM *ki *kiD *kio *ki` *kiϚ ,*ki *kiV *ki *ki *ki Q===*ki *kij ,*ki *ki *ki *ki *kie *ki *ki *ki ,*kiҭ *ki® c9===*kiA *ki *ki *kiv *ki *ki *ki ,*ki *ki *ki ,*ki *ki *ki *ki ;===*ki *ki] *ki *kiO *ki۽ *ki *ki# *ki *ki% *ki *ki. *ki *ki *kiH *kih *ki *ki *ki *ki *ki *ki$ *kiO *kip *ki? *ki *kiX *ki *ki5 *ki *ki *ki *ki *kiK *ki *ki *kip *ki! *ki ,*ki *ki *ki *ki1 *ki ,*ki *ki *ki *ki` *ki *ki *ki *kiU *ki *ki *ki *ki *kie *ki *kiF *ki; *ki ,*kiW *ki2 *ki *ki *ki *ki *kih *ki *ki *ki *ki *ki? ,*ki_! *ki" *ki# *ki# *ki!' *kiT( ,*ki) *ki* *ki}, *ki, *ki- *ki0 *ki1 ,*kim3 *ki,5 *ki6 *ki97 *ki7 *ki9 *ki: *ki); *ki; *ki= *ki> *ki> *ki? *kicB *kiD f  You encounter a quokka.*kicK b #.........##.####...# ####.........### ........####.### *kiK .####...#....##.# ##### #......#.#####.#  #.##.#.#.# #)# *kiK  #.#..#.#.#####.# *kiK #....#.#.......# ######@#########*kiL g..r....######## *ki(L r   quokka (asleep)*kiS 1318.5 (45.0)*kimT 39.5 (46 _*kiY *ki[ *kiH  ####.........##.#  ..####.##.#  ..#....##.#  #......#.  #.##.#.#.# #)#  #.#..#.#.#####.#  #....#.#.......#  ######@#  ..r.....# #########*ki  ####.........##.#  ..####.##.#  ..#....##.#  #......#.  #.##.#.#.# #)#  #.#..#.#.#####.#  #....#.#.......#  ######@#  ..r.....# #########  *ki_ *ki *ki *ki\ ] _A quokka is nearby!*ki ####.........##.#  ..####.##.#  ..#....##.#  #......#.  #.##.#.#.# #)#  #.#..#.#.#####.#  #....#.#.......#  ######@#  ..r.....# #########*ki!<+kiV ####.........##.#  ..####.##.#  ..#....##.#  #......#.  #.##.#.#.# #)#  +kiuWA#.#..#.#.#####.#  #....#.#.......#  ######@#  ..r.....# #########  +ki^]4+kib+kid] _A quokka is nearby!+ki:  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.+ki4+kiů+kiv _You can't see any susceptible monsters within range! (Use Z to cast anyway.)+kie  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.+ki- 4+ki3 +ki5   Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.),ki?&####.##.# #... ........####.##.# #... .####...#....##.# ### #......#.#####.#  #.##.#.#.# #)# #.#..#.#.#####.# #....#.#.......#..######.#########...r...@.# ,kib######### b   bat (asleep),ki,kiv220.5 (1.0),ki,kionfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. ,ki?_You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You encounter a bat.,ki65 ####.........##.# #... ludeguy the Sneak,kic5 ........####.##.# #... Octopode ,ki5 .####...#....##.# #### Health: 31/31 ======================== #......#.#####.#  Magic: 7/9,ki5J==================------ ,ki5J#.##.#.#.# #)#  AC: 1Str: 8 #.#..#.#.#####.#  EV: 12,ki-6{Int: 19 #....#.#.......#  SH: 0Dex: 12 ..######.#########  XL:  5 Next: 34% Place: Dungeon:2 ...†...@.#,kih6Y Noise: ---------  Time: 2320.5 (0.0) b######### c) +0 dagger (protect) ,ki6d Cast: Poisonous Vapours,ki7  r   quokka (asleep),ki=7!  b   bat (asleep)Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line,ki`7Aim: a quokka (asleep, chance to weaken: 100%)  The glob of mercury hits the quokka. The quokka looks weaker.,ki&<    .# ,kil< .#  .#   #)#  ,ki<1    ,ki<..#  ...†***@.# ,ki<Ib## ,ki<% ,ki< ,ki...,ki<5==1.5 (1,ki=,kionfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a quokka (asleep, chance to weaken: 100%)  The glob of mercury hits the quokka. The quokka looks weaker. _You kill the quokka!,kiU  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.,ki 4,ki! ,ki# _You can't see any susceptible monsters within range! (Use Z to cast anyway.),ki' U ####.##.# # ..####.##.# # .####...#....##.#  #......#.#####.# #.##.#.#.# #)# #.#..#.#.#####.# #....#.#.#.######.##.†..@..#.b#,ki ,ki 6--2 _,ki ,kig -kihC ####.##.# # .####.##.# # .####...#....##.#  #......#.#####.# #.##.#.#.# #)# #.#..#.#.#####.#. #....#.#.#.######.##.†.@...#.b#-ki8---ki3-ki-ki -ki  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.-ki4-ki-kiY  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)-ki? _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.-kiEb4-kinh-kik  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)-kiB ####.##.# # .####.##.# # .####...#....##.#  #......#.#####.# #.##.#.#.# #)#. #.#..#.#.#####.#.. #....#.#.#.######.##.†@....#.b##-ki&-ki!'-4 _-ki/,-kii--kiO  ####.........##.# # ludeguy the Sneak -ki$P ........####.##.# # Octopode .####...#....##.# # Health: 31/31 ======================== -kiGP #......#.#####.#  Magic: 5/9=============----------- -kidP #.##.#.#.# #)#  AC: 1Str: 8-kiP  . #.#..#.#.#####.#  EV: 12Int: 19-kiP  ... #....#.#.......#  SH: 0Dex: 12-kiP  -kiP .....######.#########  XL:  5 Next: 35% Place: Dungeon:2 -kiP &......†@....#  Noise: ---------  Time: 2324.5 (0.0) -kiQ ...†#########  c) +0 dagger (protect) # Cast: Poisonous Vapours  b   bat (asleep)Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  -kiQ Press: ? - help, Shift-Dir - straight lineAim: a bat (asleep, chance to weaken: 100%)  -kiQ ?The glob of mercury hits the bat. The bat looks weaker.-ki(] J          #)#  .   ...   ...#  ....***@....#  ...#  # -kiQ X..†-ki 4==5.5 (1-ki -ki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a bat (asleep, chance to weaken: 100%)  The glob of mercury hits the bat. The bat looks weaker. _You kill the bat!-ki  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.-kiН-ki9-ki-kiإ _You can't see any susceptible monsters within range! (Use Z to cast anyway.).ki1.ki2.kiv2.ki3.ki7 _.ki7.ki 8.ki8.ki9O6===.ki9.kiB:.kip:.ki:.ki;.ki;.ki,<.ki<.ki=.kiq=.ki.>.ki>;===.ki?.ki?.ki?.kiP@.kiA.kiGA.kiA.kiwB.kiB.ki,C.kiC.kiD.kiwD.ki1E.kiEN7==.kiE.kiF,.kiFG.kiKH.kixH.kiH.kiI.kiI.kiIJ.kiJ.ki7K:==.kiK.kimL.kiL.kiL.kiM.kiM.ki@N.ki9O.kisO.kiO.kivP.kiP.kiQ.kiQ.ki9RM8===.kiR.kifS.kiS.kiT.kiT.kiT.ki]U.kiV.kiDV.kiV.kieW.kiW;===.ki'X.kiX.ki Y.kiY.ki:Z.kipZ.kiZ.ki[.ki[.ki\.ki\.ki].ki].kiQ^.ki^M9===.ki_.kia.kicf  You encounter an adder..ki/i ####.##.#  .####.##.# S .####...#....##.# .. #......#.#####.#... #.##.#.#.# #)#... #.#..#.#.#####.#.. #....#.#.#.######.##.@.....#--.†.kivi###S   adder (asleep).ki)o056.5 (31.0).ki|pN--7.5 (32 _.kiGu.kiws _You see here a quokka corpse..ki?     S   ..   ...  #)#  ....   .....   ......######.#  .......@.....#  ....†#########  ###.kiJ3.ki     S   ..   ...  #)#  ....   .....   ......######.#  .......@.....#  ....†#########  ###  .kib.ki.ki3.ki] _An adder is nearby!.ki      S   ..   ...  #)#  ....   .....   ......######.#  .......@.....#  ....†#########  ###.ki3 <     S   ..   ...  #)#  ....   .....   ......######.#  .......@.....#  ....†#########  .ki3 e###  .ki8 .kiJ8 .kiV; .ki= ] _An adder is nearby!.ki 3 _You encounter an adder. _You see here a quokka corpse. _An adder is nearby!An adder is nearby!  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells..kiO.ki4P.kizU.kiW _You can't see any susceptible monsters within range! (Use Z to cast anyway.)/kiO ####.##.#........####.##.#.S.....####...#....##.#.....#......#.#####.#....#.##.#.#.# #)#...#.#..#.#.#####.#..#....#.#.#.######.#/ki#†.....#.†###/kid/ki88.5 (1.0) _/ki/ki|/kizw ####.##.#........####.##.#/ki{|.S.....####...#....##.#.#......#.#####.#.#.##.#.#.# #)#.#.#..#.#.#####.#</kiM{.#....#.#.#.######.#/ki~{.†.....#.†#/ki{&##/ki/ki/ki9/ki/kiw; _Found an escape hatch in the ceiling./ki=  #.##.####.........##...............####.##.S.....####...#....##..#......#.#####.=.#.##.#.#.# #)..#.#..#.#.#####.<.#....#.#.......######.########....†.....#/ki > t.......†##################/kiA .SFound a peridot ring./kieI ES/kiBJ C===60/kiS /kiS / _The adder hisses angrily./ki~  #.##.# #.######.........##........####.##.......####...#....##....S.....#......#.#####=.#.##.#.#.# #..#.#..#.#.#####<.#....#.#......######.#######/ki ....†.....#........†###################/ki Q.S/ki 8.S/kiF /ki4 /ki ?1Poisonous Vapours/ki /ki /ki#.........## ludeguy the Sneak.........# #.........## Octopode.........####.........## Health: 31/31 ========================.................####.## Magic: 7/9==================------..........####...#....## AC: 1Str: 8..........#......#.##### EV: 12Int: 19/kiN.=........#.##.#.#.# # SH: 0Dex: 12......S...#.#..#.#.##### XL:  5 Next: 35% Place: Dungeon:2..<....@..#....#.#...... Noise: ---------  Time: 2361.5 (0.0)..........######.####### c) +0 dagger (protect)...........†.....#Cast: Poisonous Vapours........†#########/ki2P##########S   adder (weak)  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells./ki[4Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an adder (chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker.0ki. Press: ? - help, Shift-Dir - straight line  Aim: an adder (chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker.  The adder is severely wounded.  The adder bites you.  You are poisoned.0ki1!#00kib!====-==2.5 (1Pois 0ki(0ki *, _The adder poisons you!0ki^#.........## ludeguy the Sneak.........# #.........## Octopode.........####.........## Health: 30/31 =======================-.................####.## Magic: 6/90ki================--------..........####...#....## AC: 1Str: 8..........#......#.##### EV: 12Int: 190ki.=........#.##.#.#.# # SH: 0Dex: 12......S...#.#..#.#.##### XL:  5 Next: 35% Place: Dungeon:20ki..<....@..#....#.#...... Noise: ==-------  Time: 2362.5 (0.0)..........######.####### c) +0 dagger (protect)0kic...........†.....#Cast: Poisonous Vapours0ki........†#########Pois ##########S   adder (weak)  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.0kiAiming: Poisonous Vapours (safe; 7% risk of failure)  Press: ? - help, Dir - move targetAim: an adder (severely wounded, weak)  0kiHYou miscast Poisonous Vapours. Nothing appears to happen. You feel sick.0ki|28--Contam: 10% -0ki 3.5 (10ki0kionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 7% risk of failure)  Press: ? - help, Dir - move target  Aim: an adder (severely wounded, weak)  You miscast Poisonous Vapours. Nothing appears to happen. You feel sick. 0kiLK_The adder completely misses you.0ki]  #..# #..####.0ki6^ .......####..####...#.....#......#..=.#.##.#.#.# .S...#.#..#.#.0kiX^ '.<0ki^ u.#....#.#.######.0ki^ [37m.†.....#.†##########0kiEi  You feel sick. The adder bites you.  You are more poisoned.0kij 5=====-----40kiOq 0kis T _The adder poisons you! The adder bites you but does no damage.1ki8#.........# ludeguy the Sneak..........# #.........# Octopode..........####.........# Health: 25/31 ===================-----..................####.# Magic: 5/9=============-----------...........####...#....# AC: 1Str: 8...........#......#.#### EV: 12Int: 19 Contam: 10% ..=........#.##.#.#.#SH: 0Dex: 121kiO9.......S...#.#..#.#.#### XL:  5 Next: 35% Place: Dungeon:2...<...@...#....#.#..... Noise: =--------  Time: 2364.5 (0.0)...........######.###### c) +0 dagger (protect)............†.....#Cast: Poisonous Vapours.........†#########Pois ###########1ki9S   adder (weak)  Casting: Poisonous Vapours (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 7% risk of failure)  Press: ? - help, Dir - move targetAim: an adder (severely wounded, weak)  You miscast Poisonous Vapours. Nothing appears to happen. You feel sick.1ki:%31ki:e====--25.5 (11ki`B1kiB!1kiBMConfirm with . or Enter, or press ? or * to list all spells.1ki CAiming: Poisonous Vapours (safe; 7% risk of failure)  Press: ? - help, Dir - move target1ki'CpAim: an adder (severely wounded, weak)  1kiECmYou miscast Poisonous Vapours. Nothing appears to happen. You feel sick. _The adder bites you.1kip{ #.........# ludeguy the Sneak ..........# #.........# Octopode ..........####.........# Health: 23/31 =================------- ..................####.# Magic: 4/9==========-------------- ...........####...#....# AC: 1Str: 8 ...........#......#.#### EV: 12Int: 19 Contam: 20% 1ki{h ..=........#.##.#.#.#  SH: 0Dex: 12 ...........#.#..#.#.#### XL:  5 Next: 35% Place: Dungeon:2 ...<...@...#....#.#..... Noise: =--------  Time: 2365.5 (0.0) ...........######.###### c) +0 dagger (protect) 1ki4|............†.....#  Cast: Poisonous Vapours .........†#########  Pois  ###########   S   adder (weak)1kiT|1kix|XConfirm with . or Enter, or press ? or * to list all spells.1ki|Aiming: Poisonous Vapours (safe; 7% risk of failure)  Press: ? - help, Dir - move target1ki|mAim: an adder (severely wounded, weak)  1ki|[Poisonous fumes billow around the adder!  The adder is poisoned. You feel sick.1ki ..........#  ..........### ............ ...........# ....1kiE# ..=.#  ....#1kii6 ...<#1kiQ ....# 1kiq.....†.....# 1ki1M ....######### 1kiYI ########### 1ki|1kit 21-446.5 (11kiwPoisonous Vapours _You kill the adder!1ki1ki\h _Your Dodging skill increases to level 3!2kiЕM-2ki0-19---8=-5===2ki _You start resting. You feel sick. x52kig7=--2ki,70.5 (42kiWO-1.5 (52ki+2kiƼ[ _You are no longer poisoned.2ki12ki2kiɤ2ki2ki=8182ki+862kiC2kiR2kiU===42ki2kiN2ki722ki+2ki2ki@702ki2ki 2kiY#92kiD=8% 2ki2kiҽ2ki762kif2kib2ki%62ki2===42ki72ki2ki722ki2ki2ki22kiST20==12kiq2ki2kiW _You start resting.2ki2ki082.5 (11.0)2ki:(2ki2kiK _Your magical contamination has completely faded away.2ki   #.  .# #.  .####.  .......####.  .####...#....  .#......#.  .=.#.##.#.#.#  ?.#.#..#.#.  .<.#....#.#  .######.  .†.....#  .†#####  # 2ki2 =    2ki 2ki{ O===3.5 (1.0)2ki 2ki V _Found a scroll of vulnerability.3ki)33ki3ki63kii1==3ki3ki,3ki3ki3kid3ki3kid7==3ki83ki#!3ki`!^2==3ki#3ki$,3kiB&3ki((,3ki)3kiU+3ki+:==3ki,3ki.3ki2/X23=3ki13ki2,3ki33ki43ki53ki53ki63ki63kiD83ki93ki':54=3kiH:F8===3ki<3ki =3kiH=3ki>3kiC?3ki?3kiQ@3kiA,3kiB3kiUC3ki}Cn5=====3kiC3kiD3kiF,3kiG3kiQ,3kiS3ki+U3kiUU3kiV3kiY3kiAZh6==3ki[3ki`n _You start resting.Magic restored.3kih3kiyn1405.5 (22.0)3kinoZ9===6.5 (23 3kio _3kiu3kiz3kiL  #  #.# #  #.####  #......####  #.####...#  #.#......#.  #...=.#.##.#.#.#  #?.#.#..#.#.  #....<.#....#.#  #.######.  #.†.....#  #.†######  #    3kiMG7.5 (1.0)3ki U3kioV3ki&  #  #.# #  #.####3ki  #.  #.####...#  #.#......#.3ki  #...=.#.##.#.#.#  #?.#.#..#.#. 3kiB #....<.#....#.#  #3kixi.######.  #3ki.†.....#  #.†3kiJ#   #3kiP=    3ki'3ki(&83ki03ki23ki   #  #.# #  #.####  #.  #.####...#  #.#......#.  #...=.#.##.#.#.  #?.#.#..#.#.  #.....#....#.#  #.######.  #.†.....#  #.†#   #    7=93ki@ y _There is an escape hatch in the ceiling here.3ki 4M......) ####.............#####........=#?#<....#.#.######.##  #.............†.....#3ki 3ki# L===10 _3ki 3ki 4kiM  #....# #..  #. #..)  #.# #  #.# #  #####.....  #........#  #.####...#  #....#......#  #.#.##.#.#  #?....#.#..#.# 4ki #....<.#....#.  #######.#  #....†.....#  #..........†######### #############  4ki4kiB&14kiq4kiDA2.5 (24kiJ4ki 1 _e - a ring of see invisible5ki z  #....# # 5ki C #. #..)  #.# #  #.# # 5ki!m #.####  #5ki4!@.  #5kiV!G.####...  #5kix!G.#......  #5ki!T.#.##.#.  #?5ki!.#.#..#. 5ki!k #....<.#....#. 5ki"I #.######. 5ki)"r #.†.....5kiK"Q  #.†5kim"/  5ki#8##  5ki*5ki+Y8=3.5 (15ki35kiO55kiI:  #....# #  #. #..)  #.# #  #.# #  #.####  #  #.####  #.#  #.#.##.#  #?.#.#..#  #....<.#....#  #.######  #.†  #.†  ###  5ki|R<45kiW5ki=Y5ki  #........... #  #.# #..  #.# #  #.####  #....  #####  #.#..  #.#.##  #.#.#..  #....<.#....  #.....####  #..†...  #†######  #############   5ki5ki&55kiS5kiA6.5 (25ki5ki_ _V - 2 scrolls of vulnerability (gained 1)6ki(Put on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)e - a ring of see invisible Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|put on[tab] equip|unequip 6kiz 6ki" 6kio < 6ki֝ B#........... #.. ludeguy the Sneak #...........# #.. Octopode #...........# #.. Health: 28/31 =====================--- 6ki #...........####.. Magic: 9/96ki N======================== 6ki; #................. AC: 1Str: 86ki\  6ki} #............####. EV: 12Int: 19 6ki #............#.... SH: 06ki 3Dex: 12 #............#.##. XL:  5 Next: 44% Place: Dungeon:2 6kiI #@...........#.#.. Noise: ---------  Time: 2416.5 (0.0) #....<.......#.... c) +0 dagger (protect)6kiv  #............##### Cast: Poisonous Vapours6ki } #.............†...6kiß  6ki o#..........†###### 6ki :#############6ki& g _Found a scroll of vulnerability. 6kiF O_You start resting. _Magic restored. 6kii V_There is an escape hatch in the ceiling here. _e - a ring of see invisible 6ki J_V - 2 scrolls of vulnerability (gained 1)6kiJ q9=7.0 (0.56ki 6ki  6ki *_e - a ring of see invisible (worn)7ki=7ki7ki_7ki(n7ki7ki ,7ki7ki(7kiȲi30==7ki7ki7kiP7ki7ki 7kiC7ki7ki,7ki7ki}7kih1==7kiϼ7ki1 _HP restored.7ki7ki.7ki7ki7ki,7ki7ki =7ki{7ki{7ki7ki7ki7ki7ki=,7kiI7ki7kiM,7kiw7ki7ki7ki/7kiI7kiW7ki7ki7ki7ki7ki7ki7ki7ki$7kiQ7ki7ki67ki7ki7ki7ki 7ki7ki7ki7ki7kiE7ki,7ki7ki7ki`,7kiX7ki%  #.≈≈.# #... #~≈#.##### #......†... #~~#.....###..........### #~.#................... #~.#.....###.......)....# ##≈~#.....# #...######... #≈~.......###...##### #~###.....'.... #≈# #....@###########...40.0 (23.7ki&&0) ### #............> ##÷...########.#...... #....# #..... #....# #........ ####....##### #........7kiM&  #...........# #..)..... 7kir&@ #...........# #........  #...........# #........7ki&-  7ki&1_You open the door.7ki'7ki-7ki/E _Done exploring.7kiT7kiU7ki1V7kit0.0)........ _Done exploring.7ki7ki7kis7ki 7kip7kil7kiE _Done exploring.7kiPP  Casting: Poisonous Vapours (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.7ki 7ki6 7ki. 7ki%' _You can't see any susceptible monsters within range! (Use Z to cast anyway.)8kiI8kiJ8kiE _Done exploring.9kiD+ ~≈#.#####†~#.....##....###.......~###)....###≈~ #...######....≈~..##...#~###.....'...........≈# ############..............> ##÷...########.#..... #....# #..........  #...........####........ 9kiL9ki}M21.0 (1 _9ki\W9kiX:ki4 :ki5 :ki< :ki!= ;ki 3;ki#!;ki2-;ki1;ki5X;kij7;ki8;ki8;ki:;ki=;ki>,;ki?;ki)A;kixB,;kiqC;kiE;kiF;kiG;ki H;kiJ;kiK,;kiM;kidO;kiP;kiQ;kioR;ki9T;kiV,;kiW;ki^≈#.##### #......†...#.......... ~#.....###..........######....... .#................) .#.....###.......)....######.##.. ;kix_n~#.....# #...######....# ###..> .......###...######....# #...#÷# ##.....'...............# #.#.#.#  #.....###########.....# #.#.#+#  #..............@....>.# #.#....50.0)  ##÷...########.#......# #.#  #....# #........### ;ki_G #....# #........'...# ###....##### #........###.#.#### ...........# #..)......##.#.## ...........# #.........##.#..' ;ki_...........# #.........##.#### ...........####...##.# #;kib`;ki l......########65.0 (14 ######....# #...#÷#......... =ki'w..........# #.#.#.#..).#### =kiEw#####.....# #.#.#+#....# #.##### ........>.# #.#........# #.#...< ##.#=kicw# #.#........# ##.#.##  #=kiw###.........## #....##  #=kiw'...#.......# #....##  ####.#.#####.# #....##=kix=kiJ=ki>ki ####+###.##......#..........#......#..........##............#...[# ÷...#................#######.........#...).......>kiD1#)....######.##......##.#....# ###..@......#.#>ki=....# #...#÷#....# #.#.#.#..).####......#.....# #.#.#+#....# #.#>ki....>.# #.#........# #.#...<. #.#......# #.#..# ##.#.##. #.###.........## #....##. #.'...#.......# #....##. >ki[#.###.#.#####.# #....##.>ki G6.0)>ki>kic _There is a stone staircase leading down here.>kif >ki >ki >ki$ >ki=) -7 _>ki, >ki &3>ki[  ..# .. ..##  >ki #... #..# ..# #.#>ki N #@# >ki #.# #.#>ki  >kiE f..# .## >kij .. ..>ki 1 #.. >ki >kiy -8.5 (2.5>ki >ki_ # _You climb downwards.>ki/ a _There is a stone staircase leading up here.?ki?kiRead which item? Scrolls  V - 2 scrolls of vulnerability ?ki)$ c - a scroll labelled GUUNGAOXEF  e - a scroll labelled TACSIO LOMUTI  h - a scroll labelled GETAEGREE VIBE [!] read|quaff|evoke?kiUG[?] describe selected@ki@ki%@ki^|ludeguy the Sneak..#Octopode..Health: 31/31 ========================..##Magic: 9/9========================#...AC: 1Str: 8#..#EV: 12Int: 19..#SH: 0Dex: 12#.#XL:  5 Next: 44% Place: Dungeon:3#@#Noise: ---------  Time: 2468.5 (0.0)#.#c) +0 dagger (protect)#.#Cast: Poisonous Vapours..#@kiQ.##....#.. _Done exploring.  Things that are here: _a +0 club; a goblin skeleton _There is a stone staircase leading down here. _You climb downwards. _There is a stone staircase leading up here.  As you read the scroll labelled GUUNGAOXEF, it crumbles to dust.  It is a scroll of enchant armour.  --more--Akiϳ  You aren't carrying any armour which can be enchanted further.Aki29.5 (1 _AkiոAki AkiC _AkiG AkiJ BAki N AkiCN AkiN AkiO AkiS Aki[S AkiS AkiTU AkiX AkiY AkiWY AkiZ AkiT^ Aki^ Aki^ Aki` Aki[c ,Akic Akile Akig Aki h Akih Akii Akiym Akim Akin Akio Aki4r i  You encounter a dart slug.Akiw  ##### ##...## #......#######.. ..######....w..# #.....##@###..##.......##.##.##.#Poisonous Vapours#. #.##<##. #.##.##. #..#.#w   dart slug (wandering).....# #. ....#### ##..Akiy T.w77.5 (8Aki' Aki 28.5 (9 _Aki Aki Aki! #####  ##...##  #......  #######..   #.....w.#   ##@###..#  #.......#  #.##.##.#  #. #.##<#  #. #.##.#  #.   .. Akif  #.   ## ##.. Bkiq: #####  ##...##  #...... Bki5r #######..   #.....w.#  BkiPrm ##@###..#  Bkir#.......#  #.##.##.# Bkirn #. #.##<Bkir& Bkire#. #.# Bkir(#. Bkis  Bki7s..  BkiQs3#. Bkiks- ## Bkis BkixBki~yBki~Bki` _A dart slug is nearby!Bkit #####  ##...##  Bki^u#......  #######..   #.....w.#   BkiO##@###..#  #.......# Bki% #.##.##.#  Bki~#. #.##<#  #. #.##.#  #.   ..   Bki79#.   ## ##.. BkiWBkiQ #####  ##...##  #......  #######..   #.....w.#   ##@###..#  #.......#  Bkiւ#.##.##.#  #. #.##< #. #.# #.   ..  Bkij#.  ## BkiƇ4Bki\v _A dart slug is nearby!Bkiww   _A dart slug is nearby! _A dart slug is nearby!  You hit the dart slug.  Your weapon exudes an aura of protection.  You grab the dart slug.  The dart slug is lightly wounded.BkizZ 8 =9.5 (1BkiBki2 _You constrict the dart slug.Bkiu f .  You hit the dart slug. You squeeze the dart slug.Bki5 (Bki j680Poisonous VapoursBki Bki M _You kill the dart slug!CkiWCkiCkivCkiAH _No target in view!Cki 4Cki)^ _No target in view!CkirCkiCkinCkicCki Cki: _CkiCkiCkiCkiCki3CkiCkiCkiCkiCkiL Cki 0 1 Cki- Cki CkiCki+CkiCkiCki,CkiCkiCki6CkilCkiCkikCki|,Cki1,CkizCkiCkis Cki!Cki?$Ckie$Cki%CkiH&Cki),Cki1*Cki|,Cki\/Cki/Cki0Cki1Cki4Cki5Cki5Cki6Cki!;CkiU;Cki;Ckia=Cki?,Cki_@CkiACkiDCkiEDCkiDCkiFCkiXJ,CkiKCki^LCkiNCkiOCkiOCkiyRCkiUCki'VCkiVCkiWCki5[,Cki[Cki\Cki_BCkiaCkieBCkij#.##.##.##.####.##..#.##............#######......## Ckij#####..#######....... #..########.#  #...........# Ckikl#....@##### -#....#.# #...###.# CkijkU#..## #..#.#. #..#.. . ....Ckik.... ..###. .# CkiHr1502.5 (22.0)CkirF-3.5 (23CkiwCkiry4 _a - a scroll of enchant armourCkiCkiCki Cki]Cki CkiBCkiĸCki%CkiCkigCki f  You encounter a quokka.Cki<#####......##  #####..######## #.......... #..########.# #...........# #.....#####.####....#.##.....# #...###.#....!#.#..## ##@.......#.#. #.#.....#.Cki #.. . ..r .......Poisonous Vapours.... ..... ...######....#.#. ##.#.. .... .# r   quokka (asleep)# .# #. # #. ..Ckih15.0)Cki+6.5 (3CkiCkiV _Found a golden potion.Ckiʻ    #. #..###  #...........#  #.....#####.###  #....#.##.....#  #.#....!#.  #..## ##@.......  #.#. #.#.....#.  #.. . ..r .......  .... ..... ...####  ##....#.#. ##.#  Cki/ }.. .... .#  # .# #. #  #. ..CkiQ    #. #..###  #...........#  #.....#####.###  #....#.##.....#  #.#....!#.  #..## ##@.......  #.#. #.#.....#.  #.. . ..r .......  CkiR 8.... ..... ...#### ##....#.#. ##.# .. .... .#  # .# #. # #. .. CkiX Cki_Y Cki_ CkiYb ] _A quokka is nearby!Ckit  #####..######## #.......... #..########.# #...........# #.....#####.### #....#.##.....# #...###.#....!#. #..## ##........ #.#. #@#.....#...<....r........Ckiyu ..............#### ##....#.#.###.# #.. ..... .### .#.#.# # #.. ..# # # ###CkiH 8<Cki +7.5 (1Cki Cki} 9 _Found a stone staircase leading up.Dki †The helpless quokka fails to defend itself.  You puncture the quokka!  Your weapon exudes an aura of protection.Dki )Dki#  8 88Poisonous VapoursDkiw Dki J _You kill the quokka!Eki{4EkiEkiH _No target in view!Ekir44Eki57EkiDH _No target in view!Ekij3EkikEki9mEki7pEkis: _Eki\uEkiwEkixEkiAyEkizEki\ 1 Eki_EkiEki'Eki;EkiEkiĈEkiEkiEki EkiWEkiEkibEki,.......#  ......##  ####..##########  #...........#  #..########.#  #...........#  #.....#####.###  #....#.##.....#  #...###.#....@#.  #..## ##........#  #.#. #.#.....#.#  #..<....†........#  EkiV..............#####  ##....#.#.###.#   #.. ..... ..#   ## .#.#.#####   #.. ..#  Eki,14.5 (6Eki(+5.5 (7EkiEki٣S _k - a golden potionEkiv3EkiwEkixEki{Eki~BEki~Eki/,Eki9Eki,EkiVEkiEkiˊEkiEkivEkiٌEkidEkiEkibEkiEkiҔ,EkiEkiÖEkiEkiʘEkiWEkiEkiEkiHEkiEkivEki,EkiMEkiEkiإEki+EkiڦEkiӧEki̩,EkixEki~Eki_EkiEkiEki<XEkiEkiUEkiEkiEkipEkiU,EkiҼEkiEkiD,EkiEkiEki,EkiEkiEkiZ,EkiEkivEkiuEkiEkiEkixEki,Eki!Eki1EkiEki8EkiEki`Eki,Eki[Eki[EkiEkiEkiEkiEkiR,EkiEkiEkiEkiOEkiEkiEkiEkiKEkiEkiEkiEki&EkiZEkiEkiEkiFEkitEki<EkiiEkiEkiEkiEki ,EkiEkiEki~EkiEkiEkiEkiEkiKEkixEkiEki4BEkiEki ,EkiEkiXEkiEki Eki Eki EkiV Eki Eki EkiEkidEkiEkiEkiEki  ### # # ###  # ...####### #. #.##...... #####.# #.########.##### .[.....###.........#  #@#.########## 52.5 (37.0) ##.##  ###  Eki Eki,!,3.5 (38EkiD%Eki (M _Found a leather armour.Eki3 Eki3 Eki4 Eki5 Eki@8 Eki: BEki< Eki< EkiQ= Eki> EkiaA EkiA EkiIB EkiC EkiE Eki9E EkinE EkihF EkiG ,EkifH Eki5I Eki)K EkiMK EkiK EkiL EkiN ,EkiN EkiO EkiS ,EkiES EkiT Eki#V EkiOV EkiV EkiIX Eki$[ Ekie[ Eki[ Eki\ Eki|^ ,Eki^ Eki_ Eki-b ,Ekib Ekip f  You see here a +0 leather armour.Ekint Ekit  _Ekiu Ekiv Ekiz ,EkiO Eki Eki EkiE Eki Eki֌ Ekil XEki EkiG Eki Ekiz Eki ,Eki$ Eki՘ Ekiy Ekiɛ Eki Eki EkiŸ ,EkiO Eki Eki Eki Eki Eki Ekiz XEki n  You encounter a frilled lizard.Eki[ ... #.#  #.# #.# ####.#   ....#######  #....l....  .# #######.# #....#Poisonous Vapours#.##.##.###.#########.#.#.###......[.....###.. l   frilled lizard (asleep)#############.#.####.#####Ekig -75.5 (22Eki *6.5 (23 Eki _Ekij Eki EkikE #. ... #.# #.#  #.# #.####.# #......#########..@.l.....##.######## #.# ###### #.# #....##.# #.##.EkiE ###.#########.#.#.####......[.....###...#############.#.#####.EkiM EkiN 07.5 (1.0) EkiR EkiT FkiG%Fki(C  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   0.0   1.0   0   f + Spellcasting 2.8   3.6  -1      Fki)o     b - Unarmed Combat   0.0   1.0   0   g + Conjurations 2.3   3.0   0      h + AlchemyFki4)4.1   4.2  +1  FkiW) c - Short Blades   0.0   1.0   0   i - Air Magic   0.0   1.0   0      Fkiy){    d + DodgingFki)3.0   4.0   0   j - Shapeshifting   0.0   1.2  -1  e + StealthFki)4.2   2.5  +4      Fki*                Fki4*            Fkia*        Fki*!            Fki*3                        Fki3+KThe relative cost of raising each skill is in cyan.  The species aptitude is in white.  [?] Help[=] set a skill target  Fkip+[/] auto|manual mode [*] useful|all skills [!] training|cost|targetsFkiFkiFki9Fki8vludeguy the Sneak#.Octopode...Health: 31/31 ========================#.#Magic: 9/9========================#.#AC: 1Str: 8#.#EV: 12Int: 19#.####.#SH: 0Dex: 12#......########XL:  5 Next: 48% Place: Dungeon:3Fki#..@.l.....Noise: ---------  Time: 2577.5 (0.0)##.########c) +0 dagger (protect)#.#######Cast: Poisonous Vapours#.##....##.##.##.###.#########.#.#.### l   frilled lizard (asleep)#......[.....###...#############.#.###Fki?##.## _No target in view! _No target in view! _k - a golden potion Fki{_Found a leather armour. _You see here a +0 leather armour. _You encounter a frilled lizard.Fki~FkiFkiFkiGkiLu3#. ... #.# #.# #.# #.####.# #......##...@l.##.##.# ###### #.#.#.#.#.#.##......[.....###.###.#.# Gki|Gki,}+8.5 (1GkiGkiGkiq †The helpless frilled lizard fails to defend itself.  You puncture the frilled lizard!  Your weapon exudes an aura of protection.Gkix(Gki9{ 8 9Poisonous VapoursGkiGkiR _You kill the frilled lizard!Gki4z#. ... #.# #.# #.# #.####.# #......##....@.Gkiz%##.##.# ###### #.#.#.#.##......[.....###.#.#.# Gki=80GkiGkiNj{ _You see here a frilled lizard corpse.Gki*GkiGkiGkiGki Gki7 c 1 _GkiGkiGkiGkicGki*"JGki4#Gki%f  You encounter an adder.GkiE* ### ..# #.# #..####.####### #.........S.... #@#  #.#  #.# Poisonous Vapours#.####.##......###############....†....... S   adder (asleep) ##.########## #.# #######.# #....#Gki!0+6.5 (6Gki0Gki1$7.5 (7Gki=5Gki7; _Found a parchment of Kinetic Grapnel.Hki ### ..# #.# #..####.####### Hkij #.........S....  #@# #.# #.# #.####.# #......# Hki$ #####....† Hki$ ##.#  HkiL#.#   #.#  Hki[ ### ..# #.# #..####.#######  #.........S....  #@# #.# #.# #.####.# #......# #####....†  ##.# #.#  #.# HkiaHkisbHkigHkij] _An adder is nearby!Hki#### ..#  #.# #..####.#########.......@.S.....#.####.#########.#  #.##.######......########## #####....†.......##.#####.# ######HkiHki:28.5 (1 _HkiHkiPIkij#### ..# #.# #..####.##.S.#.####.##.# #.##.####.Ikik##......# #####..##. Iki-sIkis&9IkixIkizIki>:The helpless adder fails to defend itself.  You puncture the adder!  Your weapon exudes an aura of protection.  You grab the adder.  The adder is almost dead.  You constrict the adder.Ikih(Iki 8 5790Poisonous VapoursIki^IkiI _You kill the adder!Iki5#### ..# #.# #..####.##..#.####.##.# IkiIki&1IkiIkib  You pick up a parchment of Kinetic Grapnel and begin reading...  You add the spell Kinetic Grapnel to your library.2.5 (2Iki S _You see here an adder corpse.JkiJkiJkiJkiJkiJki\ 1 Jki,JkirJkiWJki(,JkiJki}Jki BJki Jki ,JkiX JkiEJki,JkiJki6Jki@JkiJkiJkiJkiz,JkiJkiJki!# #.#. #..##. ... #<. #.. #####..  ....# 600.5 (8 #####..####.#  #..####.########## #.........†....... ##.####.########## #. #.# #$ #.# #.####.#Jki) #......#Jki(*Jki`, ###Jki,Jki6Jki9Jkic9$1.5 (9JkiyAJkiD9 _Found a stone staircase leading up.JkiD Jki F  Spells (Memorise)TypeFailure Level JkirF ; a - Kinetic GrapnelForgecraft16% 1b - Mephitic CloudConjuration/Alchemy/Air 19% 3  c - Olgreb's Toxic RadianceAlchemy28% 4  JkiF d - Sigil of BindingHexes43% 3  e - Sticky FlameFire/AlchemyJkiF 054% 4 JkiF -6 spell levels left Jki G ^[!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitNki*&NkiG,Nki3ludeguy the Sneak# #.Octopode#. #.Health: 31/31 ========================.##.Magic: 9/9========================...AC: 1Str: 8#<.EV: 12Int: 19#..SH: 0Dex: 12#####..######XL:  5 Next: 57% Place: Dungeon:3.......@....#Noise: ---------  Time: 2601.5 (0.0)#####..####.#c) +0 dagger (protect)#..####.##########Cast: Poisonous Vapours#.........†.......##.####.###########. #.#Nki4#$ #.##.####.##......##########You constrict the adder. _You kill the adder!You pick up a parchment of Kinetic Grapnel and begin reading...  You add the spell Kinetic Grapnel to your library. _You see here an adder corpse. _Found a stone staircase leading up.Nki=Nki>Memorise Mephitic Cloud, consuming 3 spell levels and leaving 3? Y - Yes Nki?' N - NoNkiNkiludeguy the Sneak# #.Octopode#. #.Health: 31/31 ========================.##.Magic: 9/9========================...AC: 1Str: 8#<.EV: 12Int: 19#..SH: 0Dex: 12#####..######XL:  5 Next: 57% Place: Dungeon:3.......@....#Noise: ---------  Time: 2601.5 (0.0)#####..####.#c) +0 dagger (protect)Nki!K#..####.##########Cast: Poisonous Vapours#.........†.......##.####.###########. #.##$ #.##.####.##......##########You constrict the adder. Nki!_You kill the adder!You pick up a parchment of Kinetic Grapnel and begin reading...  You add the spell Kinetic Grapnel to your library. _You see here an adder corpse. _Found a stone staircase leading up.Nkij+2.5 (1NkiNki3 _This spell is quite dangerous to cast!3.5 (2NkiNki<Nki+4.5 (3NkiINkixA5.5 (4Nki Nki8 _You start memorising the spell. You continue memorising. x3Nki4 _You finish memorising. Spell assigned to 'c'.Oki Oki   Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   0.0   1.0   0   f + Spellcasting 2.9   3.6  -1           b - Unarmed Combat   0.0   1.0   0   g + Conjurations 2.3   3.0   0      h + Alchemy4.1   4.2  +1   c - Short Blades   0.0   1.0   0   i - Air Magic   0.0   1.0   0  ki 7;22H        d + Dodging3.0   4.0   0   j - Shapeshifting   0.0   1.2  -1  e + Stealth4.3   2.5  +4                                                      ki, _m                        The relative cost of raising each skill is in cyan.  The species aptitude is in white.  [?] Help[=] set a skill target  [/] auto|manual mode [*] useful|all skills [!] training|cost|targetsQkiS> i + Air Magic 0.0Qki9QkiQki; ludeguy the Sneak# #.Octopode#. #.Health: 31/31 ========================.##.Magic: 9/9========================...AC: 1Str: 8#<.EV: 12Int: 19#..SH: 0Qkin  Dex: 12#####..######XL:  5 Next: 57% Place: Dungeon:3.......@....#Noise: ---------  Time: 2605.5 (0.0)#####..####.#c) +0 dagger (protect)#..####.##########Cast: Poisonous Vapours#.........†.......##.####.###########. #.##$ #.##.####.##......##########You add the spell Kinetic Grapnel to your library. _You see here an adder corpse. _Found a stone staircase leading up. _This spell is quite dangerous to cast! _You start memorising the spell. You continue memorising. x3 _You finish memorising. Spell assigned to 'c'.QkiQkifQkiQkiRki # #. #. #.# .##.# ...# #<.# #..#######..######.............# #####.@####.# #..####.########## #.........†....... ##.####.########## #.# #.# #$# #.# #.####.# #......########## #####....†.......RkiRki26.5 (1 _RkiRkiRki #. #.# .##.# ...# #<.# #..#######..###### .............# #####..####.# #@.####.########## #.........†....... ##.####.########## #.# #.# #$# #.# #.####.# #......##########  #####....†.......  ##.########## RkiRki&7Rki4Rki-RkiN   .# ..#<.######..######............. #####..#### #..####.##########.......†.......#.####.########## #.# #.# #.### RkiJV RkiW &8RkiO\ Rki]^ RkiO\ Rki\ Rkia Rkid Rki Rki3 Rki Rki| Ski$..# #<.# #..# ######..######.............# #####..####.#  #..####.###########.........†....... ##@####.########## .# #.# #$# #.# #.####.##......###############....†.......  ##.########## .# #.# #..SkiSki&9Ski Ski Skin# #<.######..######............. #####..#### #..####.###########.........†.......SkiOo##.####.########## #@# #.# $.####.##.# Ski{Ski|'10SkiSkiSki-  .######..######............. #####..#### ###########.........†.......#.####.########## #.# #.# .###.....############.#########.# SkiSki&1SkiSkiSki+2.5 (2SkihSkii> _You now have 125 gold pieces (gained 6).Ski ######..######............. #####..#### ##########.......†.......#.####.########## #.# #.# ##.....##############....†.......###......[..... SkiSki&$3.5 (1SkiSkiSkiV Ski`W SkiW SkiGZ Ski$] SkiPa BSkib ,Skigc Skie Skilh ,Skii Skij Skim Skim SkiNn Skijo Skir Skir Skirs Skit Skix Ski)y Skiy SkiO{ Skix ,Ski Ski Skiф Ski Ski SkiN Ski Ski Ski Ski Ski8 Skij Ski. Skiq P  There is a stone staircase leading up here.Ski SkiG  _Ski Skiњ Ski x  You encounter a bat and a frilled lizard.Skiģ w #l  #. ## #. .. #b .# Ski #. #.# #. #.# #.##.# #.@..# Ski ###<.#  #..# Ski? n#######..######Ski] d..............#Skix #######..####.# b   bat (asleep)Ski #..####.######### l   frilled lizard (asleep)Ski #.........†......##.####.#########Ski 024.5 (11.0)Ski 35.5 (12 _Skiƴ Skif Tki #l #. ##  #. ..  #b .#  #. #.#  #. #.#  #.##.#  #.@..#  ###<.#  #..#  ..######  Tki/.......#  ..####.#  #..# #...† ##.Tkij #l Tki#. ##  #. ..  #b .#  #. #.#  Tki>#. #.#  #.##.#  Tki^#.@..#  ###<.#  Tki~h#..#  Tki]..# Tkiޫ... ..####.#  Tki4#..# #...† ##.Tki4TkikTkid _There are monsters nearby!Tki3 #l #. ##  #. ..  #b .#  #. #.#  #. #.#  #.##.#  #.@..#  ###<.#  #..#  ..######  .......#  ..####.#  #..# Tki49#...† ##.Tki1, #l #. ##  #. ..  #b .#  #. #.#  #. #.#  #.##.#  #.@..#  ###<.#  #..#  ..# ... ..####.#  #..# #...† ##.TkiTkiTkiTkid _There are monsters nearby!Tki ### #l.  #.# ## #.# .. #b# .# #.##.# #.##.# #@##.# #....####<.# #..# #######..###### ..............########..####.#  #..####.######## #.........†.....TkiUTkiT6.0)Poisonous Vapours _TkiTkiTkiO##l. ##.# ..b# ##.#....####<.# #..########..#####.............#######..#######.########TkiTki(&7TkiJTkiGTki ##l. ##.# ..b# ##...###<. #..# #######..#####.............#######TkiZ Tki &8Tki Tki= Tki ^ .  The helpless bat fails to defend itself.  Tki- LYou puncture the bat!  Your weapon exudes an aura of protection.Tki>.l   frilled lizard (asleep)Tki]. 8 TkiZ9Poisonous VapoursTkiTkiG _You kill the bat!Uki֕##l. ##.# .. ##...###< #..########..#####.............UkiLUkiUki}@30Poisonous VapoursUkiUki{Uki# .###.l. ##..# ##...###< #..########..#####UkiUkiY9 1 1UkiUkiUki  .###.#l..# ##.# ...# ##...###< #..#Uki Y2Ukidy †The helpless frilled lizard fails to defend itself.  You puncture the frilled lizard!  Your weapon exudes an aura of protection.Uki (Ukio  8 83Poisonous VapoursUki Uki R _You kill the frilled lizard!UkiT1 Uki1 UkieB UkiE H _No target in view!Vki"fIVkiiVkikVkisp: _Vkisj  You see here a frilled lizard corpse.Vki})#.#.#Vki2}.# .#  .# VkiU}###.# #†@.# 4Vki}!#.#### #.# .. #.# .#Vki}~#.##.##.#Vki}#.##.##.##....#### 1 5.5 (2Vki 9 _Found a mace.VkiPIVkiӽVkiVkiBVkiVkiHVkiVkiVkij,VkiVki VkiVkiVkiVkipVkiBVki!Vki;BVkiVkiVkiVkiVkiVkiBVkiC<  You see here a +0 mace.VkiVki  _VkiVki Vki ,Vki_VkiLVkiBVkiuP..# ..# #.# #.# #.# #.# ###.# #..@# #)### #.# #.##.##.##.####.##†..#VkiE(046.5 (11.0)Vkiz),7.5 (12VkiV.Vki4, _f - a ring of wizardryVki3VkiVkiVki(VkiaBVki,VkiVki* Vki"Vki"Vki#Vki:%VkiC'Vki'Vki(Vkiv)Vki+Vki+Vki,Vki-VkiA0Vki0Vki.1Vki2Vki"5VkiM5Vki5Vki8Vkin:%  Vki:bYou encounter a kobold. It is wielding a +0 short sword.Vki@K###.## #...## #.@..# #....# ####.# #.# #.# #.#K   kobold (wandering) ###.# #...# #)###VkiA9.54.5 (7.0)VkiG(Vki H+5.5 (8VkiLVkiP3 _The kobold leaves your sight.VkimVki+VkiVkiH _No target in view!VkiM VkiN VkiU VkiAV H _No target in view!Wki'Wki_WkiדWkiՖWkiWkiGP _WkiWkiWkiȞWkiWkiJWkiWkiܡWkiۢWkim,WkiWkiWki,WkiBWkiWkiޭh  A kobold comes into view.Wki###########.###..............K #@#  #.#  #.# #.###.###...#K   kobold (wandering)#....#....####.Wki3.60.5 (5Wkix(Wki|+1.5 (6WkiWki3 _The kobold leaves your sight.WkiWki/WkiWkiH _No target in view!WkiWkiWkiWkiWki ? _No target in view! _ A kobold comes into view. _The kobold leaves your sight. _No target in view!  A kobold comes into view.Wki~M###########.###.......@......K#######.#######.#.#..K   kobold (wandering)..Wki+...Wki) %0Wki.WkiZ22.5 (1 _WkiWkiWkir #.#.K.#.##.# #.##.###.## #...###....# Wkit /K.Wkif{ Wki{ &3Wki{ Wkiw Wki X WkiP ###########.####  ........@....K..  #######.########  #.# Wki #.# #.# ##.## #...## #....# Wkiw{ ###########.####  ........@....K..  #######.########  #.# #.# #.# ##.## #.. #..Wkiw Wkim{Wki{WkiqWki] _A kobold is nearby!WkiG6##..#.#.K.#.#.#.# #.##.###.## #...###....# Wki̕>.KWkiWki^-4 _WkiNWkiXki7#### >.. #.#.K..##.#.##.# ##.## XkiG;>.KXkiAXkiA&5Xki&GXkiI; _Found a stone staircase leading down.XkipD##### #>.. #.###### .K.# #.#.# #.# XkiD^##.## XkiGF.KXkiMXkiN&6XkieSXkiSUXkiVF /##### #>.. #.###### .# XkiF #.#K# #.# ##.## XkiF XkiH .XkiM )Xki|N &7Xki'R XkiT Xki/ 4Xki3 Xkir6 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Yki#Yki#Yki(Ykiy*H _No target in view!Yki@>Yki>Yki5BYkieDH _No target in view!Yki Yki Ykiۼ Ykin Yki c  You encounter a bat.Yki  ########. #>.....b. ###########@###### .................########.########.# Yki ? #.#  #.# #.b   bat (asleep) ## #...Yki U##  #....#Yki G0KYki K   kobold (wandering)Ykiv +8.5 (1Yki Yki + _Found 20 gold pieces.Zkio8  Casting: Poisonous Vapours (safe; 7% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Zki 4ZkijZki2 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)[kiq ########.# #>@....b..###########.######K#.................# #######.#[kir #######K# #.# .# Kmissile, asleep)##.##[ki)r 0#...##[ki <9[kis  _You encounter a kobold. It is wielding a +0 short sword and quivering stones.[ki#.#.#>.@...b..###.######K#l.........# #.#### #.# l   iguana (asleep)#.# b   bat (##.## K   kobold (missile, asleep) [ki[ki'70[ki[kiX _You encounter an iguana.\ki!  ludeguy the Sneak  Octopode  Health: 31/31 ========================  Magic: 7/9==================------  AC: 1Str: 8  EV: 12Int: 19 \ki SH: 0Dex: 12 ########.#.  XL:  5 Next: 58% Place: Dungeon:3 #>.@...$..#  Noise: ---------  Time: 2670.5 (0.0) \kiy ###########.######K#l  c) +0 dagger (protect)  .................#  Cast: Poisonous Vapours \kiHU #######.########K#  #.# \kik#.# l   iguana (asleep) \ki#.# b   bat (asleep)\ki ##.##\ki˸ K   kobold (missile, asleep) #...##\kiMConfirm with . or Enter, or press ? or * to list all spells.\kiAiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line\ki'HAim: a bat (asleep, chance to weaken: 100%)  \kiCsThe glob of mercury hits the bat! The bat looks weaker. The mercury splashes!  The kobold looks weaker.\ki .#.  #>.@***$..#  #l \kiN   # #.# #.#\ki #.#K   kobold (missile, asleep, weak)\ki^ ##.## \kiA.\kiZH3...\kiK<9==1.5 (1\kiQ\kitT  Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  \kiTAim: a bat (asleep, chance to weaken: 100%)  The glob of mercury hits the bat! The bat looks weaker. The mercury splashes!kobold looks weaker. _You kill the bat!\kik #.#.##>..@..$..# ##.######.#l#........# #.## \ki G#.# \ki E--2\ki \ki ]ki94#.#.# #>...@.$..#  ##.######.#l#  .# ]ki4R#.# ]kid81K]ki>K   kobold (wandering)]ki'?A--3]kiE]kixG]ki  ludeguy the Sneak  Octopode  Health: 31/31 ======================== ]ki Magic: 5/9=============-----------  AC: 1Str: 8  EV: 12Int: 19]ki  SH: 0Dex: 12 ]ki4########.#.#  XL:  5 Next: 59% Place: Dungeon:3 ]kib4#>...@.$..#  Noise: ---------  Time: 2673.5 (0.0) ]ki ###########$######.#l#  c) +0 dagger (protect)  .................# Cast: Poisonous Vapours  #######.########K# #.# #.#]ki l   iguana (asleep) #.#]ki K   kobold (wandering) ##.## #...##]kiMConfirm with . or Enter, or press ? or * to list all spells.]ki!Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line]ki=Aim: a kobold, wielding a +0 short sword and wearing a +0 leather armour  (wandering, hasn't noticed you, chance to weaken: 100%)  ]kicEThe glob of mercury hits the kobold. The kobold looks weaker.]ki}M]ki7 #.#  #>***@.$..#  ]ki:## ]ki  ]ki   ]ki#2#.# ]ki7/#.#]kiI2 #.#]ki\ ]kio4##.## ]ki]ki$...]ki4==4.5 (1]kiH]ki  Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a kobold, wielding a +0 short sword and wearing a +0 leather armour  (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the kobold. The kobold looks weaker. ]kiq?_You kill the kobold!^ki!j  Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.^kiT04^ki7^kih8 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)^ki##..#.#.# #>....@$..# ##$######.#l# ^ki~[.# # ^kiR#.# ^ki^ki6--5 _^ki^ki^kiDludeguy the SneakOctopodeHealth: 31/31 ========================Magic: 3/9========----------------AC: 1Str: 8##EV: 12Int: 19..SH: 0Dex: 12########.#.#XL:  5 Next: 59% Place: Dungeon:3#>....@***#Noise: ---------  Time: 2675.5 (0.0) ###########$######.#l#c) +0 dagger (protect) .................# #^kiCast: Poisonous Vapours #######.########K##.##.#l   iguana (weak)#.###.###...##Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.^ki ?Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an iguana (asleep, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks weaker.^kial.$.==6.5 (1Poisonous Vapours^ki9g^kiionfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an iguana (asleep, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks weaker. _The iguana is lightly wounded._kiludeguy the SneakOctopodeHealth: 31/31 ========================Magic: 1/9==----------------------AC: 1Str: 8##EV: 12Int: 19..SH: 0Dex: 12########.#.#XL:  5 Next: 59% Place: Dungeon:3#>....@**l#Noise: ==-------  Time: 2676.5 (0.0) ###########$######.#.#c) +0 dagger (protect) .................# #Cast: Poisonous Vapours #######.########K##.##.#_kil   iguana (weak)#.###.###...##Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an iguana (lightly wounded, weak, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks even weaker._kinaKl._kiu$K   kobold (missile, weak)_ki{v+7.5 (1_ki|_ki(onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an iguana (lightly wounded, weak, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks even weaker. _The iguana is moderately wounded._ki]   ludeguy the Sneak  Octopode  Health: 31/31 ========================  Magic: 0/9------------------------  AC: 1Str: 8 ##  EV: 12Int: 19 ..  SH: 0Dex: 12 ########.#.#  XL:  5 Next: 59% Place: Dungeon:3 #>....@$lK#  Noise: ==-------  Time: 2677.5 (0.0) ###########$######.#.#  c) +0 dagger (protect) .................# #  Cast: Poisonous Vapours #######.########K# #.# #.# l   iguana (weak)[_ki^ 20;10m #.# K   kobold (missile, weak) ##.## #...##Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetAim: an iguana (moderately wounded, weak)  Poisonous fumes billow around the iguana!l. ##  ..  ########.#.#  #>.# #$######.#.#  #  #.# #.#poisoned, weak) #.# ##.## -8.5 (1Poisonous Vapours_kib _kid onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  Aim: an iguana (moderately wounded, weak)  Poisonous fumes billow around the iguana! _The iguana is poisoned.`ki$K.  Poisonous fumes billow around the iguana! _The iguana is poisoned.  You hit the iguana.  `kiyYour weapon exudes an aura of protection.  You grab the iguana.  The iguana is heavily wounded.`kiw8 `ki/H 8 -`kiZ9`ki`kim _You constrict the iguana. The iguana barely misses you.`ki^ $You hit the iguana but do no damage.The iguana is almost dead.You constrict the iguana.`ki] K   kobold (missile, weak)  You kill the iguana!`ki8(`ki;A8$`kiEv1==8380Poisonous Vapours`kiJ`kihMW _The kobold throws a stone. The stone hits you but does no damage.`kiN#### ... #.#.# #>.....@K.# #$######.#.# #.# .#K#$.#.# ..##.# ..#g   Ijyb (wand, asleep)#.# .g#K   kobold (missile, weak)##.## ... `ki`ki  You encounter Ijyb the Inquisitive. She is wielding a +0 dagger and carrying awand of paralysis.`ki /  --more--akiH1 _Found 12 gold pieces. The kobold closely misses you.Things that are here: _20 gold pieces; an iguana corpseaki h )You hit the kobold.aki (aki a2Poisonous Vapoursaki aki J _You kill the kobold!bki+ #### ... #.#.# #>....@$).###$######.#.#.#.##.bki#K#$. #.# ..# #.# ..# #.# .g# ##.## ...  #...##bki<bki.-3bkibkibki < #### ... #.#.# #>...@.$).#  ##$######.#.#  .#.#  #.#K#$.  #.# ..#  #.#bki ' ..#  #.# .g#  ##.## ...  #...##bkiБ bkiQ ]==-4bkiɘ bkip bki d #### ... #.#.# #>..@..$).# ##$######.#.# .#.#  #.#K#$.  #.# ..#  #.# ..#  #.# .g#  ##.## ...  #...##bki bkiI &5bki` bki bkiu #### ... #.#.# #>.@...$).# ##$######.#.# ........#.# #.########K#$.  #.# ..#  #.# ..#  #.# .g#  ##.## ...  #...##bki~O 1 6bkibkicki7{ #### ... #.#.# #>@....$).# ##$######.#.# .........#.# #.###cki#####K#$.  #.# ..#  #.# ..#  #.# .g#  ##.## ...  #...##ckickiN&7ckickickiD cki ckiJ cki^ cki 2===ckiƯ cki Bcki ,ckiW ckiZ ,cki cki Q===ckiE cki ,cki ckiz ,cki cki cki0 cki ckiD ,cki ckij 93cki 2===ckiC cki cki cki cki ,ckiS cki cki cki cki cki ;===cki cki cki cki ckiA ,cki cki ,cki ckin ,cki4 cki- j4==cki cki ,ckiL cki ,cki cki ckiL cki cki cki :==cki ckiv ,cki cki[ cki cki cki ,cki ckiM ,cki ckiD! cki! O5===ckix" ckik% ,cki& cki) ,cki* cki- cki. cki?/ cki2 Q===cki 4 cki#7 ckie7 ckiv8 ckiH +6===ckicJ ckiO BckiP ckiSP ckiQ ckiT cki]T ckiU ckiX Q===ckiY cki] ckii] cki^ cki*a ,ckib ckiYe ,ckixf ckii ckiQi ckiYj ckil cki:m N7==ckifn ckip ,ckiBr ckiCu ckiu ckiuv ckix ,ckiz cki| P==cki} cki ,cki cki ,cki% cki ,cki cki̋ cki cki ckik c8===cki ckiu cki cki̤ cki3 cki~ cki ;===ckiE cki, ckie cki cki cki cki0 cki6 Bcki cki ckiB cki n _You start resting.Magic restored.cki cki 1751.5 (64.0)cki, 9===2.5 (65 _dkijA#### ...########.#.# #>.....$)###########@######.#.# .................#.# dkiA #######.########.#$. #.# ..#  #.# ..# #.# g#dkiA#.## ... #...## #...dkiB.#dkizIdkiI#3.5 (1dkiJ.0)dkieki!ekiekieki)eki:,ekiekifekiekiekicekidekiGd  Ijyb comes into view.eki####  ... ########.#.#  #>.....@).# ##########)######.#.# ................#.# ######.########.#$.#.# ..##.# ..# g   Ijyb (wand, asleep)#.# .g###.## ...#...##eki(+9.5 (5eki360.5 (6 _ekiekiC  Things that are here: _20 gold pieces; an iguana corpseeki ####  ...  ########.#.#  #>.....@).# #)######.#.# eki.#$. #.# ..#  #.# ..#  #.# .g#  ##.## ...  eki)G ' ####  ...  ########.#.#  ekiG [#>.....@).# #)######.#.# .#$. #.# ..# #.# ..#  ekiG #.# .g#  ##.## ...  ekiN ekiP ekiU eki8W Y _Ijyb is nearby!fki  Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.fkiLfkifkifkiA _You can't see any susceptible monsters within range! (Use Z to cast anyway.)fki+#######.##....########.#.##>.....$).# #########)######@#.# ...............#.# #####.########.#$.  #.# #..##.# #..##.# #.g# ##.##...#..#..##....#1.5 (1 _gkiw  Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.gki@  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)gki #######.#....# ########.#.# >.....$).# #########)######.#.# ...............#@# #####.########.#$......#  #.# #..######g##.##.....###.....gkiB agg)gki **gki q ##  #####.#  #....#  ##.#.#  #>.....$).#)######.#.# #*##$......#  #.# #..######  #.# #..#  #.# #.g#  ##.## #...   #..#   ....  gkiJY *@gki\   2  2Para gkia gkib Kg.gkii gki?j /gkij )3.5 (2Poisonous Vapoursgkip gki$}  ##  #####.#  #....#  ##.#.#  #>.....$).#)######.#.# #@##$......#  #.# #..######  #.# #g.#  #.# #..#  ##.## #...   #..#   ....  onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within rgki} ange! (Use Z to cast anyway.) _Ijyb zaps a wand. You suddenly lose the ability to move!12 4.0 (2.5gki gki:  gkim D_You can act again.gkie ?ludeguy the SneakOctopode##Health: 31/31 ========================#####.#Magic: 7/9==================------#....#AC: 1Str: 8########.#.#EV: 12Int: 19#>.....$).#SH: 0Dex: 12 #########)######.#.#gkif XL:  5 Next: 83% Place: Dungeon:3 ...............#@#Noise: ---------  Time: 2764.0 (0.0) #####.########.#*......#c) +0 dagger (protect)#.##*.######Cast: Poisonous Vapours#.##g.##.##..###.###...g   Ijyb (wand, weak)#...###..##....#....#....#Confirm with . or Enter, or press ? or * to list all spells.gki.g Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight linegkidg Aim: Ijyb, wielding a +0 dagger, wearing a +0 leather armour and carrying a  wand of paralysis (chance to weaken: 100%)  The glob of mercury hits Ijyb! Ijyb looks weaker.gkir 8g.gki $==5.0 (1gkiJ   Aiming: Mercury Arrow (safe; 6% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: Ijyb, wielding a +0 dagger, wearing a +0 leather armour and carrying a  wand of paralysis (chance to weaken: 100%)  The glob of mercury hits Ijyb! Ijyb looks weaker. _Ijyb is heavily wounded.hki2  ludeguy the Sneak  Octopode hki##  Health: 31/31 ======================== #####.#  Magic: 6/9================-------- #....#  AC: 1Str: 8 hki########.#.#  EV: 12Int: 19 #>.....$).# SH: 0Dex: 12 #########)######.#.#  XL:  5 Next: 83% Place: Dungeon:3 ...............#@# Noise: ==-------  Time: 2765.0 (0.0) #####.########.#g......#  c) +0 dagger (protect)  #.# #..######  Cast: Poisonous Vapours  #.# #..#  #.# #..#  ##.## #... g   Ijyb (wand, weak)  #...## #..#  #....# ....  #....#Casting: Mercury Arrow (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetAim: Ijyb, wielding a +0 dagger, wearinghkiA a +0 leather armour and carrying a  wand of paralysis (heavily wounded, weak)hkiKi ## hki #####.#  #....#  hki##.#.#  #>hki)######.#.# #@#hki^b#g......# hki| #.# #..###### hki| #.# #..# hki #.# #..#  ##.## #...hki,d, poisoned, weak) hki1  #..#   ....  hki3-6.0 (1hkihki Sonfirm with . or Enter, or press ? or * to list all spells.hki @Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  Aim: Ijyb, wielding a +0 dagger, wearing a +0 leather armour and carrying a  hkiE wand of paralysis (heavily wounded, weak) _Poisonous fumes billow around Ijyb! Ijyb is poisoned.ikiV:ludeguy the SneakOctopode##Health: 31/31 ========================#####.#Magic: 5/9=============-----------#....#AC: 1Str: 8ikiV########.#.#EV: 12Int: 19#>.....$).#SH: 0Dex: 12 #########)######.#.#XL:  5 Next: 83% Place: Dungeon:3 ikiV...............#@#Noise: =--------  Time: 2766.0 (0.0) ikiV#####.########.#g......#c) +0 dagger (protect)#.#iki W#..######Cast: Poisonous Vapours#.#iki0W#..##.##..#ikiTW@##.###...ikixWg   Ijyb (wand, very poisoned, weak)#...###..#ikiW6#....#....ikiWd#....#Confirm with . or Enter, or press ? or * to list all spells.ikiWAiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetiki XAim: Ijyb, wielding a +0 dagger, wearing a +0 leather armour and carrying a  wand of paralysis (heavily wounded, poisoned, weak)  iki-X;Poisonous fumes billow around Ijyb! Ijyb looks even sicker.ikiY+7.0 (1iki_ikibN _Ijyb closely misses you.iki  You miss Ijyb. Your grab misses Ijyb. Your squeeze misses Ijyb.  Ijyb is heavily wounded.ikiT0-8ikiiki5 _Ijyb hits you with a +0 dagger.iki  You barely miss Ijyb. Your grab misses Ijyb.  Ijyb is heavily wounded.iki8$28ikia=---9ikiD.K _Ijyb hits you with a +0 dagger.ikig _Ijyb hits you with a +0 dagger.  You barely miss Ijyb. Your grab misses Ijyb.  Ijyb is heavily wounded. _Ijyb hits you with a +0 dagger.  You barely miss Ijyb. Your grab misses Ijyb.  Ijyb is severely wounded.iki%iki Y ikiY '70iki_ ikib D _Ijyb zaps a wand. You resist with some effort.iki^  You barely miss Ijyb. You grab Ijyb.  Ijyb is severely wounded.iki_ B5----iki_ 1ikic iki0f I _You constrict Ijyb. Ijyb hits you with a +0 dagger.iki You hit Ijyb.  Your weapon exudes an aura of protection.  Ijyb is severely wounded.iki M 8 2iki iki K _You constrict Ijyb. Ijyb hits you but does no damage.jki$  ludeguy the Sneak  Octopode ##  Health: 25/31 ===================----- #####g#  Magic: 4/9==========-------------- #....#  AC:  8  Str: 8jki ########.#.#  EV: 12Int: 19 #>.....$).# SH: 0Dex: 12 #########)######.#.#  XL:  5 Next: 83% Place: Dungeon:3 ...............#@# Noise: =--------  Time: 2772.0 (0.0) jki#####.########.#g......#  c) +0 dagger (protect)  #.# #..######  Cast: Poisonous Vapours  #.# #..# jki #.# #..#  ##.## #... g   Ijyb (wand, poisoned, weak)  #...## #..#  #....# ....  #....#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetAim: Ijyb, wielding a +0 dagger, wearing a +0 leather armour and carrying a  jkiwand of paralysis (severely wounded, constricted by you, poisoned, weak)  You miscast Poisonous Vapours. Nothing appears to happen. You constrict Ijyb.jki ##  #####g# jki #....#  ##.#.#  jki@#>)######.#.# jkim-#@##g......#  #.# #..###### jki #.# #..#  #.# #..# jki ##.## #...   #..#jkig   goblin (wandering)   .... jki   jkiBAiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  jkinBAim: Ijyb, wielding a +0 dagger, wearing a +0 leather armour and carrying a  wand of paralysis (severely wounded, constricted by you, poisoned, weak)  You miscast Poisonous Vapours. Nothing appears to happen. You constrict Ijyb.  jki`You encounter a goblin. It is wielding a +0 dagger.jkiTjkiz~6=5===Contam: 10% -3.0 (1jkijkiD _Ijyb zaps a wand. You resist with some effort.jki $You hit Ijyb. Your squeeze misses Ijyb.  Ijyb is almost dead.You constrict Ijyb.jki K.gjkiO g   goblin (wandering)jki kludeguy the SneakOctopodejki7 ##Health: 26/31 ====================----#####.#Magic: 5/9jkiZ =============-----------#...g#jkiz AC:  8  Str: 8########.#.#EV: 12jki Int: 19 Contam: 10% #>.....$).#SH: 0jki Dex: 12 #########)######.#.#jki XL:  5 Next: 107% Place: Dungeon:3 ...............#@#Noise: =--------  Time: 2774.0 (1.0) #####.########.#$......#jki c) +0 dagger (protect)#.##..######Cast: Poisonous Vapoursjki& #.##..##.##..#jkiD ##.###...g   goblin (wandering)#...##jkic #..##....#....#....#jki You encounter a goblin. It is wielding a +0 dagger. _Ijyb zaps a wand. You resist with some effort.  You hit Ijyb. Your squeeze misses Ijyb.  jki Ijyb is almost dead.You constrict Ijyb. _You kill Ijyb!jki  You hit Ijyb. Your squeeze misses Ijyb.  Ijyb is almost dead.  You constrict Ijyb. jkiR _You kill Ijyb!Your Spellcasting skill increases to level 3!You have reached level 6!jki /  --more--lki30/365/10-6 3% Poisonous Vapourslkilki4 _mki#######.#...g# ########.#.# >.....$).# #########)######.#.# ...............#.##>#..# #####.########.#@......#  #.# #..##### ##.##....####.....###-5gYour Spellcasting skill increases to level 3! _You have reached level 6! _Found a stone staircase leading down.  You now have 152 gold pieces (gained 12).  e - a wand of paralysis (3)  Things that are here:g   goblin (wandering)1-6.0 (2mki _a +0 dagger; a +0 leather armour; the goblin corpse of Ijybmki!  ######.# #.g..########.#.# #>.....$).# #########)######.#.# ...............#@##>#..# #####.########.#)......##### #.# mki ##.## . ##..##.......mki G.gmki mki D7.0 (1Poisonous Vapoursmki mki nki /  ludeguy the Sneak  Octopode ##  Health: 31/36 ====================----nki/t #####.#  Magic: 4/10=========--------------- #....#  AC:  8  Str: 8 ########.#.#  EV: 12Int: 19 Contam: 10% nki/( #>.....$)g# SH: 0Dex: 12 #########)######.#.#  XL:  6 Next:  3% Place: Dungeon:3 ...............#@##>#..#  Noise: ---------  Time: 2777.0 (0.0) #####.########.#)......#  c) +0 dagger (protect) nki$00 #.# #..######  Cast: Poisonous Vapours  #.# #..#  #.# #..#  ##.## #...nki>0 g   goblin (wandering)  #...## #..## nkiU0< #....# ....  #....# .... nkij0_a +0 dagger; a +0 leather armour; the goblin corpse of Ijybnki0Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.nki0Aiming: Poisonous Vapours (safe; 6% risk of failure)  nki0Press: ? - help, Dir - move targetAim: a goblin, wielding a +0 dagger (wandering, hasn't noticed you)nki7= ##  #####.#  #....#  nki7Q##.#.#  #>)######.#.# nki8#@##>#..# nki.8#)......#  #.# #..###### nkiQ8| #.# #..# nkig8 #.# #..#  ##.## #... nki8y  #..#   .... nki8  nki :f 1 28.0 (1nki??nkiA  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  nkiBAim: a goblin, wielding a +0 dagger (wandering, hasn't noticed you) _You miscast Poisonous Vapours. Nothing appears to happen.nki   ludeguy the Sneak  Octopodenki  ##  Health: 31/36 ====================---- #####.#  Magic: 3/10=======----------------- #....#  AC: 1Str: 8 ########.#.#  EV: 12Int: 19 Contam: 20%  #>.....$).# SH: 0Dex: 12 #########)######g#.#  XL:  6 Next:  3% Place: Dungeon:3 ...............#@##>#..#  Noise: ---------  Time: 2778.0 (0.0) #####.########.#)......#  c) +0 dagger (protect)  #.# #..######  Cast: Poisonous Vapours  #.# #..#  #.# #..#  ##.## #... g   goblin (wandering)  #...## #..## nki   #....# ....  #....# ....Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  nki Press: ? - help, Dir - move targetAim: a goblin, wielding a +0 dagger (wandering, hasn't noticed you)  nkiV NPoisonous fumes billow around the goblin!  The goblin is poisoned.nki B ##  #####.#  #....#  nkiU :##.#.#  #>)######g#.# #@##>#..# #)......#  #.# #..######  #.# #..#  #.# #..#  ##.## #...g  poisonednki ~)   #..# nki 8  ....   nki J====9.0 (1nki nki Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  Aim: a goblin, wielding a +0 dagger (wandering, hasn't noticed you)  Poisonous fumes billow around the goblin!  nki7 7The goblin is poisoned. _shouts!okiA )You puncture the goblin!  Your weapon exudes an aura of protection.okifB(okiF2= 8 4=---80Poisonous Vapoursoki0LokiNJ _You kill the goblin!okiWM ######.# #....########.#.# okiW _#>.....$).# #########)######@#.# ...............#.##>#..# #####.########.#)......##.##..######....okioki&Q----1oki]oki8O _You see here a +0 dagger.oki ## #####.# #....# ########.#.# #>.....@).# ##########)######)#.# ................#.##>#..# ######.########.#)......# #.# #..######oki #.# #..# #. #..# ## #... #...## #..##okiokiIl4==-2 _okiokiN  You now have 172 gold pieces (gained 20).oki> 1 3.0 (2okiokiT _You see here an iguana corpse.pki## #####.# #....# #.#.# #>.....†@.# )######)#.# pki4#.##>#..# .#.#)......##.# #..#######.# #..##.# #..#pkic##.## #... pkiݹpkiqv3==4.0 (1pkiapki$  Things that are here:pkiP _a +0 short sword; 4 stonespkit3pkivpkiuzpki)~U18 _pkipkieT==6pkipkipki 74pkipki4=2pkijpki#M0pkipki|pkiŕ_5===8% pkipkiқpki!76pkipkijpki]5=4pki£pkiEpki72pki`pki=pkiU===1pki\pki pkiO'pkipki Z _Your magical contamination has completely faded away.pkiVpki|a6==pkirpki8N _HP restored.pkipkihpkiN6==pki9pkipki?pkipkihpki9=pkipkipkipkipkipki:==pkipkipki#pkipkipkipkikN7==pkipki ,pki3 pki,pkipkiC,pkipkiP==pkiNpki ,pki^%pki>',pki()pki+,pki-pkiJ1;8pki1*===pkiB3pki6,pkig8pki;pki/<pki=pki^BpkiBpkiyDpkiHpkiH;===pki Kpki~OpkiPpki2QpkiUpkiSUpkiWpkiZpki?[pki]pkiapkiLapkitaE9==pkicpkiahpkihpkijpkijopkiopkiqpkibvpkivpkiHxpki }P==pki~pkiт,pkiipkï,pkipkipkipkiEpkipkiڠpkipkiKpkiQ10/10===pkipkiHpkiزpkipkiݴpkipkiƺpkiipkiԼpkipki,pki|pkihpkiypkib%===pkipki_pkipkiBpkipki~6###  #####.##  #....#@# 837.0 (5pkiP3.0)  ##.#.###.......  #>.....†).## #.##[.#pkiO)######)#.# ...pki ..........#.##>#..###. pki'.########.#)......# # .# #..###### pki>.# #..# .# #..pkiT"#pkil pki ,8.0 (54pkiF pki M _Found a pair of gloves.pki pkia pki٤ pki pkiR pki| pkiΪ pki$ pki pki pkiJ pki pki pki pkib pkii pki` pki ,pki pki Bpki pki7 pki ,pki pki pki pkiY pkih pki pki ,pki pki pki pkir pkif pki pki ,pki pki pki* pkiu pki pki pki ,pki0" pki# pkik& ,pki' pki+ ,pki, pki;/ N _e - 3 potions of enlightenment (gained 1)pki1 pki1 pki2 pki4 pki6 pki-7 pki7 pkig8 pki: pki: pki\   You encounter a hobgoblin.pki] ###)#.###.............. ..#.##>#..###..##.#... #.#)......# #.#.#.#.##..###### #.##....##..#pki] #.......##..# ####......###... g.........####..## ###........#.... ##..@..#.#.... #.#####.#  #. #.#  #. #.# #.# #.# pkiT^ g   hobgoblin (asleep) #.# #.# ..######pkia U.g63.0 (25pkif g==4.0 (26pkik pkim + _The hobgoblin shouts!pki)#.###..... >#..###..##.#... ) #.#.#.#.#   #.##....#  #..# #.......#  #..# ####......##  #... .g........###  #..## ###........#  .... ##..@..#.#  .... #.#####.#  #. #.#  #. #.#  #.#  #.#  #.#  #.#   qki$)#.###..... >#..###..##.#... ) #.#.#.#.#   #.##....#  #..# #.......#  #..# ####......##  #... .g........### qki #..## ###........#  .... ##..@..#.#  .... #.#####.#  #. #.#  #.  #.# #.#  qkix#.# #.# qki7qkiqkiqki` _A hobgoblin is nearby!qki|)#.###..... >#..###..##.#... ) #.#.#.#.# qki.  #.##....#  #..# #.......#  #..# ####......##  #... .g........###  #..## ###........#  .... ##..@..#.#  .... #.#####.#  #. #.#  #. #.#  #.#  #.#  qkiS#.#  qki{F#.#   qki $)#.###..... >#..###..##.#... ) #.#.#.#.#   #.##....# qki$ #..# #.......#  #..# ####......##  #... .g........###  #..## ###........#  .... ##..@..#.#  .... #.#####.# qki% #. #.#  #. qki>%> #.#qkid%@ #.#  qki%n#.# #.# qki% qki|+qki+qki0qki3` _A hobgoblin is nearby!qkiД #)#.###......#.##>#..###..##.#... ##.#)......# #.#.#.#.# #..###### #.##....# #..# #.......# #..# ####......## #... .g..### #..## ###........# .... ##.@...#.# .... #.#####.# #. #.# #qki h. #.##. #.##. #.##[ #.##. #.#  ..######qkiɗ @.gqki qki :--5.0 (1.0)qki qkio M _Found a leather armour.rki  Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.rkiSrkicT9--rkij[rki^ _You can't see any susceptible monsters within range! (Use Z to cast anyway.)rkiN....†).## ##.##[.##.##.##.# rkiO#####)#.###.............. ....#.##>#..###..##.#... ###.#)......# #.#.#.#.#rkiO #..###### #.##....#rkiSO #..# #.......# #..# ######......##rkikOY #... ....g###rkiOm #..## #...# ....#.....#.#.... #.#####.#rkiPc #.# #.# #.# #.# #.# #.# #.# #.# #[# #.##. #.#rkiQ?.grki)ZrkiZI6Poisonous Vapours _rkiarkicrkiE ....†).## ##.##[.##.##.##.#  ludeguy the Sneak rki r#####)#.###..............  Octopode ....#.##>#..###..##.#...  Health: 36/36 ======================== ###.#)......# #.#.#.#.#  Magic: 9/10=====================---  #..###### #.##....#  AC: 1Str: 8 rkiܳ P #..# #.......#  EV: 12Int: 19  #..# ######......##  SH: 0rki Dex: 12  #... ............###  XL:  6 Next:  4% Place: Dungeon:3 rki.  #..## ###g@......#  Noise: ---------  Time: 2866.0 (0.0)  .... ##.....#.#  c) +0 dagger (protect) rkiW  .... #.#####.#  Cast: Poisonous Vapours rki ^#.# #.#  #.# #.#  rki #.# #.#  g   hobgoblin #.# #.#  #[# #.# rki  #. #.# Casting: Poisonous Vapours (safe; 6% risk of failure)  rki Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  rki{ Press: ? - help, Dir - move targetAim: a hobgoblin  Poisonous fumes billow around the hobgoblin!rkiJ +).## ##.##[ )........... rki >#..###..##.#... ) #.#.#.#.#   #.##....#  #..# #.......# rkiԽ #..# ######......##  #... .....### rki B #..## ###g@......#  .... ##.....#.# rki# .... #.#####.#  #.# rkiJ [ #.# rkiվ  #.# #.#  rki (poisoned) #.#  #[#  #. rkiT rki: 3=7.0 (1rki6 rkix Sonfirm with . or Enter, or press ? or * to list all spells.rki Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  Aim: a hobgoblin  rki WPoisonous fumes billow around the hobgoblin! _The hobgoblin is poisoned.ski....†).## ##.##[.##.##.##.#ludeguy the Sneak #####)#.###..............Octopode ....#.##>#..###..##.#...Health: 36/36 ======================== ###.#)......# #.#.#.#.#skiMagic: 8/10===================-----#..###### #.##....#AC: 1Str: 8#..##.......#EV: 12Int: 19#..# ######......##SH: 0Dex: 12#... ............###XL:  6 Next:  4% Place: Dungeon:3#..## ###g@......#Noise: =--------  Time: 2867.0 (0.0)....##.....#.#skic) +0 dagger (protect)....#.#####.#Cast: Poisonous Vapours#.# #.##.# #.#ski5c#.# #.#g   hobgoblin (very poisoned)#.# #.##[# #.#ski#. #.#Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetskiAim: a hobgoblin (moderately wounded, poisoned)  Poisonous fumes billow around the hobgoblin!ski[2---8.0 (1skiNskionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  Aim: a hobgoblin (moderately wounded, poisoned)  Poisonous fumes billow around the hobgoblin! _The hobgoblin looks even sicker. The hobgoblin hits you.skiE .  You barely miss the hobgoblin. You grab the hobgoblin.  The hobgoblin is severely wounded.You constrict the hobgoblin.ski N(skiT3=--9Poisonous VapoursskiWskiKZM _You kill the hobgoblin!ski!.†).## ##.##[.##.##.##.##)#.###...............#.##>#..###..##.#...#.#)......# #.#.#.#.# #..###### #.##....# #..# #.# #..##......## #....### #..## ###.# .... ##.....#.# .... #.#####.# #.# #.# #.# #.# #.# #.# #.# #.# #[#ski=" #.#  #. #.#-70ski4skic6skigskihskijskin,skir4=skitski"x,skiNyskiZ|ski|L9==ski}skiՀskiskiskiskirK5=skixskiskifski"skiski:==ski-skiskiskiskiskiuh6==skiXskiskiski/skiǝski '10/10ski**===ski;ski΢skiEskiskiskiѫskiskiEskii2=skiski skiµski4ski)skiskiski;===ski#skiskiski@ski$ski<skiOskiskiskiZskiMskiskijski7skiski:skiski2ski,skiskiskiski/skiski$skiskiskiNskiskiski,ski(ski,skiski\skiskiskiskiJskiskiski`skiskiXskiskiskiskiski ski skiW ski' skiskiQski+skiskiT,skiskiUskiiskiskiskiskiskiskiskinskixskiski8ski$Xski%ski^'ski'ski$(skiW)ski+ski%,skiu,ski.ski0,ski1skiw3ski}5,ski5ski6ski7ski7skiZ8ski9ski:ski:ski';ski<tki ####...## #.######.# ......#.###.##....# #[.##.##.##.##.###.# ...............### tkiE#..##.#..........# #.#.#.#.###.####.# #.##....# #.# #.# #.......# #.####.##># #......## #.....@...# -913.0 (43.0) tki.......#########. #........# ######.# ##.....#.# tkiH#  #.#####.#  #.#  #.#tki^  #.#  #.#tki#tki tki ,4.0 (44tkiqtki; _Found a stone staircase leading down.tkiWItkitkitkitki^ntkitki֏tkiDtki,tki tkitkitkiR  There is a stone staircase leading down here.tkitkii _tkitkitki7tkiK,tkitkitki;tkitkitki,tkiLtkiBtkitkitki߼Btki]tki,tki,tkihXtki,tkitki,tkiQtkitkitki,tki,tkitkitkitkiXtkitki,tkiOtkitkiKtkij,tkitkitki~Btki/tki,tkitkitki!tki",tki#tki&tki'tki%(tki4)tki+,tki,tki-tkiA1,tki1tki2tkiT;tki<,tki>tkihFXtkiH,tki"ItkiJtkiP,tkiQtkiRtkiU,tki@VtkiWtki[,tki[tki$_tkiaBtkibtkieBtkigtkipjtki`ytki|,tkiP~tki\tki0,tki4,tki,tkitkitki̋tkitkitkitkiXtki,tki,tkigtki,tkiܧtkië,tkiPtkitkitki̱tkitkiܶtkitkiȼtkitkiXtkiBtkiBtki3tki^D #.# #.#  #.# #.  #.# #.#  #.# #.#  ..###### #.######### ##...#######.........# #............#######.# ######.....##############.# ..#..........# .#####.###..#############.#  #.......# #.#  #.##.##.# #.# #.##.##<####.# #.##.##.##...# .####.##..#.##.#.# ............##.#.# #####......###.#.#66.0 (527.0 (53 _c - a scroll labelled MYGGURCHEWEtkimLItkiOtkiQtkiVXtkiVtkiVtkiRXtkiLZtkiZtki [tki\tki8_,tki_tkiatkictkidtkiudtkietki_htkihtkioitkijtkim,tkintkiotki)r,tkirtki~ttkivtkiWvtkivtkiwtkiy,tkiztki|tki~,tki[tkiƀtkiʃtki/tkitki=tkiI,tkitkitkitkiKtkiztki/tkitkitki:tkitkitkitkitki tkiܗ,tki>tkiRtkitki#tkiTtkitkitkitki]tkiXtki,tkitkitki,tkitki֩tkiW,tkitkitkiʰtkitkitkitkiմ,tki!tkixtki,tkiTtkibtki-tkihtkitki$tkib,tkitkitki,tki\tkiOtki%Btkitkitki,tkitki:,tkitki<tkitkitkitki8tkitkiFtkitki{tkitkiBtkitkitki  You encounter a gnoll. It is wielding a +0 spear.tkiN` #.####.##..#.##.#. #............##.#. ######......##tki#.#. #####..########## #... #...........# #.## #..########.# #.# #...........# #.# #.....#####.###.#tkis^ #@...#.##.....#.# #...###.#.....#.# #..#####........# ##.#.#.#.#.....#.# ##..<....†........# .......j......##### j   gnoll (polearm, wandering)tkiE ##....#.#.###.# ##...........# ###.#.#.#####tkiQ3001.0 (34j.tkitki32.0 (35 _tki`tkiukin% .#.#  ....#  ...##  #####..## uki,& #...  #..########.# #.#  #...........# #.#  #.....#  #@...#  #...##  #..## uki'' ##.#.  ##..<....†  ......j.  ##....#.#  ##......   uki .#.#  ....#  ...##  #####..##  #...  uki#..########.# #.#  #...........# #.#  #.....#  #@...#  #...##  #..##  ##.#. ##..<....† ......j.  ##....#.# ukio##...... ukiukipukiuki\ _A gnoll is nearby!uki(  Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.uki 4uki" uki( _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ukiv ..........#####......# #####..########## #.. #...........# #.##..######## ...............#####.##....#.##.....###.#####.......##.#.#.#.#.....###..<....†.............j.......######....#.#.###.#  ##.......... ###.#.#.####uki] I #.....#uki .ukiu vj3.0 (1.0) _uki vkiÒ  Casting: Poisonous Vapours (safe; 6% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.vki^vki2`vkifvkil  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)vkia ###### #####..########## #.. #...........# #.########## ........#####.###.##.....vki4###.#####.......##.#.#.#.#.....###..<....†...........j....#....j   gnoll (polearm, wandering).#.....###.###vki1jvki/j.vki&Zj 2 gnolls (1 polearm, wandering)vki'?4Poisonous Vapoursvki&/vki7onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Poisonous Vapours (safe; 6% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You encounter a gnoll. It is wielding a +0 whip.vki I######......###.#. ludeguy the Sneak#####..########## #... Octopode#...........# #.## Health: 36/36 ========================#..########.# #.# Magic: 8/10===================-----#...........# #.# AC: 1Str: 8#.....#####.###.# EV: 12Int: 19#....#.##.....#.# SH: 0Dex: 12#...###.#.....#.# XL:  6 Next:  4% Place: Dungeon:3#@.#####........# Noise: ---------  Time: 3004.0 (0.0)vki ##*#.#.#.#.....#.# c) +0 dagger (protect)##..*....†........# Cast: Poisonous Vapours....j...j.....#######....#.#.###.###...........#jj 2 gnolls (1 polearm, 1 wandering, 1 w…)###.#.#.######.....####.###Aiming: Mercury Arrow (safe; 5% risk of failure)  vki Press: ? - help, Shift-Dir - straight lineAim: a gnoll, wielding a +0 spear (wandering, hasn't noticed you, chance to  vki weaken: 100%)  The glob of mercury hits the gnoll! The gnoll looks weaker.  The gnoll is severely wounded.vki; vki7 9j.vkiv 9j.vkiȊ x.<jeak)vki6 vkiZ C====5.0 (1vki2 vki   Press: ? - help, Shift-Dir - straight line  Aim: a gnoll, wielding a +0 spear (wandering, hasn't noticed you, chance to  weaken: 100%)  The glob of mercury hits the gnoll! The gnoll looks weaker.  The gnoll is severely wounded. _The gnoll shouts! x2; You hear a shout!wki€ ######......## #.#. ludeguy the Sneak #####..########## #... Octopode #...........# #.## Health: 36/36 ======================== #..########.# #.#  Magic: 7/10================-------- #...........# #.#  AC: 1Str: 8 #.....#####.###.#  EV: 12Int: 19 #....#.##.....#.#  SH: 0Dex: 12 #...###.#.....#.#  XL:  6 Next:  4% Place: Dungeon:3 #@.#####........#  Noise: ====-----  Time: 3005.0 (0.0) ##.#.#.#.#.....#.#  c) +0 dagger (protect) ##.j<.j..†........#  Cast: Poisonous Vapourski#H ..............#####  ##....#.#.###.#  ##...........#  jj 2 gnolls (1 polearm, 1 weak) ###.#.#.#####  #.....#  ###.### Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 spear (severely wounded, weak)  Poisonous fumes billow around the gnoll!jonfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 spear (severely wounded, weak)  Poisonous fumes billow around the gnoll!  The gnoll is poisoned.wki    #####..#  #...  #..########.# #.#  #...........# #.#  #.....#  #....#  #...#  #@.#  ##.#.#  †  .. ##....#.#.# wkiʊ##...........# j 3 gnolls (1 polearm, 1 poisoned, 1 w…) ###.#. #....   You encounter a gnoll. It is wielding a +0 club.wkiM`==--6.0 (1wkiwkiNV _The gnoll completely misses you.wki  ######......## #.#. ludeguy the Sneak #####..########## #... Octopode #...........# #.## Health: 36/36 ======================== #..########.# #.#  Magic: 6/10==============---------- #...........# #.#  AC: 1Str: 8 #.....#####.###.#  EV: 12Int: 19 wki #....#.##.....#.#  SH: 0Dex: 12 #...###.#.....#.#  XL:  6 Next:  4% Place: Dungeon:3 #@.#####........#  Noise: ==-------  Time: 3006.0 (0.0) ##.#.#.#.#.....#.#  c) +0 dagger (protect) ##.)<.j..†........#  Cast: Poisonous Vapours .........j....#####  ##....#.#.###.#  ##...........#  jjj 3 gnolls (1 polearm, 1 poisoned, 1 w…) ###.#.#.#####  #.....#  wkiS ###.### Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 spear (almost dead, poisoned, weak)  Poisonous fumes billow around the gnoll!  The gnoll looks even sicker.wkix j.j.   #####..#  #...  #..########.# #.#  #...........# #.#  #.....#  #....#  #...#  #@.#  ##.#j#  ..†  . ##....#.#.# ##...........#  2 gnolls ###.#. #.... 9-7.0 (1wkit wki MAiming: Poisonous Vapours (safe; 6% risk of failure)  Press: ? - help, Dir - move target: a gnoll, wielding a +0 spear (almost dead, poisoned, weak)  Poisonous fumes billow around the gnoll!  The gnoll looks even sicker. _You kill the gnoll!xkiI7 ######......## #.#. ludeguy the Sneak #####..########## #... Octopode #...........# #.## Health: 36/36 ======================== #..########.# #.#  Magic: 5/10============------------ #...........# #.#  AC: 1Str: 8 #.....#####.###.#  EV: 12Int: 19 #....#.##.....#.#  SH: 0Dex: 12 #...###.#.....#.#  XL:  6 Next:  9% Place: Dungeon:3 #@j#####........#  Noise: =--------  Time: 3007.0 (0.0) ##.#.#.#.#.....#.#  c) +0 dagger (protect) ##.)<....†........#  Cast: Poisonous Vapours .xki7I[m.......j.....#####  ##....#.#.###.#  ##...........#  jj 2 gnolls ###.#.#.#####  #.....#  ###.### Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 whip  Poisonous fumes billow around the gnoll!xki94j.xkiJ:kjonfirm with . or Enter, or press ? or * to list all spells.xki:hAiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 whip  Poisonous fumes billow around the gnoll!  The gnoll is poisoned.xki@CR   #####..#  #...  #..########.# #.#  #...........# #.#  #.....#  #....#  #...#  #@j#  ##.#.#  †  . xkiD_##....#.#.# ##...........# jjj 3 gnolls (1 wandering, 1 poisoned) ###.#. #.... 8.0 (1xkiHLxkiURp _You encounter a gnoll. It is wielding a +0 whip.xki6  ######......## #.#. ludeguy the Sneak #####..########## #... Octopode #...........# #.## Health: 36/36 ======================== #..########.# #.#  Magic: 4/10=========--------------- #...........# #.#  AC: 1Str: 8 #.....#####.###.#  EV: 12Int: 19 xkio `#....#.##.....#.#  SH: 0Dex: 12 #...###.#.....#.#  XL:  6 Next:  9% Place: Dungeon:3 #@j#####........#  Noise: =--------  Time: 3008.0 (0.0) ##.#.#.#.#.....#.#  c) +0 dagger (protect) xkid ~##.)<..j.†........#  Cast: Poisonous Vapours ..............#####  ##....#.#.###.#  ##...........#  jjj 3 gnolls (1 wandering, 1 poisoned) ###.#.#.#####  #.....#  ###.### Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 whip (poisoned)  You miscast Poisonous Vapours. Nothing appears to happen.xkiS .xki <   #####..#  #...  #..########.# #.#  #...........# #.#  #.....#  xkiӶ #....#  #...#  #@j#  ##.#.#  j†  j... ##....#.#.# ##...........# j   gnoll ( ###.#.xki[ Z #.... xki ZContam: 10% 9.0 (1xki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 whip (poisoned)  You miscast Poisonous Vapours. Nothing appears to happen. _The gnoll barely misses you.ykik  #####..########## #.. #...........# #.########## ........#####.###.##.....###.ykiHlj#####.......##@#.#.#.#.....###.)<...j÷.............j.......#######....#.#.###.# ##...........#jjj 3 gnolls (1 wandering, 1 poisoned)###.## #####.#yki~rx j.  The gnoll shouts!yki"s/j.ykiykijyki͊#ykiyki==yki6 10ykiyki ykiyki&2_The gnoll completely misses you.ykiZykiՓ #...........# #.####..########.# #.# #...........# #.# #.....#####.###.# #....#.##.....#.# #...###.#.....#.# #.j#####........# ##.#.#.#.#.....#.# ##.)@j.j.÷........# .................##### #####....#.#.###.#  .......##.#.#.##### #.....#  2 gnolls###.### ### #.# ..# #########.#ykiȕ/jykiF j.  The gnoll attacks as it pursues you! The gnoll misses you.yki.j 3 gnolls (1 poisoned)3----1yki#yki1 _The gnoll hits you with a +0 club.ykia _There is a stone staircase leading up here.yki\Z ykiZ 9--ykihb ykid 7j.yki.m yki0r c29-----2ykit yki ---.2. _The gnoll completely misses you. The gnoll hits you with a +0 whip.ykit-######.#.##### #.#.....# #....##.##### #.#.........# #.#...#.###.# ##############.#...#.# #.# yki]#............#.#.j.#.# #.# '............+..@j.#.# #.# #............#.#...#.# #.# #............#.#...#.# #.# #............#.#####.# #yki .# #............#.......# #.# yki/#.[..........#...##### #.# 2 ykiOK#............#.#.# #.# #ykip1............#.#.#######.# #............#....yki:...<.#.#ykiEm5===-3.5 (2.5yki7 _You climb upwards.yki c _There is a stone staircase leading down here.zkiŒ  You closely miss the gnoll. Your grab misses the gnoll.The gnoll is moderately wounded.zki\n25---=4.5 (1.0zkiSzkiy _The gnoll hits you with a +0 club. The gnoll completely misses you.zki )  You hit the gnoll.  Your weapon exudes an aura of protection.  Your grab misses the gnoll. You squeeze the gnoll!zki/    gnoll  You kill the gnoll!zkiɭ 0------=== 8 8% 135zkiB zkin 8 _The gnoll hits you with a +0 club.zkiԫ  You hit the gnoll. Your grab misses the gnoll.The gnoll is moderately wounded.zkiM @66zki zkiQ K _The gnoll misses you.{ki}  You hit the gnoll. You grab the gnoll.  {kiHThe gnoll is severely wounded.{ki@t16------47{ki;{kiQ _You constrict the gnoll. The gnoll hits you with a +0 club.{ki]4{ki{kin^ _You are too injured to fight recklessly!{ki1){ki{){ki0{kig2^ _You are too injured to fight recklessly!{ki {ki0 {ki {ki ^ _You are too injured to fight recklessly!|ki&G )  You hit the gnoll.|ki`/(|ki3x7=--278|kie3;Poisonous Vapours|ki9|ki@; |kih;4_You kill the gnoll!|ki=y _There is a stone staircase leading down, spattered with blood here.|ki(#####  #.#.#####  #.#.....#  #....##.#####  #.#.........#  |ki#.#...#.###.#  .#...#.# #.#  .#.#.).#.# #.#  .|ki(+..>@.#.# #.#  .|kiL#.#...#.# #.#  .|kin}#.#...#.# #.# |kiw .#.#####.# #.# |ki .#.# #.#  .[.#...##### #.#    .|ki?#.#.# #.#    |kia<.#.#.#.#  |ki=  .#.|ki<.#.#   |ki|kiF1-9 |kiC _|ki+|kiEM _You see here a +0 club.|ki +  Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.|ki& N-|ki |ki. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)}kic }ki }ki7 }ki W  You start resting.}ki }ki 20 _Your magical contamination has completely faded away.}kik6==8== 1 ==9=7==20=}kij1====}ki?$X}ki%*2=8===}ki*,}ki+}ki-}ki-}ki.}kit0}ki0=3=}ki14===}ki2}kin3}ki3}ki4}ki6}kiZ6}ki7}kir:B}ki{;}ki;^4==}ki<}ki>b9==}ki?}kiA}kiA}kiJB}kiC}kiC}kieF}ki*Ha5=}ki]I}kiJ}kiJ:==}kiFL}kiM,}kiN}kiP}kiFP}kiqQ}kiR}kiRN26=}kijT}ki@Wn _You start resting.Magic restored.}ki]}kic053.5 (33.0)}kidg10/10===4.5 (34 _}kij}ki4k~kiC #####  #.#.#####  #.#.....#  #....##.#####  #.#.........#  #.#...#.###.# #.#...#.# #.# #~ki.#.#.).#.# #.# '.+..@).#.# #.# #.#.#...#.# #.# ~ki#.#.#...#.# #.# #~kiA.#.#####.# #.# #.#.# #.# #.[~kih.#...##### #.# #.#.#.# #.# #.#.#.~kiܕv#.# #.#.<.#.#~kif~ki͝15.5 (1.0)~ki~kiZy _There is a stone staircase leading down, spattered with blood here.~ki/~ki~ki~~ki,~ki7==~kiQ===~ki&~kiv~ki~ki~kir~kiU8=~ki~ki?,~ki~ki$,~ki'~ki[,~ki~ki~kiK9=~ki4~ki~ki~ki~ki,~ki~~ki~ki~ki~ki~kiIi30==~ki~kih,~ki~ki,~ki~ki,~ki~kik1=~ki ~ki,~ki~ki~ki7~ki~ki,~ki, ~kis ~ki K2=~ki ~kiO ,~ki8 ~ki ~ki ~ki ~ki: ~kit ~kii ~ki ~ki h3==~ki> ~ki ,~ki ~ki- ~kic ~ki9 ~ki ~ki #4~ki 2=~ki ~ki ,~ki ~ki ~kiB ~ki`' 5=~ki( ~ki + k _You start resting.HP restored.~ki3 ~ki: 090.5 (35.0)~ki: R6==~ki; ,1.5 (36 _~kiCC kik`kib Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft16% 1b - Olgreb's Toxic RadianceAlchemy26% 4  c - Sigil of BindingHexes41% 3  d - Sticky FlameFire/AlchemykiZc52% 4 5 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitkikiki#####ludeguy the Sneak#.#.#####Octopode#.#.....#Health: 36/36 ========================#....##.#####Magic: 10/10 ========================#.#.........#AC: 1Str: 8#.#...#.###.#EV: 12kiInt: 19 ##############.#...#.# #.#SH: 0kiDex: 12 #............#.#.).#.# #.#ki,XL:  6 Next: 17% Place: Dungeon:2 '............+..@).#.# #.#kiM]Noise: ---------  Time: 3091.5 (0.0) #............#.#...#.# #.#c) +0 dagger (protect) kit#............#.#...#.# #.#Cast: Poisonous Vapours ki#............#.#####.# #.# #............#.......# #.# #.[..........#...##### #.# #............#.#.# #.# #............#.#.#######.# #............#.......<.#.# _Your magical contamination has completely faded away. _You start resting. _Magic restored. _There is a stone staircase leading down, spattered with blood here. ki+F_You start resting. _HP restored.kin  Okay, then.kiki. _ki Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Air5% 1 b - Mercury ArrowConjuration/Alchemy5%2  c - Mephitic CloudConjuration/Alchemy/Air 16%3 Select a spell to describe [?] help [!]/[I] toggle spell headerski ki/" kiJ* #####ludeguy the Sneak#.#.#####Octopode#.#.....#Health: 36/36 ========================#....##.#####Magic: 10/10 ========================ki* #.#.........#AC: 1Str: 8#.#...#.###.#EV: 12Int: 19 ##############.#...#.# #.#ki* YSH: 0Dex: 12 ki* &#............#.#.).#.# #.#XL:  6 Next: 17% Place: Dungeon:2 ki+ '............+..@).#.# #.#ki1+ Noise: ---------  Time: 3091.5 (0.0) #............#.#...#.# #.#kiQ+ c) +0 dagger (protect) #............#.#...#.# #.#ki+ ~Cast: Poisonous Vapours #............#.#####.# #.# #............#.......# #.# #.[..........#...##### #.# #............#.#.# #.# #............#.#.#######.# ki+ m#............#.......<.#.# _You start resting. ki, _Magic restored. _There is a stone staircase leading down, spattered with blood here. ki", L_You start resting. _HP restored. ki=, 6_Okay, then.ki2 ki43 ki.9 kix: ki;kikiki:ki22.5 (1 _kiki&3ki  #...........# #.### #..########.# #.# #...........# #.# #.....#####.###.# #....#.##.....#.# #...###.#.....#.# #..#####........# ##.#.#.#.#.....#.# ##.)@....÷........# .......j.........##### #####....#.#.###.# ##...........# ###.#.#.##### #.....# kij   gnoll ###.######.# ..# #########.#You climb downwards. The gnoll hits you with a +0 whip.kiQ0----=4.0 (2.5Poisonous VapourskiWkiXL _The gnoll closely misses you.kiZa _There is a stone staircase leading up here.ki+ki#...........# #.### ludeguy the Sneak#..########.# #.#Octopode#...........# #.#Health: 30/36 ====================----#.....#####.###.#Magic: 9/10=====================---#....#.##.....#.#AC: 1Str: 8#...###.#.....#.#EV: 12Int: 19#..#####........#SH: 0Dex: 12##.#.#.#.#.....#.#XL:  6 Next: 17% Place: Dungeon:3##.)@....÷........#Noise: =--------  Time: 3094.0 (0.0).......j.........#####c) +0 dagger (protect)#####....#.#.###.ki`#Cast: Poisonous Vapours##...........####.#.#.######.....#j   gnoll (poisoned)###.### ####.# ..##########.#Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 whip  Poisonous fumes billow around the gnoll!5.0 (1onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 whip  Poisonous fumes billow around the gnoll! _The gnoll is poisoned. The gnoll barely misses you.ki #...........# #.### ludeguy the Sneak#..########.# #.#Octopode#...........# #.#Health: 30/36 ====================----ki #.....#####.###.#Magic: 8/10===================-----#....#.##.....#.#AC: 1Str: 8#...###.#.....#.#EV: 12Int: 19#..#####........#SH: 0Dex: 12ki J##.#.#.#.#.....#.#XL:  6 Next: 17% Place: Dungeon:3ki) ##.)@....÷........#Noise: =--------  Time: 3095.0 (0.0)ki\ &.......j.........#####c) +0 dagger (protect)#####....#.#.###.#ki (Cast: Poisonous Vapours##...........####.#.#.#####ki #.....#j   gnoll (very poisoned)kiߖ [###.### ####.# ..#ki #########.#Casting: Poisonous Vapours (safe; 5% risk of failure)  ki& MConfirm with . or Enter, or press ? or * to list all spells.kiG Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetkig Aim: a gnoll, wielding a +0 whip (lightly wounded, poisoned)  Poisonous fumes billow around the gnoll!kiq $27ki 7--6.0 (1ki ki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 whip (lightly wounded, poisoned)  Poisonous fumes billow around the gnoll! _The gnoll looks even sicker. The gnoll hits you with a +0 whip.ki #...........# #.### ludeguy the Sneak#..########.# #.#Octopode#...........# #.#Health: 27/36 ==================------#.....#####.###.#Magic: 7/10================--------#....#.##.....#.#AC: 1Str: 8#...###.#.....#.#EV: 12Int: 19#..#####........#SH: 0Dex: 12##.#.#.#.#.....#.#XL:  6 Next: 17% Place: Dungeon:3##.)@....÷........#Noise: =--------  Time: 3096.0 (0.0).......j.........#####c) +0 dagger (protect)#####....#.#ki 0.###.#Cast: Poisonous Vapours##...........####.#.#.######.....#j   gnoll (very poisoned)###.### ####.# ..##########.# _The gnoll looks even sicker. The gnoll hits you with a +0 whip.  Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 whip (moderately wounded, very poisoned)Contam: 10% 7.0 (1ki ki =MCasting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.  Aim  kiC >Press: ? - help, Dir - move target: a gnoll, wielding a +0 whip (moderately wounded, very poisoned) _You miscast Poisonous Vapours. Nothing appears to happen. The gnoll misses you.kin ki]#...........# #.### ludeguy the Sneak#..########.# #.#Octopode#...........# #.#Health: 27/36 ==================------#.....#####.###.#kie~Magic: 6/10==============----------#....#.##.....#.#AC: 1Str: 8#...###.#.....#.#EV: 12Int: 19 Contam: 10% #..#####........#SH: 0Dex: 12kiJ##.#.#.#.#.....#.#XL:  6 Next: 17% Place: Dungeon:3ki\##.)@....÷........#Noise: =--------  Time: 3097.0 (0.0).......j.........#####kic) +0 dagger (protect)#####....#.#.###.#Cast: Poisonous VapourskiL##...........####.#.#.######.....#j   gnoll (very poisoned)kim###.### ####.# ..##########.#kiCasting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiAiming: Poisonous Vapours (safe; 5% risk of failure)  kiPress: ? - help, Dir - move targetAim: a gnoll, wielding a +0 whip (heavily wounded, very poisoned)  Poisonous fumes billow around the gnoll!ki +8.0 (1kikkio _The gnoll looks even sicker. The gnoll barely misses you.kibY4kiNgki g 4kik kil ki Poisonous fumes billow around the gnoll! _The gnoll looks even sicker. The gnoll barely misses you.You hit the gnoll.  Your weapon exudes an aura of protection.  Your grab misses the gnoll. Your squeeze misses the gnoll.  The gnoll is almost dead.ki25-- 8 9kiki8 _The gnoll hits you with a +0 whip.ki' kiB)You hit the gnoll.ki])kil22100Poisonous VapourskikiB _You kill the gnoll!kiEa _There is a stone staircase leading up here.ki% < ######## ........#####.###.##.....###.#####.......##.#.#.#.#.....######.)<....÷..............@.........#########....#.#.###.#  ##..........#.#.#.###.# #.###.........#ki ki: 5-1 _ki ki $  Things that are here:ki o _a +0 whip; a gnoll corpseki yM........##########......# .#####.##.#.#.###.#.....# #..#####....... ##.#.#.#.#.....######.)@....÷........kim.......).........##########....#.#.#####...........##.#.#.###.#kikikiD87==kij.-2 _kikia _There is a stone staircase leading up here.ki4qkiqkiskiukixo26=-ki?zkizkizS 1 8% ki0|ki~ki 76kiekikiڂ$==ki04kiPkiki%7kiW==2kikiki71ki\kiʏW _You start resting.ki`ki +9.0 (7kiڛ(ki(kiK _Your magical contamination has completely faded away.ki~ ki ki/ ki ki 8=8===ki ki kiҋ ki ki ,ki- ki+ Bki kiB i9====ki ki 30==9==ki ,kih kiv ,ki ki ki ?1=ki ki kiE kit ki 3==ki ki ,kiC ki ,ki ki ki9 K2=ki ki n _You start resting.Magic restored.kis ki 026.0 (17.0)ki? g10/10===7.0 (18 _kiT ki- kil ki ki ki Xkif ki kiM ki #3ki E==ki kikiD;===kiki,kiLkiMki}ki ki kiU U4=ki kiakiki8ki*ki[kimkikikiskiki55=ki9kiki,ki_ ki"ki.#ki$ki$'ki'ki[)ki+ki,ki$,a6==kik-ki11 _HP restored.ki3ki3ki5ki08ki:ki;ki`<ki?ki@ki%Aki BkiODkiR #..########.#  #...........# # #.....#####.### #....#.##.....# #...###.#.....# ### #..#####....... ... ##.#.#.#.#.....# ############.)<....÷.......(......@...).##45#########....#.#.###. ##...........# ### ###.#.#.##### ... #..... ### ###.######### #.#  #....##########.#  #.##.## #.........#kiUkiwV#=kiV%6.0 (19ki+hkik- _Found 4 poisoned darts.ki 3ki kiGki9kiKBkikikikikikikikiki(,kiki kif",ki#ki$ki%ki%ki&ki+'ki9(kid(ki(ki,C  You see here 4 poisoned darts.ki-ki.. _ki.ki 0kip0ki0kiD1ki3ki4ki-5ki5ki=7ki8  You encounter a goblin. It is wielding a +0 dagger.ki>= #####..##.##......# #.#. # #..... ###g. .# #..... ...###. #....# #.#... #...# #.########## #.# #..### ki=X....†....... #@# ##.#.#. #.########## #.##########.)<... #.##..(..........)... #.############....#. #.# ##..... ..########## ###.#. g   goblin (asleep) ....†....... #... #.#############. ki=~#.# ###### #.kiE,50kiF37.0 (11 _kikLki)Qki! .# .#  #. #  g. .#  .###.  ...  #.# † #@# ki% #.#)< #..(..........) ####†kiK. ki! .# .#  #. #  g. .#  .###.  ...  #.# † #@#  #.#)< #..(..........) ####† ki4kiki] _A goblin is nearby!ki######......## .# #####..###.# ....# ### ###. ##..g. .#. .#..###.#. #.....#. #.########## #..### ....†....... #.# ##.#.########## #.##########.)<..(..........)..kiO############....# #.# ##....#############.# ....†.........######### ##kiIkiƠT8.0 (1.0)Poisonous Vapours _ki^ki 9 ######......##  ludeguy the Sneak .# #####..### Octopode .##..... Health: 36/36 ======================== .# #..### Magic: 8/10===================----- ###. # #..... AC: 1Str: 8 ### ..). .# #..... EV: 12Int: 19 kif..# #..###.# #....# SH: 0Dex: 12 #.# #.....# #...## XL:  6 Next: 22% Place: Dungeon:3 #.########## #@# #..### Noise: ---------  Time: 3158.0 (0.0) ki....†....... #.# ##.#.#. c) +0 dagger (protect) ki#.########## #.##########.)<... Cast: Poisonous Vapours #.# #..(..........)... #.# ############....#. #.###..... g   goblin (asleep) ..##########kiA,###.#. ....†.......#... #.#############.Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kis[Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a goblin, wielding a +0 dagger (asleep, chance to weaken: 100%)  The glob of mercury hits the goblin! The goblin looks weaker.ki{   .#  .# .#  ###. #  ..). .#  #.*###.#  #..*..# kid #@# † #.#  )< #..(kie) ki/p †kiRT  kiqki&..kio==9.0 (1Poisonous Vapourskilkionfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  kiɌDPress: ? - help, Shift-Dir - straight line  Aim: a goblin, wielding a +0 dagger (asleep, chance to weaken: 100%)  The glob of mercury hits the goblin! The goblin looks weaker. _You kill the goblin!kiki%ki=XkiBkiki(ki=kikiWkiki,kikikikikikikikiQkiE9==kikikiakikikiD ki :==ki ki ki kikikiki,kikikikiki6Q10/10===ki kiE$ki%(kig(ki)kiz,ki&2Xki?4ki4ki5ki^8kiC;ki^===## ######......# .# # #####.. .###. # .#.. ## #.. ####..# .# ### ...).# .# #..# #..###.# #... ###.# #.....# #... ###.###.@#.## #..--..†..........#.# # ###.###########?##.##.)<  #.##. #..(..)  #.##. ###... ###.##. ##..#kiIa##. ## ##....†......... #  ##.## ##80.0 (21.0)--1.0 (22ki3bki,h6 _g - an amulet of guardian spiritkiP3kinQkiTkinWki[,ki,\ki(_ki`_ki`kil # .###. #.. # .#.. ## #.. #####..# .# # ######...).# .#kil #.. .....# #..###.# #.#kilv #.... # ki!m####.###########..#.## # kiBm.......†..........#.##.##.kigmU##@##.##########.)< kimX# #.# #.##..(..........) #.# #.##kiTn#.. ####.# #.# ##. .....###########.# ###...†.........# #  ##.#### #  #.# ######  #.# #....#ki~n #####kinXl - a scroll labelled OGGU BAMAEC FAUNkiw13.0 (2.0)kix+4.0 (3kiG _You see here a +0 falchion.ki-J 3kiJ kiM kikP kiP kiXU ,kiV kiV kiX ki)Z ki\ ki\ ki] ki[` kid  You encounter a goblin. It is wielding a +0 club.ki(k  #.####.##..# #......... ########.... # # #. #### # .###.#  kivk .#.. ## # ..# .# ###### .g.....).# .# #.. .....# #@.###.# #.. #kik ##.....# #.. ####.###########..#.## # .......†..........#.## ####)##.##########.)<kil b #.# #.##..(..........) g   goblin (asleep) # #.# #.#############... ### #.# ki5l y##.. .....###########.#  ki &7ki9 )8.0 (4 ki_ _ki kiД kiM  Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kikikiki" ki"_You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki: c.. #.# #.## .# #.####.## .# #.... .### ########... .## #.# ##### .#.###.### # .# .#....## # .# #.######..# .# # .ki ###### #.g....@).# .# # ......# ########..###.# # .####.# #.....# # .####.###########..#.## #. ki ........†..........#.# ##. .####.###########)##.##########.) .# #.# #.##..(....... .# #.#ki  #.########### .####.# #.#.ki kiw 29.0 (1 _kiX ki ki .. #.# #.##.  .# #.####.## #.# # #.# ## ######## #.#kiȒ .# #.# ##### ..# .###.### # ki<.# .#....## # .ki.# #.######..# .#ki2( # .kit%.###### #.g...@.).# .# #.# kiy#..###.# # ..####.#kiM #.....#kiԓm # ..####.#..#.##ki) #kiD.†...#.#kiIk ## #.####.#)##.kil#. #.# #.# #.##..( ki#.# #.# #.# #.####.#kiʔl #.# ##kikil'90kiki-ki ..#.# #.##. ludeguy the Sneak  .##.####.##. Octopode #.##......... Health: 36/36 ======================== ki3#.# ## ########.... Magic: 8/10===================----- #.# .# #.# ##### AC: 1Str: 8 ..# .###.### # EV: 12kiInt: 19 <.#.#....## # SH: 0Dex: 12 ..# #.######..# .# # XL:  6 Next: 22% Place: Dungeon:3 ..###### #.)...@.).# .# # Noise: ---------  Time: 3190.0 (0.0) ki.......# ########..###.# # c) +0 dagger (protect) ki..####.# #.....# # Cast: Poisonous Vapours ..####.###########..#.## # ki).........†..........#.# ## ki #.####.###########)##.##########. g   goblin (asleep) #.# #.# #.##..(......... kiCO#.# #.# #.#############. #.####.# #.# ##kigCasting: Mercury Arrow (safe; 5% risk of failure)  kiMConfirm with . or Enter, or press ? or * to list all spells.kiAiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight linekiAim: a goblin, wielding a +0 club (asleep, chance to weaken: 100%)  The glob of mercury hits the goblin! The goblin looks weaker.ki  ..#.#  .#ki ~ ## ## .# #.#  .###.### <.#ki .#....##  #. .#  #.)***@.).# .# ki  ##  #.....# .## ki †# )ki;  #.# (  #.# ki{   #.#  kiV...ki<3==1.0 (1kipkivonfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a goblin, wielding a +0 club (asleep, chance to weaken: 100%)  The glob of mercury hits the goblin! The goblin looks weaker. _You kill the goblin!kiq  Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiZ ki[ kieb kid  kid _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki?# .. #.# #.## # .# #.####.## ##.# # ##.# ## ## ##.# .# #.# .# .###.### #<.# .#....## #..# #.######..# .# #..###### #.)..@..).# .# .# #..###.# #..####.# #.....# #..####.#..#.# #.†.#.# #.####.#)##.#  #.# #.# #.##..(  #.# #.# #.#  ki@d#.####.# #.# kiCkirE6--2 _kiJkiLkis3kikiBkikijki/ki,ki@kikikiki ,ki*ki kibL9==kikiCkikiki>kikiki',ki%kiCki:==kiki0kikikikiki ki%kickikikiikiki ki. Q10/10===kit kiki,kikiki,kikiki,kikikiki%===kikikiy!ki"ki"kiG#ki$ki%ki&ki&kii(ki*,ki++ki .ki9 #.......###... #. #.#####.###.. #. #.## ###) #.# #.##.##.# ... #.# #.##.##< #.. #.# #.##.##.# #.. #.####.##..#.# ki:v#.## #............# ## #@########......##--214.0 (22.0) #.# ##.# #####..## #.###.### #.... #.#....## kiF: #..## #.######..###.# #....ki:## #.).....).# .# #.... ...# ########..###.# # ##.# #.....# #... ########..#.## #..#kiBkiC,5.0 (23kiRIkiJ* _Found a short sword.kiu0ki0ki1ki4ki<: #######.....# #.[ #.......###.. #.# #.#####.###..ki<5 #.# #.# #.......###)# #.# #.##.##. ...# #.# #.##.##< #..# #.# #.##.##.ki=.# #.####.##..#. #@## #....ki3=?..0.0) #kiW=#######...... ##.# #####..###.##ki=` #... #.#....##ki= #..# #.######..###.# # ki>##### #.).....).# .# # ....# ########..###.# #...#.# #.....# #...kiEkiGJ+6.0 (1kiufki nI _Found a chain mail.kiٝ kiV ki3 kiޣ ki& kiլ Bki ,ki ki" ki ki= ki kiۼ kit ki˿ ki ki> ki ,ki ki ki kiq kiR ki ki ,ki ki ki kiq kio ki2 kii ki ki] ki ki& kim ki ki ki k  You encounter a ball python.ki ki  ki ##ki  kiI #...ki a ### #######...ki  #.[ #.......###kiM x #.# #.#####.#ki  #.# #.# #......ki .#######)# #.# #.##.## ki #ki? ....S....# #.# #.##.## kip .ki v.# #.# #.##.## ki #kiY w ##..# #.####.## ki #ki  ##.#.## #...........ki% 0Poisonous Vapours kiZ #ki _#.###.########... ki #ki& #.## ##.# #####.. ki\ #ki T ##.###.##ki ' #kiX wS   ball python (constriction, asleep) #ki ; ##.#....##ki $ #..ki  kiB F# #.######..###.#ki{ $ #..ki ki ### #.).....).# .#ki $ #..ki !ki /20.0)ki 37.0 (11 _kiX$ ki% ki  ##...# ludeguy the Sneak #..... Octopode ### #######..... Health: 36/36 ======================== #.[ #.......###. Magic: 8/10===================----- #.# #.#####.###. AC: 1Str: 8 #.# #.# #...... EV: 12Int: 19 .#######)# #.# #.##.## SH: 0Dex: 12 # ....†....# #.# #.##.## XL:  6 Next: 23% Place: Dungeon:3 .#@.# #.# #.##.## Noise: ---------  Time: 3227.0 (0.0) kin !# ##..# #.####.##..# c) +0 dagger (protect) # ##.#.## #........... Cast: Poisonous Vapours # ##.###.########...... # #.## ##.# #####.. # ##.###.### #.. S   ball python (constriction, asleep) # ##.#....## #.. # #.######..###.# #.. ###### #.).....).# .# #..Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a ball python (asleep, chance to weaken: 100%)  The glob of mercury hits the ball python!  The ball python looks weaker.ki  ###  #.[  #.#  #.# #.#  .## #.#  ....†**..# #.# #@.# #.# ki  ##..#     #.## ##.#  ##.###.###  #    #    #.).....).# .#  kif ..kif o==8.0 (1Poisonous Vapourski kiy   Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a ball python (asleep, chance to weaken: 100%)  The glob of mercury hits the ball python!ball python looks weaker. _You kill the ball python!ki  Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kizki{ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiI kiJ kiK kilN ki>O $ _kiS ,kiZT kiAU kiX ,kiX ki[ ki7\ kie] kip_ ki_ ki?a ki/d kid kie kig kih L9==kiWi kipk kik kim ki2o kio kip kir ki:s ki$t kiEv kiv :==kiw kiYz kiz kio{ kiz} ki} ki~ ki kii kiQ kiP ki Q10/10===ki͆ ki ki kib ki ki ki ,ki ki ki ,ki ki kii ki ;===kiX ki g  You see here a ball python corpse.ki/ kiݦ  _ki# ki- ki, ki ki ki ki kiF ki ki ki ki] ki ki ki ki" ki ki ,ki kiY N _e - 4 potions of enlightenment (gained 1)ki ki kiv ki8 ki ki kiz ki ki ki ki> ki ki ,ki> kik ki ,ki% kiG ki ,ki3 ki ki kiC kin ki ki ki ki4 kii kiN kiN ki ki ki kiz ki ki> ki ki ,kiq ki ki kiB ki ki ki8 kiz kiy ki ki ki ki ki ki ,ki ki kiw c  You encounter a bat.ki ....#....##.....#.# ....#....... #.#####.# ###.#... #.# #.# #.#... #.# #.# ki< ?#.##.# #.# #.# #.##.# #.# #.# ###.# # #.# #[# #.# ...# #b##.######. #.# #)###ki #...@....... ..#--.#####.######. ##. #.######.# #Poisonous Vapours.#ki #.....# ### ####### #.##.##### #.[ #.......# #.#ki! |#.# #.# #.#####.# b   bat (wandering) #.##.# #.# #.# #...ki5!  ..####.#######)# #.# #.##kio! ###.......†....# #.# #.##ki" /70.0 (42.0)ki+# .ki) Rki* l--1.0 (43Poisonous Vapourski* ki0 ki2 0 _The bat leaves your sight.ki 3ki ki ki kiٯ Bki e  A bat comes into view.ki  #....# .... ##.....#.#  #....# ....... #.#####.#  ####.#... ... #.# #.# #.#.. ... #.# #.# #.#.. #.# #.# #.# #.##b #.# #.# #.#  ###.# #. #.# #[# #.#  #...# #.##.######. #.#  #)### #.@......... ..  #.# ####.######. #  #.# #####.# #Poisonous Vapours  #.# #.....#i 49m ### #######  #.# #.##### #.[ #......  #.# #.# #.# #.##### b   bat (wandering) ###.# #.# #.# #.# #. #†..# ####.#######)# #.# #..##.......†....# #.# #..b2.0 (1.0)b..ki Rki f3.0 (2Poisonous Vapourskib kid 0 _The bat leaves your sight.kiki-kiki}kiOe  A bat comes into view.ki #....# .... ##.....#. #....# ....... #.#####. ####.# ....... #.# #. #.# ...... #.# #. #.# ..b#.# #.# #. #.# #.##.# #.# #. ###.# #.##.# #[# #.kis^ #...# #.##.######. #. #)### #@... .. #.# ####.######.  #.# #####.#  #.# #.....# ###  #.# #.##### #.[ # #.# #.# #.# #.kiAb   bat (wandering)  ###.# #.# #.# #.# # ki #†..# ####.#)# #.# #  #.ki#.†....# #.# #kiDb.0kiV5b.ki=.bkiXki24.0 (1 _ki)ki2ki  ....   .......   ...b... #.#  #.# ...... #.#  #.# ...#.# #.#  #.# #.##.# #.# kiu, ###.# #.##.# #[#  #...# #.##.######.  #)### #@..........  #.# ####.######.  #.#   #.#  ###  #.#  #.[  #.# #.# #.# kiJ ###.# #.# #.# #.#  #†..# )# #.# ki5 †....# #.# ki$   ....   .......   ...b... #.#  #.# ...... #.#  #.# ...#.# #.#  #.# #.##.# #.# ki % ( ###.# #.##.# #[#  #...# #.##.######.  #)### #@..........  #.# ####.######.  #.#   #.# ki%% , ### ki;% s #.#  #.[ kih% #.# #.# #.# ki% ###.# #.# #.# #.#  #†..# ki% b)# #.#  ki% `†....# #.# kiz- ki- ki3 ki4 Z _A bat is nearby!ki]K   ....   .......   ...b... #.#  #.# ...... #.#  #.# ...#.# #.#  #.# #.##.# #.#  ###.# #.##.# #[# kiK C #...# #.##.######.  #)### #@..........  #.# ####.######.  #.#   #.#  ###  #.#  #.[  #.# #.# #.#  ###.# #.# #.# #.#  #†..# kiK D)# #.#  †....# #.# kiA   ....   .......   ...b... #.#  #.# ...... #.#  #.# ...#.# #.#  #.# #.##.# #.#  ###.# #.##.# #[#  #...# #.##.######.  #)### #@..........  #.# ####.######.  #.#   #.#  ###  #.#  #.[  #.# #.# #.#  ###.# #.# #.# #.#  #†..# ki )# #.#  †....# #.# kiW ki ki. ki$ Z _A bat is nearby!ki.Jn##..########............## ##.............######...b....... .##kiJ#.# #[#...##.######. #)###........... .. ####.######.####.#....# ### ######kiJ#### #.[ #..... kiK####ki K #.# #.†..# ####.#######)ki>KkiM.ki@N)bkiN,b.kiZWkiWkiX&5 _kiW_ki`kiA#.## ........#### #.#..########............#### ##........#.......#######...b............ .## #[#...##.######. #)###........... .. ####.######.####.#....# ### ########## #.[ #..... #### #.# #.b..bb.6kiTki  Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki ki ki kio _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki. #.# #########.## ........#### #.#..########............#### ##........b...#ki/#######.......##.......#...# .## #[#...##.######. #)###........... .. ####.######.####.# ....# ### ########## #.[ #..... ##kih1ki1@.bkiu2/b.ki2I.bki9ki:@7Poisonous Vapours ki: _ki>@kiki, #.##..########......## ludeguy the Sneak##.## #.#................## Octopode#...## #.#..########........ Health: 36/36 ========================#....# .....#### ##.....#. Magic: 8/10===================-----#....# #.......# #.#####. AC: 1Str: 8####.# #..b....# #.# #. EV: 12Int: 19kid#.# #..*.... #.# #. SH: 0Dex: 12#.##.*.#.# #.# #. XL:  6 Next: 23% Place: Dungeon:3#.##@##.# #.# #. Noise: ---------  Time: 3277.0 (0.0)###.##.##.# #[# #. c) +0 dagger (protect)#...##.##.######. #. Cast: Poisonous Vapours#)####........... ..#.#####.######.#.######.#b   bat (weak)#.#ki8#.....# ### #######.##.##### #.[ #.....#.##.# #.# #.####kiCasting: Mercury Arrow (safe; 5% risk of failure)  kiConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  kiPress: ? - help, Shift-Dir - straight lineAim: a bat (wandering, hasn't noticed you, chance to weaken: 100%)  ki27The glob of mercury hits the bat. The bat looks weaker.kih[,.bki] .bki~donfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a bat (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the bat. The bat looks weaker.  The bat is heavily wounded.kie4==8.0 (1kiylkipnP _The bat barely misses you.ki; [ #.# #..########......## ludeguy the Sneak  ##.## #.#................## Octopode  #...## #.#..########........ Health: 36/36 ========================  #....# .....#### ##.....#. Magic: 7/10================--------  #....# #.......# #.#####. AC: 1Str: 8  ####.# #.......# #.# #. EV: 12Int: 19 #.# #....... #.# #. SH: 0ki Dex: 12 #.# #..b#.# #.# #. XL:  6 Next: 23% Place: Dungeon:3 #.# #@##.# #.# #. Noise: ==-------  Time: 3278.0 (0.0)  ###.# #.##.# #[# #. c) +0 dagger (protect)  #...# #.##.######. #. Cast: Poisonous Vapours  #)### #........... .. ki #.# ####.######.  #.# #####.#  b   bat (weak)  #.# #.....# ### ######  #.# #.##### #.[ #..... ki #.# #.# #.# #.####Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiM ]Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a bat (heavily wounded, weak)  Poisonous fumes billow around the bat! The bat is poisoned.ki b.ki~ z #.#  ##.## #.#...   #.#..##   .....####  ki2 V #.......#   #.# #.#  #.# # #.#  #.# #...#.# #.#  #.# #@##.# #.#  ###.# #.##.# #[#  #...# #.#  #)### #kij   #.# ###  #.#  ki poisoned, weak)  #.#  ###  #.# ki #.[  #.# #.# #.# ki 3-9.0 (1ki* kiQ onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: a bat (heavily wounded, weak)  ki Poisonous fumes billow around the bat! The bat is poisoned. _The bat closely misses you.kib #.# #..########......## ludeguy the Sneak  ##.## #.#................## Octopode  #...## #.#..########........ Health: 36/36 ========================  #....# .....#### ##.....#. Magic: 6/10==============----------  #....# #.......# #.#####. AC: 1Str: 8  ####.# #.......# #.# #. EV: 12Int: 19 #.# #....... #.# #. SH: 0Dex: 12 #.# #.b.#.# #.# #. XL:  6 Next: 23% Place: Dungeon:3 #.# #@##.# #.# #. Noise: =--------  Time: 3279.0 (0.0) ki ###.# #.##.# #[# #. c) +0 dagger (protect)  #...# #.##.######. #. Cast: Poisonous Vapours  #)### #........... ..  #.# ####.######.  #.# #####.#  b   bat (poisoned, weak)  #.# #.....# ### ######  #.# #.##### #.[ #.....  #.# #.# #.# #.#### _The bat closely misses you.Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a bat (heavily wounded, poisoned, weak)kiGMb.  Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aim  Press: ? - help, Dir - move target  Aim: a bat (heavily wounded, poisoned, weak)  You miscast Poisonous Vapours. Nothing appears to happen.kiH #.#  ##.## #.#...   #.#..##   .....####   #.......#   #ki.# #.#  #.# # #.#  #.# #...#.# #.#  #.# #@##.# #.#  ###.# #.##.# #[#  #...# #.#  #)### #  #.# ###  #.#   #.#  ###  #.#  #.[  #.# #.# #.# ki[Contam: 10% 80.0 (1kikiP _The bat barely misses you.kit  #.# #..########......## ludeguy the Sneak  ##.## #.#................## Octopode  #...## #.#..########........ Health: 36/36 ========================  #....# .....#### ##.....#. Magic: 5/10============------------  #....# #.......# #.#####. AC: 1Str: 8  ####.# #.......# #.# #. EV: 12Int: 19 Contam: 10%  #.# #....... #.# #. SH: 0Dex: 12 #.# #...#.# #.# #. XL:  6 Next: 23% Place: Dungeon:3 ki w#.# #@##.# #.# #. Noise: =--------  Time: 3280.0 (0.0)  ###.# #.##.# #[# #. c) +0 dagger (protect)  #...# #.##.######. #. Cast: Poisonous Vapours  #)### #........... ..  #.# ####.######.  #.# #####.#  b   bat (poisoned, weak)  #.# #.....# ### ######  #.# #.##### #.[ #.....  #.# #.# #.# #.####Casting: Poisonous Vapours (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiZ RAiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: a bat (heavily wounded, poisoned, weak)  Poisonous fumes billow around the bat!ki z #.#  ##.## #.#...   #.#..##   .....####  ki) q #.......#   #kiS .# #.#  #.# # #.# kiv  ki M#.# #...#.# #.#  #.# #@##.# #.# ki ' ###.# #.##.# #[#  #...# #.#ki   #)### # ki c #.# ### ki+ V #.#   kiM t #.#  ### kiq `   #.# ki V #.[   ki  #.# #.# #.#  ki+ f1.0 (1Poisonous Vapourski ki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: a bat (heavily wounded, poisoned, weak)  Poisonous fumes billow around the bat! _You kill the bat!kiN3kikinki8kiY,kikikikikid6==kikikiO8% kiM6kiki:M4kikikiT==2kikiki71kieki#kis'kikiw _Your magical contamination has completely faded away.kikikiN7==kikikikinkimkikikiki?kiki;ki}:==kiki?kivkikikiki6O8===kiki>kimkikikiFki|kiDkikiki ki ;===ki ki] ki ki( ki kiO ki kiki+kikikikiYkiPkiL9==kiRkiki[,kikiki}kikikiYkiki2:==kikiki kikikikickiki?kiki4kimQ10/10===kiki<ki ,ki!ki$ki%ki%kiF&ki)ki*ki\*kiq+kid-}===ki/,ki0ki1ki&8ki^9ki9ki#:ki.;ki;ki;ki=<ki<kik=ki=ki=ki?ki?ki@ki@kiBkiCkiDki'EkiFkiH,ki^IkitJkiK,kiLkiMki)OkiuOkirPkiRkiT,ki4VkiWkiRYkiYkiZki\ki_^ki^ki_kiakickicki?ekigki6ikiikiskiwkiy,kiUkiEki,Bki@kikiki=ki:kiC,kikikiki kiki1ki ki<kiki*kis,kikib  You see here a +0 chain mail.kikip _kiki*kinkikiki!ki,kikiC  You see here a +0 short sword.kiki  _kikiki,kikiki<,kiOkiKki(kikkikikikikiki5kikikikiki?kikiTkikim"vki$,ki&ki(ki(ki*ki,ki.ki.ki0ki(3ki4ki.5ki6kiq9ki;ki;ki?>kiRAkiC,kinEkiHkiJ,kiLkiOkiQ,ki}SkiUkiWki*XkiYkiE\kid^,ki|`kiskiItkiu,kivkixkiz,kizki~d  You see here an adder skeleton.kim5 _ki ki,kiEkiyki]kiokikikiŊkiki",kikiokiTkiki4kiՓkipkikiFkiʖki>ki~kikixki,kiQkiSkikikiki۠ki١ki kiki]ki,ki{kilkiki(kikkiBkikiki'kikiakiki kiki3,ki֮ki$kiki4kiܱkikikikikiȶkiki&kikiMkiܻkikiNkiֿkikikiq _c - 3 potions of curing (gained 1)kikiDkikivki,ki&kikiOkiki#kikikikikiki,ki.kiOkiYkikirkiGkiki+kikikikilkiki    #.#  #.#  #.#  #.#  ###.#  #†..#  #.########   #.##### #.##.....   #...@.# #.##.#####- ki+z  #####.# #.##.#    #.# #.##.#    #.# #.##.#    #.# #....#    #.# ###<.#    #.# #..#    #.########..#####    #................You now have 182 gold pieces (gained 10).kiPn4020.0)-2ki 1ki ki^ _n - a bubbling amethyst potionki:3kikiki kidki,kikiki6 #.#ludeguy the Sneak #.#.#Octopode #.#.#Health: 36/36 ======================== #.#.#Magic: 10/10 ======================== #.ki8###.#AC: 1Str: 8 #@#†..#EV: 12Int: 19 #.#.###### SH: 0Dex: 12 #.##### #.##.... XL:  6 Next: 23% Place: Dungeon:3 #.@...# #.##.### Noise: ---------  Time: 3403.0 (1.0) #####.# #.##.#kiXec) +0 dagger (protect) #.# #.##.#Cast: Poisonous Vapours #.# #.##.# #.# #....# #.# ###<.#@   Terence (asleep) #.##..# #.########..### #.............. _You see here a +0 short sword. _You see here an adder skeleton. _c - 3 potions of curing (gained 1)  kiYou now have 182 gold pieces (gained 10). _n - a bubbling amethyst potionYou encounter Terence the Veteran. He is wielding a +0 hand axe.kit/  --more--ki4ki7Poisonous VapourskiFkia; 4.0 (2 _kikiCki #.#ludeguy the Sneak #.#.#Octopode #.#.#Health: 36/36 ======================== #.#.#Magic: 8/10===================----- #.###.#AC: 1Str: 8 #@#†..#EV: 12Int: 19 #*#.###### SH: 0Dex: 12 #*##### #.##.... XL:  6 Next: 23% Place: Dungeon:3 #.@...# #.##.### Noise: ---------  Time: 3404.0 (0.0) ki#####.# #.##.#c) +0 dagger (protect) #.# #.##.#Cast: Poisonous Vapours #.# #.##.# #.# #....# #.# ###<.#@   Terence (weak) #.##..# #.########..### #..............Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Terence, wielding a +0 hand axe and wearing a +0 scale mail (asleep,  chance to weaken: 100%)  The glob of mercury hits Terence! Terence looks weaker.  Terence is heavily wounded.ki[Q.@ki9fj.====5.0 (1kioki?r  Press: ? - help, Shift-Dir - straight line  Aim: Terence, wielding a +0 hand axe and wearing a +0 scale mail (asleep,  chance to weaken: 100%)  The glob of mercury hits Terence! Terence looks weaker.  Terence is heavily wounded. _Terence shouts!kiVK #.#  ludeguy the Sneak #. #.#  Octopode #. #.#  Health: 36/36 ======================== #. #.#  Magic: 7/10================-------- #. ###.#  AC: 1Str: 8 #. #†..#  EV: 12Int: 19 #. #.###### SH: 0Dex: 12 #@##### #.##.... XL:  6 Next: 23% Place: Dungeon:3 #.@...# #.##.### Noise: ====-----  Time: 3405.0 (0.0) #####.# #.##.#  c) +0 dagger (protect) #.# #.##.#  Cast: Poisonous Vapours #.# #.##.#  #.# #....#  #.# ###<.#  @iMm   Terence (weak) #.# #..#  #.########..### #..............Casting: Mercury Arrow (safe; 5% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move targetAim: Terence, wielding a +0 hand axe and wearing a +0 scale mail (heavilywounded, weak)#.#  #. #.#  #. #.#  #. #.#  #. ###.#  #. #†..#  #.  #@#####  #.@...#  #####.#   #.#   #.#  #.#  #.# ###<.# kizN[33mpoisoned, weak) #.#   kiN`=---6.0 (1kiTkiVSonfirm with . or Enter, or press ? or * to list all spells.ki,WRAiming: Poisonous Vapours (safe; 5% risk of failure)  Press: ? - help, Dir - move target  Aim: Terence, wielding a +0 hand axe and wearing a +0 scale mail (heavilykiUWpwounded, weak) _Poisonous fumes billow around Terence! Terence is poisoned.ki8  )You hit Terence but do no damage.Your weapon exudes an aura of protection.  You grab Terence. You squeeze Terence!  8 35---7Poisonous Vapours _You kill Terence! _Your Air Magic skill increases to level 1!kii  #.#  #.# #.#  #.# #.#  #.# #.#  #.# #.#  #.# ###.#  #.# #†..#   #.# #.#####  #@##### #.##...  #.....# #.##.## #####.# #.##.#   #.# #.##.#  #.# #.##.#  #.# #....#  #.# ###<.#  #.# #..#   #.########..##ki\kiP5-8 _ki.ki$  Things that are here:ki _a +0 hand axe; a +0 scale mail; the human corpse of Terenceki#%3ki%ki'kiC,y 1 _ki,ki.,ki/ki 1kin1O8===kiF2ki3ki3ki5ki6,kic7ki8kiL9kiy:ki;ki]<;===ki&=ki:?,ki|@ki{AkiAkiBkiD,kitEkiG,kiHkiIki*JL9==kiL,ki/Mki%NkigOkiOki|PkiQkiQki,X==ki;Z,kiZkih[ki\ki\ki]kiUb10/10===kickickidkifkiugkigkinhkijkik,kilkimkicokio;===kiCpkiqkirkiGskiQtkiukiv,kiwkimyki\zkizkiw{ki}ki~ki~ki}ki kikikiVkikifkiki3kikikiki*kiSkiӊ,kiPkidki΍,ki8kikiՏkikikikiےkikiki$kikikiqkikikiJkikiҜki,kikiikikikikikikikikikkikiϨkikiki<kikikikiگki'kikiҳ,ki ki>~ _e - 2 scrolls labelled TACSIO LOMUTI (gained 1)kikiSkikikii,kiBkikikiki]kiki,kieki+kiki,kikipkikikikikikikikiVkiki9ki&kikiekikiki,kikiki)kiskiki ki ki ki ki ki kiL ki ki kis ,ki@ ki ki ki3 ki ki ki Bki" ki@) ,kiU+ kiGR   Things that are here:  a +0 leather armour; a +0 short sword; a kobold skeleton _kiOX Bkik kiBr {  You see here an iguana skeleton.ki{ o _  Things that are here:ki t  4 stones; a +0 short sword _ki Xki ki΍ ki ki kiJ ki\ h  There is a stone staircase leading down here.ki  _kiߛ ki ki ,ki ki) kif ,ki ki ki ki kip kia kig ki ki͸ kiv ki ki ki ki ki ki ki ki ki ki ki ki ki ki ki ki ki ki ki ki+ kiw ki ki kiG ki ki ki kiz ki ki ki ki ki ki ki ki ki ki ki ki ki, ki ki ki ki0 ki kiC ki4 ki ki ki kiH ki ,ki ki ki kic kiv ki ,ki0 ki ki ki kiU ki kiy ki ki kiG ki ki kiQ kir ki ki` ki ki; ki kii ki ki ki ki ki{ ki ki kib ki kit ki^! ki! kir" ki$ ki% ki% ki`& kia          ###########    #.........#   ### #.#######.##  ..## #.######.#..##  .#.###.##....##.@.#  -51103.0) .##.##.##.###.#..##  ..........####.#.# .#..........##.#.# .#.###.####.##.#.# ...# #.# #.##.#.# ...# #.####.##>#.# ..## #.........#.# ki_c   ..#########......#  _Done exploring.ki 3ki kiz ,.............0.0). ......ki E _Done exploring.ki?3ki @ki#WkiWki[ki6]E _Done exploring.ki7kiÆ Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft16% 1b - Olgreb's Toxic RadianceAlchemy24% 4  c - Sigil of BindingHexes41% 3  d - Sticky FlameFire/Alchemy52% 4 5 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitkiog kin t  ludeguy the Sneak  Octopode  Health: 36/36 ========================  Magic: 10/10 ========================###########  AC: 1ki}o Str: 8#.........#  EV: 12Int: 19 ### #.#######.###  SH: 0Dex: 12 ..## #.######.#..##  XL:  6 Next: 35% Place: Dungeon:3 .#.###.##....##.@.#  Noise: ---------  Time: 3511.0 (0.0) kio .##.##.##.###.#..##  c) +0 dagger (protect) kio ..........####.#.#  Cast: Poisonous Vapours kip .#..........##.#.# .#.###.####.##.#.#ki;p  ...# #.# #.##.#.#kidp 8   kip ...# #.####.##>#.#   kip ..## #.........#.#   ..#########......# kiq  Things that are here: _4 stones; a +0 short sword ki#.#   ..## #.........#.#   ..#########......#   _Done exploring. _Done exploring. _Okay, then. _Done exploring. _Done exploring. ki0_Done exploring.kikikiki0ki kiv ki ki ki+ ki ki` E _Done exploring.kikikikikiki _kiHkikiZkiki9kiki?kikiki}kikiekikikiski>ki##### #.#######.### #...## #.######.#..## ...#.###.##....##...# ##.##.##.##.###.#..##ki ............####.#.# ##.#....##.#.# .#.#.###.####.##.#.# #....# #.# #.##.#.#ki# ....# #.####.##@#.# 7.0 (6...## #.........#.#ki?e #########......# .....# ######.#...#.# #.# #####.# #.# # #.# #.# ki# #.# #.# # #.# #.#kikidkic _There is a stone staircase leading down here.ki%DkiJ4kiMkiDQ28.0 (1 _kiRkiJ 4  You climb downwards.ki7 .o.  ...  .h.  #.#  #.#  #.#  #.#  #@#  kiQq#?#  #!#  #.# ..# ### o   orc (asleep) h   jackal (asleep) ki kiN-9.5 (2.5kiUki\ _You encounter a jackal and an orc.Found a scroll labelled MYGGURCHEWE and a potion of curing.kia _There is a stone staircase leading up here.ki ki zRead which item? Scrolls  a - a scroll of enchant armour  V - 2 scrolls of vulnerability  c - a scroll labelled MYGGURCHEWE  e - 2 scrolls labelled TACSIO LOMUTI  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedkikiki ludeguy the Sneak.o.Octopode...Health: 36/36 ========================.h.Magic: 10/10 ========================#.#AC: 1Str: 8#.#EV: 12Int: 19#.#SH: 0Dex: 12#.#XL:  6 Next: 35% Place: Dungeon:4#@#Noise: ---------  Time: 3519.5 (0.0)#?#c) +0 dagger (protect)#!#Cast: Poisonous Vapours#.#..####o   orc (asleep)h   jackal (asleep) _Done exploring. _There is a stone staircase leading down here.  You climb downwards. _You encounter a jackal and an orc.Found a scroll labelled MYGGURCHkiiEWE and a potion of curing. _There is a stone staircase leading up here.ki@P  Okay, then.kiki ki. _kiY  Casting: Poisonous Vapours (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiv 4ki kiD _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki <####.o..h.<?!#..###kiC ki9 320.5 (1 _kiѸ ki kiߝ  ludeguy the Sneak ####. Octopode .o. Health: 36/36 ======================== ...ki  Magic: 8/10===================----- ... AC: 1Str: 8 #.# EV: 12Int: 19 #.# SH: 0Dex: 12 #.# XL:  6 Next: 35% Place: Dungeon:4 #@# Noise: ---------  Time: 3520.5 (0.0) #<# c) +0 dagger (protect) #?#kiO Cast: Poisonous Vapours #!# #.# ..# o   orc (asleep) ### h   jackal (asleep)Casting: Poisonous Vapours (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a jackal (asleep, chance to weaken: 100%)  The glob of mercury hits the jackal. The jackal looks weaker.ki ####. .o. ... ki... #*# #*# #*# #@# #<# #?# ki#!# #.# ..# ### ki)honfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 5% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a jackal (asleep, chance to weaken: 100%)  The glob of mercury hits the jackal. The jackal looks weaker.  You kill the jackal!ki,P.oki4...oh   jackal (wandering)ki7<6==1.5 (1ki #........)# ....#########......#######..##ki͘K-7 _ki  Things that are here: _a +0 dagger; a +0 ring mailki<M######### #.........# #### #.### #...## #.######.#..# ...#.#...##... ##.##.##.##.###.#..## ....## ##.#......... .#.#.###.### # #.##).# #.####.##> ....## #........)#.#.#-8 _kiD ......... ##### #.#######.### #...##.#..## kiE...#.###.##....##... ##.##.###.#..# ............####.#.# ##.#.. .#.#.###.#### #....# #.# .###.##>## #........).# # #.##.#kiO6==9kiWkizW$  Things that are here:ki/]q _a +0 dagger; a +0 ring mailkim  ##### #.#######.### #...##.#..## ...#.###.##....##... ##.##.###.#..# ............####.#.# ##.#.. .#.#.###.#### #....# #.# #.##) .#### #........)#######.....######..## # #.##.#kir kis B 1 700 _kiz ki~ 1 _There is a stone staircase leading down here.  Things that are here: _a +0 dagger; a +0 ring mail  Things that are here: _a +0 dagger; a +0 ring mail _There is a stone staircase leading down here.kiOe 1 _ki#p ki* B=4ki S ####. ... ... ... #.# #o# #[# #.# #@# #.# #!# #.# ..# ### o   orc warrior (polearm)  Things that are here: _a +0 dagger; a +0 ring mail  Things that are here: _a +0 dagger; a +0 ring mailThere is a stone staircase leading down here.  You climb downwards.ki ` ####. ... ... ... #.# #o# #[# #.# #@# #.# #!# #.# ..# ### ki  .........#.##.##[##o##@##.##!##.#..####The orc warrior hits you with a +0 glaive! x2ki3 3/36 ----------------------===2.5 (2.5Poisonous Vapours _* * * LOW HITPOINT WARNING * * *kiI  kiS q_There is a stone staircase leading up, spattered with blood here.kikiډ Drink which item? Potions  c - 3 potions of curing  g - a potion of magicb - a potion of brilliance  ki#e - 4 potions of enlightenment  d - a pink potion  f - a sedimented cyan potion  j - a bubbling grey potion  k - a golden potion kij n - a bubbling amethyst potion [!] read|quaff|evoke[?] describe selectedkizkiukiج####.ludeguy the Sneak...Octopode...Health: 3/36kiV==----------------------...Magic: 10/10 ========================#.#AC: 1Str: 8ki:#.#EV: 12Int: 19ki_#[#SH: 0Dex: 12#o#kiXL:  6 Next: 53% Place: Dungeon:4#@#kiNoise: ===------  Time: 3702.5 (0.0)#.#c) +0 dagger (protect)kiέx#!#Cast: Poisonous Vapourskik#.#..####kiEo   orc warrior (polearm) _a +0 dagger; a +0 ring mail ki,_There is a stone staircase leading down here.  You climb downwards.  The orc warrior hits you with a +0 glaive! x2 _* * * LOW HITPOINT WARNING * * * _There is a stone staircase leading up, spattered with blood here.kiGP  Okay, then.kiki3ki . _kigRead which item? Scrolls  a - a scroll of enchant armour  V - 2 scrolls of vulnerability  c - 2 scrolls labelled MYGGURCHEWE  e - 2 scrolls labelled TACSIO LOMUTI  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedkiʸki0ki####.ludeguy the Sneak...Octopode...Health: 3/36ki0==----------------------...Magic: 10/10 ========================#.#kiZAC: 1Str: 8#.#kiyEV: 12Int: 19#[#kiSH: 0Dex: 12#o#kiXL:  6 Next: 53% Place: Dungeon:4#@#ki<Noise: ===------  Time: 3702.5 (0.0)#.#c) +0 dagger (protect)#!#Cast: Poisonous Vapours#.#ki..####o   orc warrior (polearm) _There is a stone staircase leading down here.  kiYou climb downwards.  The orc warrior hits you with a +0 glaive! x2 _* * * LOW HITPOINT WARNING * * * ki_There is a stone staircase leading up, spattered with blood here. _Okay, then.ki%  ki+Okay, then.kikiki. _kiԭ Quiver which action? ([-] to clear) Items ([,] to cycle)  e - Zap: wand of paralysis (3) Spells ([,] to cycle)Cast: Poisonous VapoursCast: Mercury Arrow [*/%] inventory [&] all spells[!] focus mode: off|onki kim ####.ludeguy the Sneak...Octopode...Health: 3/36==----------------------...Magic: 10/10 ========================#.#AC: 1Str: 8#.#EV: 12Int: 19#[#SH: 0Dex: 12#o#XL:  6 Next: 53% Place: Dungeon:4#@#Noise: ===------  Time: 3702.5 (0.0)#.#c) +0 dagger (protect)#!#Zap: wand of paralysis (3)#.#..####o   orc warrior (polearm)You climb downwards.  The orc warrior hits you with a +0 glaive! x2 _* * * LOW HITPOINT WARNING * * * _There is a stone staircase leading up, spattered with blood here. _Okay, then. _Okay, then.i; 1;76Hki ki ki\ ####. ludeguy the Sneak ...ki" Octopode ... Health: 3/36==---------------------- kî... Magic: 10/10 ======================== ki#.# AC: 1Str: 8kiR #.#ki0 EV: 12Int: 19 kiN~#[# SH: 0kiktDex: 12 #o#ki XL:  6 Next: 53% Place: Dungeon:4 ki#@# Noise: ===------  Time: 3702.5 (0.0)ki #.# c) +0 dagger (protect)kikx #!# Zap: wand of paralysis (3) #.# ..# ###ki o   orc warrior (polearm)ki0 _Okay, then.ki΄3Aiming: ParalysekiPress: ? - help, Q - select action, ( or ) - cycleShift-Dir - straight linekiAim: an orc warrior, wielding a +0 glaive and wearing a +0 chain mail (chance  to affect: 49%)ki1 ####.ludeguy the Sneak...Octopode...Health: 3/36==----------------------...Magic: 10/10 ========================ki~ #.#AC: 1Str: 8#.#EV: 12Int: 19#[#SH: 0Dex: 12ki #*#XL:  6 Next: 53% Place: Dungeon:4#@#kiΨ Noise: ===------  Time: 3702.5 (0.0)#.#c) +0 dagger (protect)ki #!#Zap: wand of paralysis (3)#.#ki 6..####ki; o   orc warrior (polearm) _Okay, then.ki\ 3Aiming: Paralyseki} Press: ? - help, Q - select action, ( or ) - cycleShift-Dir - straight lineki yAim: an orc warrior, wielding a +0 glaive and wearing a +0 chain mail (chance  to affect: 49%)ki ki o  Aiming: ParalysePress: ? - help, Q - select action, ( or ) - cycleShift-Dir - straight line  kim Aim: an orc warrior, wielding a +0 glaive and wearing a +0 chain mail (chance  to affect: 49%)  The orc warrior resists with some effort.ki K43.5 (12ki ki Q _The orc warrior misses you.ki ####. ludeguy the Sneak ... Octopode ... Health: 4/36==---------------------- ... Magic: 10/10 ======================== #.# AC: 1Str: 8 #.# EV: 12Int: 19 #[# SH: 0kiDex: 12 #o# XL:  6 Next: 53% Place: Dungeon:4 #@# Noise: ===------  Time: 3703.5 (0.0) ki#.# c) +0 dagger (protect) kiP#!# Zap: wand of paralysis (2) #.# ki..# ### o   orc warrior (polearm)kiq _The orc warrior misses you.ki=Aiming: ParalysekiuPress: ? - help, Q - select action, ( or ) - cycleShift-Dir - straight lineAim: an orc warrior, wielding a +0 glaive and wearing a +0 chain mail (chance  to affect: 49%)kie####.ludeguy the Sneak...Octopode...Health: 4/36==----------------------...Magic: 10/10 ========================#.#AC: 1Str: 8#.#EV: 12Int: 19#[#SH: 0Dex: 12#*#ki*fXL:  6 Next: 53% Place: Dungeon:4#@#Noise: ===------  Time: 3703.5 (0.0)#.#c) +0 dagger (protect)#!#Zap: wand of paralysis (2)#.#..####o   orc warrior (polearm) _The orc warrior misses you.Aiming: ParalysekiXfnPress: ? - help, Q - select action, ( or ) - cycleShift-Dir - straight lineAim: an orc warrior, wielding a +0 glaive and wearing a +0 chain mail (chance  to affect: 49%)ki:Yo, paralysed)ki>MoAiming: Paralyse  Press: ? - help, Q - select action, ( or ) - cycleShift-Dir - straight lineAim: an orc warrior, wielding a +0 glaive and wearing a +0 chain mail (chance  to affect: 49%)  The orc warrior becomes paralysed!ki24.5 (11 ki _kiPki6kiS # _The orc warrior becomes paralysed!  The helpless orc warrior fails to defend itself.  You puncture the orc warrior!  Your weapon exudes an aura of protection.  You grab the orc warrior. ki N The orc warrior is heavily wounded.ki W 8 ---5ki ki9 4 _You constrict the orc warrior.ki )The helpless orc warrior fails to defend itself.  You puncture the orc warrior!ki.1  398---6 _You kill the orc warrior!Your Stealth skill increases to level 5!ki88ki:\  Your Conjurations skill increases to level 3!ki= ki&=i_There is a stone staircase leading up, spattered with blood here.ki &M####.....[#<#.#!#kiPki,35=kiW&7 _kiqki$  Things that are here:ki _a +0 glaive; a +0 chain mail; an orc corpseki]  ####. ... #.#[)ki^ k#.#!kiq kir -8 _kiy kik| w _There is a stone staircase leading up, spattered with blood here.ki@ 4ki ki ki C9 _ki vB=3ki|##### #.#######.### #...## #.######.#..## ...#.###.##....##...# ##.##.##.##.###.#..## ............####.#.# ##.#..........##.#.# .#.#.###.####.##.#.# #....# #.# #.##[#.# .....# #.####.##@#.# ....## #........[#.# ....#########......# ki }......# ######.# ....#.# #.# #####.# #.# ki0}# #.##.# # #.##.# # #.#kiP}!#.#kim6= 1 11.0 (2.5kiki! _You climb upwards.kic _There is a stone staircase leading down here.ki3kikiki@nkikikikkikiDS7=kitkiBki$ki]kiKkikikikiTkiI8=kiki,kiki kiIkiki-kilf9==kiYki ,kikikiTki}kikikikiKkim10/36=kikikiHki+kikikikiki:kiFki_1=ki{ki,kikiki1ki/kiykikikiki0f2==ki-ki ,ki ki ki ki ki8 kic ki ki kiI S3=kib ki ki ki kiP ki kie ki ,ki kih ki I4=ki ki+ ,ki5 ki ,ki! ki5# kic# kiP$ ki% ki% _15==ki(' ki( ,ki* kiw, BkiT- ki- K6=ki. ki/ ki/0 ki 1 kiU2 ki2 ki3 ki4 ki5 ki*6 kiQ7 ki7 S7=ki9 ki\: ki: ki; kiA kiB kiB ^8==kiC ki,E kiE kixF kiG kiH kiCI kiJ ,kiK ki}M a9=kiO kiO kiP kiP kiR ,kiS ki.U kiVU kiFV kiW ki X T20=kiY kikZ kiZ ki[ ki\ ki] ki] ki<_ kip_ kib` kia ki5b ^1==kiGc kid kid kie king kig kih ki+j ki~j K2=kik kil kim ki n kido kio kip kiq kir kis kiqt kit S3=kiwv ki1x Bki 4==5=26=kiԠ ,ki@ 7==kiC kiP ki kiu ki ki ki ki3 ki ki{ ki ki U8=kiC ki ki kiɵ ki kiK ki4 ki kiչ K9=kiغ kic ki ki kiO ,ki< ki] ki ki ki% ki i30==ki ki kiL kiQ ki ki ki ki kiF ki$ kiO ki U1=ki ki ki ki ki[ ki ki ki ki ki! kic ki K2=ki ki$ ,ki kiR ki kiw ki ki ki ki ki h3==ki# ki> ki ki} ki ,ki* ki ,ki ki ki U4=ki ki ki ki ki ,ki ki ki K5=ki* ki ki ki ki ki[ ki5 ki ki ki ki k _You start resting.HP restored.ki ki 2825.0 (114.0)ki u6==65 ki _ki kiU kiki>Quiver which action? ([-] to clear) Items ([,] to cycle)  e - Zap: wand of paralysis (1) (quivered) kiSpells ([,] to cycle) Cast: Poisonous Vapours ki 4Cast: Mercury Arrow [*/%] inventory [&] all spells[!] focus mode: off|on¶kiE ¶kibS v##### #.#######.###ludeguy the Sneak #...## #.######.#..##Octopode ...#.###.##....##...#Health: 36/36 ======================== ##.##.##.##.###.#..##Magic: 10/10 ======================== ............####.#.#AC: 1Str: 8 ¶kiS ##.#..........##.#.#EV: 13Int: 19 .#.#.###.####.##.#.#SH: 0Dex: 12 #....# #.# #.##[#.#¶kiS XL:  6 Next: 98% Place: Dungeon:3 .....# #.####.##@#.#¶kiS ~Noise: ---------  Time: 3826.0 (0.0) ¶kiT ....## #........[#.#c) +0 dagger (protect) ¶ki:T ....#########......#Cast: Poisonous Vapours ¶kiWT ......# ######.# ....#.##.# ¶kirT e#####.##.# # #.#¶kiT 8#.# # #.#¶kiT A#.# # #.##.# ¶kiT r_a +0 glaive; a +0 chain mail; an orc corpse ¶kiT w_There is a stone staircase leading up, spattered with blood here. _You climb upwards. ¶kiGU _There is a stone staircase leading down here. _You start resting. _HP restored.¶kiU ¶ki[ ¶kin] ökiM 4ökiökiöki1*A7.0 (1öki.&4öki9s ####.  ...  ...  ...  #.#  #.#  #[#  #[#  #@#  #.#  #!#  #.# ..# ### ökig-8.5 (2.5ökiöki| öki_You climb downwards.ökiw _There is a stone staircase leading up, spattered with blood here.Ķki2@MĶkiL2\####.....[#Ķkio2;<#.Ķki2O#!#Ķki <Ķkio=49.5 (1.0 _Ķki2CĶkiF$  Things that are here:ĶkiH _a +0 chain mail; a +0 glaive; an orc corpseĶkiIM ######.#........Ķki[#<##.#ĶkiEĶkiW%30 Ķki} _Ķki!Ķkik _Items here: ) [ ÷÷.Ķki3X  ######. #.... ... #.#[ĶkiX [<#.#Ķki` Ķkia $1 Ķkia _Ķki!e Ķkif $  Things that are here:Ķkih _a +0 chain mail; a +0 glaive; an orc corpseŶkiT ####. #....Ŷki ... #.#[[#Ŷki).#Ŷki0!ŶkiJŶkiL$2 Ŷkii _ŶkiŶki ŶkiŶkiԛi_There is a stone staircase leading up, spattered with blood here.Ŷki1! ... ... #.#[[<##!.Ŷki.8Ŷkio9$3 Ŷki9 _Ŷki(>Ŷki?Ŷki : ... #.#[[<#.#..### Ŷki Ŷki֤ 4Ŷki Ŷki ŶkiK +5.5 (2Ŷki Ŷki2 b _c - 4 potions of curing (gained 1)Ŷki5 M#........[[#<##Ŷki S..##Ŷki+ Ŷki~ Ŷki $6.5 (1Ŷki Ŷki ƶkiquM####....ƶki'rP....[[#ƶki\r\##.#ƶki{ƶki{&7ƶki$ƶki" ƶkiTi_There is a stone staircase leading up, spattered with blood here.ƶki:M ######.#.......ƶkix.[#<##.#ƶkiƶkiƶki$8 ƶki _ƶkiƶki  ƶkiNThings that are here:ƶkis _a +0 chain mail; a +0 glaive; an orc corpseƶki@M ######.#........[#<#ƶkiI#.#ƶkixƶkiE$9 ƶkig _ƶki>ƶki7k _Items here: ) [ ÷÷.ƶkib ƶki nPick up what? 7/52 gear slots (_ for help) Hand Weapons (select all with ))a - a +0 hand axe Armour (select all with [) ƶki_ ` b - a +0 leather armour Carrion a jackal skeleton an orc skeleton ƶki [Up|Down] select[Esc] exit Letters toggle [.|Space] toggle selected[top]ǶkiǶki_Ƕki#ludeguy the Sneak##Octopode####.Health: 36/36 ========================#....Magic: 10/10 ========================Ƕki6...AC: 1Str: 8...EV: 13Int: 19#.#SH: 0ǶkiDex: 12#.#XL:  6 Next: 98% Place: Dungeon:4#@#Noise: ---------  Time: 3839.5 (0.0)Ƕkiښ#[#c) +0 dagger (protect)#<#Cast: Poisonous VapoursǶki#.##.##.#Ƕki..##### _c - 4 potions of curing (gained 1) Ƕki*_There is a stone staircase leading up, spattered with blood here.  Things that are here: _a +0 chain mail; a +0 glaive; an orc corpse ǶkiE~_Items here: ) [ ÷÷.  Okay, then.ǶkiUǶkiƞǶkiǶki. _ǶkiIǶkipǶkiǶkihP _Ƕki,ǶkiǶkiǶkiǶki[ǶkipǶki^ǶkinǶkiǶki ǶkiǶki0ǶkihǶkikǶkiǶkiǶkiBǶkiǶkiPǶkiǶki/ǶkiK.#  .# :# .# .####.#### ####.....##.#.##....@...#Ƕki46.5 (7#.............#.####..........###.#.....####.####.###[# .##[# $##<# (##.#Ƕki1ǶkiǶki+7.5 (8Ƕki Ƕki!_There is a stone staircase leading up, spattered with blood here.  Things that are here: ǶkiS_a +0 chain mail; a +0 glaive; an orc corpse _Items here: ) [ ÷÷. _Found a parchment of Mercury Arrow and 6 poisoned darts.Ƕkiet3Ƕki/vǶkiwyǶkiU~Ƕki~ǶkiǶkiԂǶkimǶkiǶki<ǶkiǶki5ǶkiiǶki˘ǶkiǶkiǶkiBǶkiǶkiǶkiNǶkiǶkiǶkiǶkiWǶkiǶkiگǶkiǶki-ǶkiaǶkiкN _You now have 192 gold pieces (gained 10).ǶkiWǶkiǶkiǶki;ǶkiǶkiǶkiǶkiǶkiBBǶkiǶkiǶkiǶkiǶki;Ƕki=ǶkiǶkiǶki7Ƕki,ǶkiǶkiGǶkiCǶkizǶkiǶkiǶkiǶkiǶki_ǶkiǶki Ƕki Ƕki Ƕki( Ƕki Ƕki8 Ƕki Ƕki$ Ƕki Ƕki Ƕki Ƕki Ƕkin Ƕki Ƕki< Ƕki Ƕki Ƕki Ƕki Ƕki Ƕki ,Ƕki ǶkiZ! Ƕkiv$ Ƕki$ Ƕkie% Ƕki<' ǶkiO* Ƕki* Ƕkit+ Ƕki, ǶkiN0 Ƕki0 ǶkiG1 Ƕki3 ǶkiB7 ,ǶkiL8 Ƕki9 Ƕki< Ƕki< Ƕki= Ƕkil? ǶkiB Ƕki4C ǶkiC ǶkiE Ƕki]H ǶkiH ǶkiI ǶkiJ ǶkiN Ƕki3N ǶkiN Ƕki/P ǶkiR Ƕki=S ǶkiS ǶkiT ǶkiX Ƕki\X ǶkiX Ƕki Z Ƕkij] Ƕki^ Ƕki^ ǶkiZ_ Ƕkib ǶkiJb Ƕkib Ƕki7d Ƕkif ,ǶkiYg Ƕkih Ƕkik ,Ƕkik Ƕkil Ƕkip Ƕki>p Ƕkip Ƕkiq Ƕkit ,Ƕkiu Ƕkiv Ƕkiy ǶkiRy Ƕkiy Ƕkiz ǶkiT~ Ƕki~ Ƕki~ Ƕki Ƕki BǶki Ƕki Ƕki Ƕkiu Ƕkiϊ Ƕki Ƕki Ƕki Ƕki/ Ƕki Ƕki3 Ƕki Ƕki Ƕki Ƕkid Ƕkiԗ Ƕki Ƕki Ƕki Ƕki Ƕki7 Ƕki Ƕkiݠ ǶkiE Ƕkif Ƕki Ƕkib Ƕki Ƕki& Ƕki Ƕki Ƕkiv Ƕki Ƕkix ,Ƕki ǶkiW Ƕki Ƕki Ƕki Ƕki޵ Ƕki ,Ƕki, Ƕki[ Ƕki ,Ƕki Ƕki Ƕki0 Ƕkiv Ƕki> Ƕki Ƕki, Ƕki\ Ƕki Ƕki Ƕki/ Ƕkix Ƕki Ƕki Ƕkij Ƕki Ƕkif Ƕki Ƕki Ƕki@ Ƕki Ƕki Ƕki ǶkiW Ƕki Ƕki. Ƕki Ƕki Ƕki Ƕki Ƕki Ƕki( Ƕki Ƕki Ƕkif Ƕki Ƕki Ƕkik ǶkiS Ƕki Ƕki Ƕki Ƕki Ƕki* Ƕki Ƕki" Ƕki Ƕki Ƕki Ƕkih Ƕki ,Ƕki Ƕkig Ƕki ,Ƕkir Ƕki Ƕki Ƕki& Ƕki Ƕki4 Ƕki$ ,Ƕki ǶkiE Ƕki Ƕki4 Ƕki Ƕki Ƕki Ƕki Ƕkij Ƕki Ƕki ǶkiK Ƕki Ƕki Ƕki Ƕki ǶkiX Ƕki Ƕki|# ,Ƕki# Ƕki% Ƕki' ǶkiA' Ƕki' Ƕki( Ƕki+ ǶkiN+ Ƕki+ Ƕki, Ƕki/ Ƕki/ Ƕki;0 Ƕki/1 Ƕki3 ,Ƕki4 Ƕki9 XǶki: Ƕki(= ǶkiP= Ƕki= Ƕki> Ƕki4B ,ǶkiB ǶkiD ǶkiF i  You encounter a dart slug.ǶkiL #...............# #.####...####...# ##.## ##.## #.# #.# #.# #.# ..# #.# ### #.# ǶkiL / ..##########.#  w..$...@.....#  ....##########ǶkiL S  .  ǶkiM K   Ƕki4M 0  ǶkiSM   w   dart slug (asleep)  ǶkiwM K   ǶkiM + ǶkiqV 0920.0)ǶkiW *8.5 (81 ǶkiW _Ƕkiz] Ƕki;_ ǶkiN  ........#  ..#  ##.## ##.##  #.# #.#  Ƕki #.# #.#  ..# #.#  ### #.#  ..##########.#  w..$...@.....#  Ƕki̻ 8....##########  .Ƕki Ƕki *ǶkiWS ........#  ..#  ##.## ##.##  #.# #.#  ǶkiS#.# #.#  ..# #.#  ### #.#  ..##########.#  ǶkiSw..$...@.....#  ǶkiSO....##########  .Ƕki"TǶkiDTǶkiZǶkiZǶki_Ƕkiyb` _A dart slug is nearby!ȶkiS  Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ȶkiE4ȶki5ȶki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ȶkit  #.........#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ### #.# .#.# .w..$..@......# .# .. .      ȶki~ ȶki 89.5 (1.0) _ȶki ȶki ȶkid { #.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.# # ### #.# #...#.# .w..$.# .ȶki # .. ... ... ~~ ȶki ?~   ȶki pw§w§ȶki- ```````The dart slug launches a dart at you.ȶkiJ v..$.@..ȶkiߣ '30ȶki :§ȶkiD O _The slug dart misses you.ȶki4S  Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ɶki.Jɶki ɶkiwɶki_You can't see any susceptible monsters within range! (Use Z to cast anyway.)ɶki*S  Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ɶkiɶki;ɶki ɶki   Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ɶkiV #.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ## ### #.#ɶki> .#...#.# .w..$.# .# ..ɶki-u .......~§..#.ɶkiSq ~§§~.#.ɶkipO~~ß~~.. ɶkiDC§§ɶki ```````onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)ɶkiL\onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  The dart slug launches a dart at you.ɶkiFT..$@...~1§§ _The slug dart misses you.ɶkiW6 #...............#ludeguy the Sneak#.####...####...#Octopode##.## ##.##Health: 36/36 ========================#.# #.#Magic: 8/10===================-----#.# #.#AC: 1Str: 8..# #.#EV: 13Int: 19## ### #.#SH: 0Dex: 12.#...##########.#XL:  6 Next: 98% Place: Dungeon:4...w***@........#Noise: ---------  Time: 3931.5 (0.0).......##########c) +0 dagger (protect).......Cast: Poisonous Vapours..............~~§..#.w   dart slug (weak)§§~~.#.~~ߧ~.. [1ɶki6 v8d Casting: Mephitic Cloud (quite dangerous; 13% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 4% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a dart slug (chance to weaken: 100%)  The glob of mercury hits the dart slug! The dart slug looks weaker.ɶki ..$~~§~ß~==2.5 (1  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 4% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a dart slug (chance to weaken: 100%)  The glob of mercury hits the dart slug! The dart slug looks weaker. _The dart slug is almost dead.ɶkijng #...............#  ludeguy the Sneak #.####...####...#  Octopode ##.## ##.##  Health: 36/36 ======================== #.# #.#  Magic: 6/10==============----------ɶki/o #.# #.#  AC: 1Str: 8 ..# #.#  EV: 13Int: 19 ## ### #.#  SH: 0Dex: 12 .#...##########.#  XL:  6 Next: 98% Place: Dungeon:4 ...†..$@........#  Noise: ==-------  Time: 3932.5 (0.0) .......##########  c) +0 dagger (protect) ɶkiYo....... Cast: Poisonous Vapours ....... ɶki~oL....... ~~~..#.ɶkio w   dart slug (weak) ~§~~.#.ɶkio& §~ß~~..ɶkioCasting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ɶkioAiming: Mercury Arrow (safe; 4% risk of failure)  Press: ? - help, Shift-Dir - straight lineɶkipAim: a dart slug (almost dead, weak, chance to weaken: 100%)  The glob of mercury hits the dart slug! The dart slug looks even weaker.ɶkitF     ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ## ### #.# ɶki'u2 .#.###.#  ...†***@........#  ...##### ɶkicuD ....... ....... .......ɶkiu  ~~~..#. ~§~~.#. §~ß~~.. ɶkiXSonfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 4% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a dart slug (almost dead, weak, chance to weaken: 100%)  The glob of mercury hits the dart slug! The dart slug looks even weaker.  You kill the dart slug!S~..$S   adder (wandering)§~~ß~§93.5 (1§ _You encounter an adder.ʶki2 #.# #.####...####...# ##.## ##.## #.# #.# #.# #.# ..# #.# ### ### #.##.#...#.##...†...#.##.#.#.#.~~~..#.#~§§S~.#.#~ß~§...ʶkiEFS~ʶkiCFJS§ʶkiMj~§~--4ʶkiSʶkiVR _You see here 13 gold pieces.ʶkiQ5 l#.# #.####...####...# ##.## ##.## #.# #.# #.# #.# ..# #.# ### ### #.# #.#...#.# #...†..$# .ʶki5 k# #.# .#.#.S~~..#.# ~§~~~.#.#~~~ߧ~...ʶki8 1~ʶkiO@ S~§~ß~ʶki`A H--5 _ʶkiF ʶkinH ˶ki#.#  #.####...####...#  ##.## ##.##  ˶ki#.# #.#  #.# #.#  ..# #.#  ˶kiC### ### #.#  #.#...#˶kiu.#  #...†..$.˶kin#  .# ˶ki͋l #.......#  ˶ki........#  S.......#  ˶ki#.~~~..#.#   ~~~~~.#.#  ˶kiLc ~§~ß~~...  ˶kitt   ˶kiP9§˶kir&6˶ki˶ki/˶ki##.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ### ### #.#  #.#...#.#  #...†..$.#  .#  #.......#  ........#  S.......# ˶ki .~~~..#.#  ~~§~~.#.#  ~§~ß~~...   ˶ki˶ki&7˶kiM˶kiռ˶kig#.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ˶kih### ### #.#  #.#...#.#  #...†..$.#  .#˶kih  #.......#  ........#  ˶kihS.#  .~~~..#.#  ~~§~~.#.# ˶ki%iU ~§~ß~~...   ˶kiPi˶ki/r˶kir˶kir8˶kiw˶kiwy˶ki  What are your orders?  t - Shout!  Orders for allies: a - Attack new target. r - Retreat!s - Stop attacking. g - Guard the area.f - Follow me.  Anything else - Cancel.̶ki%Y P  Okay, then.̶kiY ̶kij D _ͶkiIͶki#Ͷki'd7==Ͷki9X==Ͷki5;Ͷki<,Ͷki=Ͷki@Ͷki@ͶkiAͶki DͶkiJDͶkiDͶkiHe8===ͶkiIͶkiuNBͶkiQ,ͶkidRͶkiVv _You start resting.An adder comes into view.Ͷki?WͶki ]SS   adder (wandering)Ͷki]0502.0)ͶkidͶkie31.5 (13 _ͶkirkͶkimͶkiK #.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ### ### #.#  #.#...#.#  #...†..$.#  .#  #...S...#  ........#  S.#  .~~~..#.#  ~~§~~.#.#  ~§~ß~~...  ͶkiЕC.SͶki q.SͶki̝A===2Ͷki.0)ͶkicͶki! #.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ### ### #.#  #.#...#.#  #...†..$.#  .#  #.......#  .....S..#  S.......#  .~~~..#.#   S   adder (wandering) ~~§~~.#.#   ~§~ß~~...    .S§ Ͷki&3Ͷki:§Ͷkiu2 _The adder leaves your sight.ͶkiD` #.#  #.####...####...#  ##.## ##.##  #.# #.#  #.# #.#  ..# #.#  ### ### #.#ͶkiD`  #.#...#.#  #...†..$.#  .#Ͷki(E  #.......#  ........#ͶkiXE} S....S..# .~§~..#.# S   adder (wandering)Ͷki|E ~~§~~.#.#ͶkiE| ~~~ß~~... ͶkiHS.SͶki%PB§§ͶkiP&4ͶkiVL§§ͶkiXζki   Casting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ζki4ζkiʾζki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ζkiX  Casting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ζkiO B  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)϶ki2onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Unknown command.϶ki < #.####...####...# ##.## ##.## #.# #. #.# #.#϶ki : ..# #.##### ### #.##.#...##########.# #...†..$.........# .......@########## #.#  .# .# .~§§.S#.# ~~§§~.#.# ~~~ß~~...϶ki z §~>~§§..#϶kiD .S.S϶ki[~~§~~§§϶ki&5϶ki M§§϶kix A _Found a staircase to the Ecumenical Temple.жki=W  Casting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.жki"4жki@%жki' _You can't see any susceptible monsters within range! (Use Z to cast anyway.)жki`w ##.## ##.## #.# #. #.# #.# ..# #.## #### ### #.##.#...##########.##...†..$.........#.....########## #.# .##.#~~~..#.#§~~~.#.#§~ßS~...жkiw~§~>~§§..#§~ߧ~~§ .#жkizN~Sжki|FS§жkiFz§~§§§~~~~~ß~~§жki\9==6 _жkiu§§§§§жkiжki&  Casting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.жki жki; жki жkiL  жki  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Ѷki #.# #. #.# #.## ..# #.##.##### ### #.# #.#...##########.##...†..$.........# #........##########..#.# .# #.#~~§..#.##.~~§§~.#.#Ѷki#§~~~ß~~...#~§~>S§~..##.~~ß~~§§..##.~§§~~.ѶkiFS~Ѷkip~§§ß~§~~~Ѷki-7 _ѶkiZ§§§§ѶkiѶki[ #.# #.##. ..# #.# #.##### ### #.# #.#...##########.##...†..$.........#. #........##########...#.#  .#Ѷkizx #.#~~§..#.# #.~~~§~.#.# #§~~~ß~~... #~§~S~§§..##..~§ß~§~~..##.~~§~~..## #..~~~...#Ѷki>S>ѶkiAS~Ѷkil§Ѷki1SѶki&§~~~~~§~ߧ§~~§~8§~>~§§ѶkiL#..##### ##...###########...†..$.........##........#########..# ѶkiG #.##..§~~@.#.#~~~~~.#.#~~§~ߧ§...§~>~§~..##..S~ß~§~~..###.~§~~~..# #..~~~...#Ѷki]0........#ѶkiH O~SѶki_~~§§~§~~§Ѷkis&9ѶkiX§§§ѶkinѶki$  _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Ѷkiy ;  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Ҷkiy #.##### ### #.# #.#...##########.#. ##...†..$.........#.##........########## ...#.#  .##.# #..~~§..#.# #.~~§@~.#.# #~~§~ß~§.....Ҷki[ #~§~>~§~..###[..~§ß~§~~..###S~~~§## #..~~~... ........###...^....Ҷki S.SҶki#A.S§~~~ߧ~§§==60Water Ҷki= §§§onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 4% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You enter the shallow water. Found a robe.Ҷki;ҶkioҶki2ҶkiҶki j #.#...##########.#. ##...†..$.........# .##........########## ...#.#  .##.# #..~§~..#.# #.~~§§~.#.## #~~~@ߧ§..... #~§~>~~~..###.[..~§ß~§§~..# #.##.~~§§~..## #..~~~... .S......###...^.... #......#.#.SҶki ~§~~§~~>~§~~§Ҷkiq %1Ҷki. §§~~>~§§§§Ҷki Ҷkim. ##...†..$........ .##........#########..#  #.##..~~§..#.~~§~~.#.##~~~§ß§~.....§~~@~§~..###.[..~~ß~§§~..# #.##.~~§~~..#. #..~§~...#  .........###.S.^....# .....###.##.SҶkiu§~~§§ß~~§~§Ҷki]~Ҷki02Ҷkia§§§§Ҷkii _There is a staircase to the Ecumenical Temple here.ӶkiRӶkiDSӶkiHZӶkiN]:S.ӶkidY§~~§~~~Ӷkiih-3 _ӶkilI§§Ӷki,+.TempleӶki/ ##### ####.@.####  ##_......._####...........####_..........._###......###....#######....##Ӷki90M#_...##.....##..._###...##.......##...###....#.........#....#ӶkiUa10/10===5.0 (2.5Ӷki;_ӶkiX _You climb downwards. Welcome to the Ecumenical Temple! Found four altars.Ӷkid _There is a staircase back to the Dungeon here.Զki #########.<.######_...@..._####....####__##Զki1#....#....§§§§.#....#Զki§§§§§§§§§§§§§§§§Զki46.0 (1.0 _Զki§_§§§§§§§§§§ԶkiԶkiM7  #########.<.######_......._####....####__##....#....#..§§§§§§§#....#__Զki8 Զki9@ Z§§§§§§§ԶkiA &7ԶkicG 6§§§§_§§§§§§§§§§§§§§§§ԶkiH ԶkiZ # #########.<.######_......._####....####__##....##....#######....###_...#§§§§§§§§§#..._#..Զki*b Զkib &8Զkih §§§§§§§§§§§§§§§§§§§§§§Զki"j նkivX[?25h[?0c  Search for what [? for help]? ֶki0 [?25l[?1cֶkiֶkiJ16 matches: travel [toggle: !], by dist [/], hide useless & duplicates [=]  a - [Temple] a staircase back to the Dungeonb - [Temple] a sacrificial altar of Ru  c - [Temple] an ancient bone altar of Kikubaaqudgha  d - [Temple] a hazy altar of Hepliaklqana  e - [Temple] an iron altar of Okawaru  f - [Temple] a burning altar of Makhleb  g - [Temple] an ornate altar of the Wu Jian Council  h - [Temple] a glowing golden altar of the Shining One  i - [Temple] a hide-covered altar of Uskayaw  j - [Temple] a basalt altar of Yredelemnul  k - [Temple] a blossoming altar of Fedhas  l - [Temple] a bloodstained altar of Trog  ֶki.m - [Temple] a radiant altar of Vehumet  n - [Temple] a snail-covered altar of Cheibriados  o - [Temple] an opulent altar of Gozag  p - [Temple] a sparkling altar of Nemelex XobehضkiThe Ecumenical Temple <_______________(Press ? for help) #####  ####.<.####  ##_......._##  ##...........##  ##_.....@....._##  #...............#  ##....#######....##  #_...##§§§§§##..._#  ##...##§§§§§§§##...##  #....#§§§§§§§§§#....#  #....#§§§§§§§§§#....#  #_...#§§§§§§§§§#..._#  #....#.........#....#  #....#.........#....#  ##...##.......##...##  [4ضki[0m#_...##.....##..._#  ##....#######....##  #...............#  ##_..........._##  ##...........##  ##_......._##  ####._.####  #####.ضkiz ludeguy the SneakOctopodeHealth: 36/36 ========================Magic: 10/10 ========================AC: 1Str: 8EV: 13Int: 19SH: 0Dex: 12XL:  6 Next: 99% Place: TempleTime: _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You enter the shallow water. Found a robe. _There is a staircase to the Ecumenical Temple here. _You climb downwards. Welcome to the Ecumenical Temple! Found four altars. _There is a staircase back to the Dungeon here.  Search for what [? for help]? .ضkiЊ ضki ضki9 ضki ضki% ,ضkix _You enter the shallow water. Found a robe. _There is a staircase to the Ecumenical Temple here. _ضki You climb downwards. Welcome to the Ecumenical Temple! Found four altars. _There is a staircase back to the Dungeon here.  Search for what [? for help]? . _Found a burning altar of Makhleb.ضkiv 4ضkil ضki7 K _Found a hide-covered altar of Uskayaw.ضkiO ضki ضki/ ضkiO ضki ,ضki ضki ضki) ضki ضkiH ضkiT  _Found a blossoming altar of Fedhas.ضki _Found a bloodstained altar of Trog.ضkid Bضki E _Found an opulent altar of Gozag.ضki ضkiV ضki ضki N _Found a sparkling altar of Nemelex Xobeh.ضki, ضkih ضki  ضki ضkiT ضki ضki ضkiW ضki ضki2 ضki ضkiH ضki ضkiV ضki ضki% ضki: ضki ضki ضki ضki ضki ضki! ضki) #....#§§§§§§§..#....##....#.§§§§§§§.#....###...##§§§§§§§##...###_...##...§§##..._###....#######....###...............#ضki) ##_..........._####...........####_.......@##Noise: --------- 3986.0 (18.0)ضki=* ####._.####c) +0 dagger (protect)#####Cast: Poisonous Vapoursضki+ ضki1 ضki{2 ^ _There is an opulent altar of Gozag here.ٶkiW  You curl up in front of the altar of Gozag.ٶki/  --more--ڶkicGozag Ym Sagoz the Greedy Gozag Ym Sagoz the Greedy teaches that the world belongs to the rich. Those accepting this principle may exchange their gold for divine assistance. Followers of Gozag do not earn piety; the only way to impress this god is by amassing a fortune, and worshippers may request as much assistance as they can afford. Fortunately, Gozag's worshippers are said to have the touch of gold. Favour - Gozag is neutral towards you. Granted powers:(Cost)Gozag turns your defeated foes' bodies to gold. Your enemies may become distracted by gold. You can petition Gozag for potion effects.(400 Gold)You can fund merchants seeking to open stores in the dungeon. (800 Gold)You can bribe branches to halt enemies' attacks and recruit allies. (3000 Gold)[!]: Overview|Powers|Wrath [J/Enter]: join religion (77 gold; you have 192)ڶkiO ڶki1J #....#§§§§§§§..#....#ludeguy the Sneak#....#.§§§§§§§.#....#Octopode##...##§§§§§§§##...##Health: 36/36 ========================#_...##...§§##..._#Magic: 10/10 ========================##....#######....##AC: 1ڶki{Str: 8#...............#EV: 13Int: 19##_..........._##ڶki?SH: 0Dex: 12##...........##XL:  6 Next: 99% Place: Templeڶki##_.......@##Noise: ---------  Time: 3986.0 (0.0)ڶki####._.####c) +0 dagger (protect)#####ڶkikrCast: Poisonous Vapours _Found a blossoming altar of Fedhas. _Found a bloodstained altar of Trog. _Found an opulent altar of Gozag. _Found a sparkling altar of Nemelex Xobeh. _There is an opulent altar of Gozag here.  You curl up in front of the altar of Gozag.ڶkik%  ڶkiDGozag welcomes you!ڶki/  --more--۶kimpz.§§.۶kiqz of Gozag Gold: 1157.0 (1۶kiw^§§§§§§§۶ki yK _You pay a service fee of 77 gold.۶kiGyܶkiouܶkisBܶkivܶkiDvܶkiwܶki{P  There is a bloodstained altar of Trog here.ܶki|ܶki} _ܶki2ܶkiǀܶkiǂܶki-ܶki*ܶkiܶki`ܶkiܶki&ܶkiqܶki,ܶkiʏܶkiܶkiܶkiٓܶkiܶkiؖܶkiܶkiܶkiܶki##_..........._##  #...............# ##....#######....## #_...##§§§§.##..._# ܶkib#...##§§§§§§§##...## ....#§§§§§§§§.#....# ....#§§§§§§§§.#....# ܶki._...#.§§§§§§..#..._# ....#§§§§§§§..#.@..#ܶkiT95.0 (8 ....#.§§§§§§..#....# ܶkiy#...##§§.§§..##...## ܶki#_...##..§..##..._# ##....#######....##  ܶki#...............#  ##_..........._####...........####_......._##ܶkiܶkiݧܶkiݶki.pIݶkirݶkiwBݶkicxݶkisXݶkiݶkiݶkiݶkidݶki,ݶkiݶkiݶkiCݶki~ݶki$ݶkiIݶkiݶkiƕݶki6ݶkiwݶki,ݶkiMݶkiݶkiݶkiݶkiݶkiݶkiݶkiݶki,ݶkiݶkiݶkiݶkiݶkiN #### ####.<.#### ##_......._## ##...........## ##_..........._## #.......@.......#4005.0 (10.0) ##....#######....## #_...##§§§§§##..._# ݶkij##...##§§§§§§.##...## #....#§§§§§§§§.#....# #....#§§§§§§§§§#....# #_...#§§§§§§§§§#..._# #....#§§§§§§§§§#....# #....#.§§ݶkiҷk§§§§§.#....#ݶkiݶkiK޶kiC޶ki*D޶kiF޶kiJ޶kiQB޶kiX _Found an ornate altar of the Wu Jian Council.޶ki6[޶kiD]޶ki]޶ki^޶ki`޶kib޶kib޶kic޶kii #####  ####@<.#### 9.0 (4.0) ##_......._##  ##...........##  ##_..........._޶kii## #...............# ##....#######....#޶ki#j #_...##§§§§§##..._޶kiGj ##...##§§§§§§§##.##޶kiij #....#§§§§§.§§§#....#޶ki9k޶kiQt޶kiU##### ####.@.#### ##_......._## ##...........## ##_..........._###.޶ki.###....#....###_...##§§§§§##..._###...##§§§§§§§##...## ޶kiB޶ki,10.0 (1޶ki_§§§##..._§§§§§޶kid _There is a staircase back to the Dungeon here.߶kiF߶kitF߶kiK߶kiQ߶ki)U-1 _߶kiXk_§§§§߶kiA.Dungeon:4߶kiJ,߶ki=L. ##S..†..$.........#.##........##########...#.......##........###........#߶kiL#..~~§..#.##.~~§~~.#.###~§§§ß~§..... #~§~@~§§..###.[..~~ß~~~~..##.##.~§§~~..## ߶kiLf . #..~§~...# ## ##...^....#߶kiM #......#.# ###.##.#.# ߶ki-2.5 (2.5߶kiU§§§߶kiָ> _You climb upwards. Welcome back to the Dungeon!߶kii _There is a staircase to the Ecumenical Temple here.ki 94ki>kiA _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki; 3ki ki% kiy  You enter the shallow water.  An adder comes into view.kiM #.#...##########. ##S..†..$.........##.#########...# ##.........~~§..#.# .~~§~~.#.## §§@ß~§..... #~§~>~§§..###kid.[..~~ß~~~~..#.##.~§§~~..##. .S   adder (wandering)####.##.#.#kiqZ.S0.0ki§~~§>~§~§3.5 (1Water _kiU§§§§kiki%   . ##.S.†..$.  .##........#  ...#.......#  #........#  ##........#  #..~~§..#.#  #.~~§§~.#.##  #~~~@ß~§.....  #~§§>~§~..###  .[..~~ߧ~~~..#  #.##.~§§~~..##  . #..~§~...#  .........##  ##...^....#  #......#.#   kiW   . ##.S.†..$.  .##........#  ...#.......#  ki X#........#  ##........#  #..~~§..#.#  #.~~§§~.#.##  kiXk#~~~@ß~§.....  #~§§>~§~..###  .[..~~ߧ~~~..#  #.##.~§§~~..##  . #..~§~...# .........##  ki_Y ##...^....# #......#.# kiYkik3kipokir] _An adder is nearby!kig   . ##.S.†..$.  .##........#  ...#.......#  #........#  ##........# kig #..~~§..#.#  #.~~§§~.#.##  #~~~@ß~§.....  kigJ#~§§>~§~..###  .[..~~ߧ~~~..#  kihG#.##.~§§~~..##  . #..~§~...# ki.h# .........## kiBh$ ##...^....# kiSh kieh+#......#.#  kivh) ki   . ##.S.†..$.  .##........#  ...#.......#  #........#  ##........#  ki`#..~~§..#.#  #.~~§§~.#.##  #~~~@ß~§.....  #~§§>~§~..### ki  .[..~~ߧ~~~..#  ki#.##.~§§~~..##  . #..~§~...# .........##  ki##...^....# ki#......#.# kiD ki kiki] _An adder is nearby!ki kiB ki kig _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki8#.##### ### #.#  #.#...##########.# . ##.S.†..$.........# .##..##########...# .# ##........# #..~~§..#.# #.~~§@~.#.## #~~~§ß~§.....  #~§§>~§~..###.[..~~ߧ~~~..# #.##.~§§~~..#. #..~§~...# .........###...^.##......#.#S.kiPE~~ߧ~§~4 _kiHC§§kitJki? ..#### ###  #.#S..##########. ##...†..$.........#.##.#########...# #........#.~~@..#.# .~~~~~.#.## ~~ߧ§..... #~~§>~§~..###.[..§~ߧ~~~..ki@#.##.~§§~~..##. #..~~~... .........####...^...ki/CG.SkieEC.SkiM§§~ß~~§~>~~~~ß~§§ki.N%5kijTV§§§kiVki  # ..#### ###  #.#..S##########. ##...†..$.........ki #.##.#########....# ##...@....#.~~~..#.# ki7 .~~~~~.#.## §§~ß~~.....kij  #~§~>~~~..###.[..~~ß~§§~..ki #.##.~§§~~##. #..~~~... .........##ki D§§~§§§kiO 9~~§kiP 06ki W§§§ki! ki8&5#.# #.#  #.# #.# #. ..# #.# #.##### ### #.#  #.#..S##########.# . ##...†..$.........# #.##..##########....# #.# ki&##........# #..~~~..#.# #.~~§§~.#.###~~§~ß~~..... #~§~>§§§..###.[..~~ß##.##.~~§~~..#. #..§~~...#ki&*Q.Skig+N.Ski@3S~§~~~§ki4?7Poisonous Vapourski::§ki<ki^#.# #.#ludeguy the Sneak#.# #.#Octopode of Gozag Gold: 115#.kixW..# #.#Health: 36/36 ========================#.##### ### #.#Magic: 8/10===================-----#.#...##########.#AC: 1Str: 8ki . ##...†..$.........#EV: 13Int: 19ki#.##.......S##########SH: 0kiDex: 12....#....**.#kiQXL:  6 Next: 99% Place: Dungeon:4#....@...#Noise: ---------  Time: 4017.5 (0.0)##........#c) +0 dagger (protect)#..~~~..#.#Cast: Poisonous VapourskizM#.~~§~~.#.###~~§§ß~~.....#~§~>~~~..###kiaS   adder (weak)ki.[..§~ß~§~~..##.##.~~§~~..##ki?. #..§~~...#kiCasting: Mercury Arrow (safe; 4% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki#Aiming: Mercury Arrow (safe; 4% risk of failure)  Press: ? - help, Shift-Dir - straight linekiCAim: an adder (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the adder. The adder looks weaker.kiy U.Ski 7.§kio §~~ߧ§§>~§ ~§kie 4==8.5 (1ki_ }§§§onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 4% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an adder (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the adder. The adder looks weaker. _The adder is severely wounded.kip###.## ##.##.# #.#  #.# #.# #. ..# #.# #.##### ### #.#  #.#...##########.# . ##...†..$.........# #.##........##########....S.# #.# ##........# #..~§~..#.##.~~§§~.#.###~~~~ߧ§..... kii #~§§>~§~..###.[..~§ß~§~~..##.##.~~§~~..#kiϗ§~§§~§~ߧ~~~>§~ki.-9ki§§ _The adder barely misses you.ki D ~~ß~§§§§ß~~You closely miss the adder. Your grab misses the adder.The adder is heavily wounded.ki !-ki 20ki! B§§ki$ U _The adder barely misses you. x2kiш $You puncture the adder!  Your weapon exudes an aura of protection.ki ~~§~§~ß~~~~ß~§ki kiИ Q###.## ##.##ludeguy the Sneak#.# #.#Octopode of Gozag Gold: 115 #.# #.#Health: 36/36 ========================#...# #.#ki 7Magic: 8/11=================-------#.##### ### #.#AC:  8  Str: 8#.#...##########.#EV: 13Int: 19. ##...†..$.........#SH: 0Dex: 12#.##........##########XL:  6 Next: 103% Place: Dungeon:4ki8 [....#....@$.#Noise: =--------  Time: 4021.5 (1.0)#........#c) +0 dagger (protect)##........#Cast: Poisonous Vapours#..~~§..#.##.~~§~~.#.###~~§~ß~~.....kii #~§~>§§~..###.[..~~ß~§~~..#ki Y#.##.~~§~~..## _The adder barely misses you.ki You closely miss the adder. Your grab misses the adder.The adder is heavily wounded. ki _The adder barely misses you. x2  You puncture the adder!  Your weapon exudes an aura of protection.ki t _You kill the adder!You have reached level 7!ki kiy /  --more--ki41/412---7 1% Poisonous Vapourski?ki$4 _kinY f ##.## ##.## #.# #.# #.# #.# #. ..# #.# #.##### ### #.# #.#...##########.# . ##...†..$.........# #.##.## ....#.....@.# kifZ J#.# ##.# ##.~~§~~.#.###~~§~ß~~.....#~§~>§§~..###.[..~~ß~§~~..# kic e§~§§§~~§kie 5-2 _kij N§§kiss r~~~~ß~§~~~kit 9 1 -3.5 (2kiy :§ki/| > _You now have 119 gold pieces (gained 4).kiM#.####...####...##.## ##.## ##. ..#.##### ###  #.#...##########. ##...†..$.........#.##.#########....#...... ##........#~~ß~~~~..#ki§~~~~>~§ki+4.5 (1kiQ D§§ki ki6M...........#.####...####...##.## ##.## # ..#.##### ###  #.#...##########. ##...†.@$.........#.##........##########....#......#........#~~~>~§~..#kiL~§§§kiW9==5kirkikikiSkikiUki 1#.# #.####...####...# ##.## ##.## #.# #.# #.# #.# #. ..# #.# #.##### ### #.# #.#...#.# . ##...†..@.# #.##.# ....#.......# ####.#.~§§~~.#.###~§~~ß~~..... kil 8~ki &6ki ki :§kiv H327.5 (2kii ki ? _You now have 132 gold pieces (gained 13).kiC3kikiFBki*ki:==ki*ki,kikikikikiki<*132ki kikiP10/12==kiwki,ki ki,kikiM ,ki> kig6L==1==ki<kipE==kiIki^IkiIkiL,kizLkiNki OL2==kicOkiQ4 _Magic restored.kixS3kiTkiIWkiYBki;Zki],ki^kibe  You see here a dart slug corpse.kifkigA== _kihkiqjkimki"nkiZokipkitki[ukiukiwki{ki9|ki|ki~kiF~50kiki%N _You now have 150 gold pieces (gained 18).ki13kiӑkikikihkikișkimkikikkiLkiVkikikiki,ki7kiki,kikiDki,ki3ki;kilkiki kiAkikikizkikikiZ,kiki',kiki3kikikizki)ki,kiBkiki,kikiki kiki>n _k - 2 golden potions (gained 1)kikiQkikikikikiki\kiPkikikikiki4 ki ki kikikikikiK,kikiki,ki ki~ki,ki/kiki. ki kiW!ki"ki$ki%ki%ki&ki(ki(kiO)ki*kia-,kiM.kii0ki68....#.# ####.#..###....... ......# #.......###....... ....####.###.#.##..~~~..# ##.###.# #.#.##.~~§~~.##.#ki~8#.# ..#.##§~~~ß~~.#.# #.##.##.##~~§>~§~.#(# #.# ...[..~§ß§~§~.#.#ki8######.#>.##.##.~~§~~..#.# .....##..§~~...84.5 (5ki87.0)  #.# ##########.#...........##.#ki,9# ##...^....##.##......#.##.####.##.#.# ki]99ki&AkiA,5.5 (58kiFkiH; _Found a stone staircase leading down.ki=ki>ki9?kiPBkiJGkiKBkiNkidNki]OkiTR  There is a stone staircase leading down here.kiXkiX _kiNZki^kiWbkibkicki8fkijki\jkikkimkiqkiDrkiski§§§..###  #.#....[..~~ß~~~~..# ######.#>.##.##.~§§~~..## .............##..~~§...# ki #########.#...........##  #.#.##...^....#  #.#.##......#.#  ki/#.#.####.##.#.#  #.#.# #@# # kiO98.5 (13 ki{#.#.# #..# kiķ"#.#.# #.## #.# #. #.# #.kif..#.#<kiA§~ki,9.5 (14kix9§kiq9 _Found a stone staircase leading up.ki H 3kiH ki,K kiQR  ....[..~~ß~~~§..# ######.#>.##.##.~§§~~..# .............##..~~~...# #########.#...........# #.#.##...^....# .##......###.## ##.# # #.@# 0.0)#  .<kiZ 9§ki [ -100.5 (1ki_ ;§§kigb 9 _Found a stone staircase leading up.kikikivki՟kiH #.#....[..~~ß~~~§..##.#>.##.##.~§§§~..##.##..~~~...##.#...........## #.#.##...^....# #.#.##......#.# #.#.####.##.#.# #.#.# ##.# # #.#.# #@.#ki0 #.#.# #.## #.# #.# #.# #.[ ... #..#kiΨ #<.# .<..kiJ~~§kif+1.5 (1kiķ9§kiW _Found an ichor-stained ring mail.ki 3kiU ki ki' ki< Bki ,ki ki nki ki kiO ki"  You see here the +0 ring mail of the Catamount {-Tele Regen+ Dex+2 SInv}.ki& ki'  _ki( ki- ki_. ki. ki/ ki3 ki6 ki$7 ki 9 ki; ki@ ki@ kiB kiF P  There is a stone staircase leading up here.kiU kiV  _kiX kiP\ P  There is a stone staircase leading up here.ki|a kib  _ki d kid kifg kig kih kik kio kio kiwq ki_s kifv kiv kiw ki2  #.#.# #.## .# # #.# #.###.#.## #.###.[....... #...........## #####..##.### .#######<.##.# ........<....# #..#####......#ki  #.....@.......# ##.#####.....## #.....# ....### ##### ki 1ki 0143.0)kiL ,5.5 (14kiݎ ki! . _i - a scroll of identifykiU kiwU ki W ki[ kig` ,kif ,kido nkip ki}p kir kiTu ,kiv ki{ ki{ kiW| kib~ kih ki' kil ki kio kiʼn ,kiE ki& ki Bki ki ki ki9 kiy ki ki Bki ki kiס kiҢ ki ki ki4 kiݪ ;4ki ki߰ M _You now have 154 gold pieces (gained 4).kiu 3ki= ki ki kiƷ kiZ ki9 ki kiݽ ki ki ki ki ki kiR ki2 kib ki ki ki/ ,ki ki ki ,ki ki ki ,ki ki] ki5 ,ki ki kif #.# ..............##..§~~...#.# ##########.#...........##.# #.#.##...^....##.# #.#.##......#.##.## #.#.####.##.#.#ki .. #.#.# ##.# ##. #.#.# #..# #####.#####.#.# #.## .# #ki ...../.@.#.#.# #.###.#.#37.5 (22ki ...."......#.###.[......>##.####.###...........#.. #.# #####..##.###.ki@ #.#######<.##.##........<....#kio #..#####......##.............#ki \.########.#####.....##ki ki ,8.5 (23ki`Q _Found a stone staircase leading down.ki Jki F _Unknown command.ki4kikiٓF _Unknown command.ki}K #.# .##..§~~ #.# #.#. #.# #.#.##...^.... #.# #.#.##......#. #.# ## #.#.####.##.#. .. #.#.# ##.# # #. #.#.# #..# #ki~[#.#####.#.# #.## .# ./@..#.#.# #.###.#.."......#.###.[.>##.####.###.ki=~ .. #.# #####..##.#.# #.#######<.##.#ki~# #..<....# #..#####......# #......ki4\.# .#.#####.....##kiŅkiˍN9.5 (1.0) _kiki+=@# #.# .##..§~~ # #.# #.# # #.# #.#.##...^ kik=# #.# #.#.##......# #.# ### #.#.####.##.# ..# #.#.# ##.# #ki= #.# #.#.# #..# #.#####.#####.#.# #.## .#.@...#.#.# #.###.#kir>."......#.###.[#.>##.####.#### ..# #.# #####..##. #.## #.#<.##.# # #.<....#  #..#####......#  #.#  .#.#####.....## kiiLkipM'40kiRki+ZkibZ$1.5 (2ki^kiH`1 _f - a wand of mindburst (8)ki= .# #.# ##########.#........ .# #.##.#.##...^# #.# #.#.##...  #.# ### #.#.####.##. ..# #.#.# ##.#  #.## #.#.# #..# #.#####.#####.#.# #.## ............#.#.# #.###....#.###.[...##.>##.####.###..... # ..# #.# #####..## #.## #.#######<.##. # #........<.... #..#####...... #........########.##### ..........#####.....ki kiL +2.5 (1ki ki A3.5 (2ki ki 1 _h - an amulet of reflectionkikivPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)f - a ring of wizardry  kiѴg - an amulet of guardian spirit  h - an amulet of reflection Talismans (go to first with %)a - a riddle talismanki[?] describe selected [!] equip|wield|put onki[tab] equip|unequip kikiki6.# #.# ##########.#......... ludeguy the Sneak .# #.##.#.##...^.. Octopode of Gozag Gold: 154 ## #.##.#.##...... Health: 41/41 ========================#.# ####.#.####.##. Magic: 12/12 ========================..# #.#.# ##.#AC: 1Str: 8#.## #.#.# #..#EV: 13Int: 19#.#####.#####.#.# #.## . SH: 0Dex: 12............#.#.# #.###. XL:  7 Next:  1% Place: Dungeon:4kid.......@......#.###.[... Noise: ---------  Time: 4143.5 (0.0)##.>##.####.###......... c) +0 dagger (protect)# ..# #.# #####..##. Cast: Poisonous Vapours#.## #.#######<.##.##........<....#..#####...... #............. .########.#####.....# ..........#####.....#kiJ  _You now have 154 gold pieces (gained 4). _Found a stone staircase leading down. _Unknown command. _Unknown command. _f - a wand of mindburst (8) _h - an amulet of reflectionki4kikif  You start putting on your amulet.kiG+4.5 (1ki\kiki+5.5 (2kiki ki +6.5 (3kiikivki"+7.5 (4kiki*A8.5 (5ki,ki:0 5 _You continue putting on your amulet of reflection. x5  You finish putting on your amulet of reflection.  You feel a shielding aura gather around you.ki0kiZ5ki7X _h - an amulet of reflection (worn)ki 4ki!8Put on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  h - an amulet of reflection (worn)f - a ring of wizardry  g - an amulet of guardian spirit kir8MTalismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|put onki8[tab] equip|unequip kikiki.# #.# ##########.#......... ludeguy the Sneak .# #.##.#.##...^.. Octopode of Gozag Gold: 154 ## #.##.#.##...... Health: 41/41 ========================#.# ####.#.####.##. Magic: 12/12 ========================..# #.#.# ##.#AC: 1Str: 8#.## #.#.# #..#EV: 13Int: 19#.#####.#####.#.# #.## . SH: 5Dex: 12............#.#.# #.###. XL:  7 Next:  1% Place: Dungeon:4.......@......#.###.[... Noise: --------- iq7m Time: 4148.5 (0.0)##.>##.####.###......... c) +0 dagger (protect)# ..# #.# #####..##. Cast: Poisonous Vapours#.## #.#######<.##.##........<....#..#####...... #............. .########.#####.....# ..........#####.....#  _h - an amulet of reflection  You start putting on your amulet. _You continue putting on your amulet of reflection. x5  You finish putting on your amulet of reflection.  You feel a shielding aura gather around you. _h - an amulet of reflection (worn)kiki _kiUkiHd  You start removing your amulet.ki+9.5 (1kiR kiki,50.5 (2kiHkiki=+1.5 (3kiX$ki.2A2.5 (4ki2ki;ki;+3.5 (5kij@kiAB& kipBc0 _You continue removing your amulet of reflection. x5kiCkiGkijR  You finish removing your amulet of reflection.  You start putting on your amulet.4.5 (6ki5`ki:tW5.5 (7ki&xkix+6.5 (8ki̅W7.5 (9kiTkikiԑ/8.5 (10.0)kiԖkiݙ _You continue putting on your amulet of guardian spirit. x5  You finish putting on your amulet of guardian spirit.  You feel your power drawn to a protective spirit.kikikiA] _g - an amulet of guardian spirit (worn)kiF ki8J Put on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  g - an amulet of guardian spirit (worn)f - a ring of wizardry  kiJ mh - an amulet of reflection Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|put onkiJ [tab] equip|unequip ki ki= ki .# #.# ##########.#......... ludeguy the Sneak .# #.##.#.##...^.. Octopode of Gozag Gold: 154 kio ## #.##.#.##...... Health: 41/41 ========================#.# ####.#.####.##. Magic: 12/12 ========================..# #.#.# ##.#AC: 1Str: 8#.## #.#.# #..#EV: 13ki jInt: 19#.#####.#####.#.# #.## . SH: 0Dex: 12............#.#.# #.###. XL:  7 Next:  1% Place: Dungeon:4.......@......#.###.[... Noise: ---------  Time: 4158.5 (0.0)ki ##.>##.####.###......... c) +0 dagger (protect)# ..# #.# #####..##. Cast: Poisonous Vapours#.## #.#######<.##.##........<....#..#####...... #............. .########.#####.....# ..........#####.....# You finish removing your amulet of reflection.  ki You start putting on your amulet. _You continue putting on your amulet of guardian spirit. x5  You finish putting on your amulet of guardian spirit.  You feel your power drawn to a protective spirit. ki H_g - an amulet of guardian spirit (worn)ki ki _kiL ki d  You start removing your amulet.ki  +9.5 (1ki ki*# ki# ,60.5 (2kiU) kic W1.5 (3kio W2.5 (4kiv ki+w +3.5 (5ki} kiF _You continue removing your amulet of guardian spirit. x5ki kiC ki>  You finish removing your amulet of guardian spirit.  You start putting on your amulet.ki +4.5 (6ki ki A5.5 (7ki" ki֩ A6.5 (8kiȭ ki ki +7.5 (9ki ki E8.5 (10.0)ki ' 5 _You continue putting on your amulet of reflection. x5  You finish putting on your amulet of reflection.  You feel a shielding aura gather around you.ki ki X _h - an amulet of reflection (worn)kiokieCPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn) ki h - an amulet of reflection (worn)f - a ring of wizardry  g - an amulet of guardian spirit Talismans (go to first with %)kia - a riddle talisman[?] describe selected [!] equip|wield|put onki[tab] equip|unequip kiK.# #.# ##########.#......... ludeguy the Sneak .# #.##.#.##...^.. Octopode of Gozag Gold: 154 ## #.##.#.##...... Health: 41/41 ========================#.# ####.#.####.##. Magic: 12/12 ========================..# #.#.# ##.#AC: 1Str: 8#.## #.#.# #..#EV: 13Int: 19#.#####.#####.#.# #.## . SH: 5Dex: 12............#.#.# #.###. XL:  7 Next:  1% Place: Dungeon:4.......@......#.###.[... Noise: --------- kiL Time: 4168.5 (0.0)##.>##.####.###......... c) +0 dagger (protect)# ..# #.# #####..##. Cast: Poisonous Vapours#.## #.#######<.##.##........<....#..#####...... #............. .########.#####.....# ..........#####.....# You finish removing your amulet of guardian spirit.  You start putting on your amulet. _You continue putting on your amulet of reflection. x5  You finish putting on your amulet of reflection.  You feel a shielding aura gather around you. _h - an amulet of reflection (worn)9.0 (0.5ki3SI _f - a ring of wizardry (worn)kiW_kikiBki>,kiki`kiki?kikiki+ki`kiki4kijkiki2kivkiki kikiqki kifkikiFki,kiki$ki&,ki ki@ki,kiFkiski,kikiQki,ki ki ki ki kikiWki!,kikikiBkiikikikiki!ki#ki@#ki#ki%ki)Xki,,ki`-ki.ki/1ki1ki1kiJ3ki6,ki6ki8ki:ki);ki;kiF=kigA,kiBkimCkiEkiEkiFkimGkiJ,ki*KkikMkiPe  You encounter a hound.kiYUF ..# #.# #.# # #### #.# #.# # #.# #.##### # #. #.#...##  #. #..###.## #.kiU%##.####.#####.#####. #.................####.#..#................###.>##.####.###.#..### ##...## #.# kiU #.. #.### #.## #.. #.# #.. #.h #.# #..#ki!V9... #.# #h   hound (asleep)###. #.########.#kiFVd #. #..... kilV7............ki^094.0 (25.0)ki9`35.0 (26 _kioki6 ..# #.# #.#  #### #.# #.#  #.# #.#####  #. #.#...##  #. #..###.##  ##.####.### #.......... ###.#..#.......... .......@.###.>##. ###.#..### ##...## #.#  #.. #.###  #.. #.#  #.h #.#  ... #.#  ###.  #. ki)  ..# #.# #.#  #### #.# #.#  #.# #.#####  #. #.#...##  #. #..###.##  kiL* (##.####.### #.......... ###.#..#.......... .......@.###.>##. ###.#..### ##...## #.#  ki* #.. #.###  #.. #.#  ki* #.h #.#  ... #.#  ki* n###.  #. ki0 ki/1 ki8? r _A hound is nearby!ki  ..# #.# #.#  #### #.# #.#  #.# #.#####  #. #.#...##  #. #..###.##  ##.####.### ki> #.......... ###.#..#.......... .......@.###.>##. ###.#..### ##...## #.#  #.. #.### kiu e #.. #.#  #.h #.#  ki .... #.#  ###. ki 3 #. ki;  ..# #.# #.#  #### #.# #.#  #.# #.#####  #. #.#...##  #. #..###.##  ##.####.### #..........ki[ B ###.#..#.......... .......@.###.>##. ###.#..### ##...## #.#  #.. #.###  #.. #.#  #.h #.#  ... #.#  ###.  #. kiS ki ki kiސ \ _A hound is nearby!kik ..# #.# #.##. ludeguy the Sneak#### #.# #.##. Octopode of Gozag Gold: 154#.# #.##### #. Health: 41/41 ========================#. #.#...## #. Magic: 10/12 ====================----ki]l#. #..###.## #. AC: 1Str: 8##.####.#####.#####. EV: 13Int: 19#.................#. SH: 5Dex: 12kil###.#..#................ XL:  7 Next:  1% Place: Dungeon:4.......@.###.>##.####.## Noise: ---------  Time: 4195.0 (0.0)kil###.#.*### ##...## #.# c) +0 dagger (protect)#.* #.### #.## Cast: Poisonous Vapours#.* #.# #...#.h #.# #..#kim{... #.# #... h   hound (weak)###. #.########.##. #..........#kiCm`............Confirm with . or Enter, or press ? or * to list all spells.kigmAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a hound (asleep, chance to weaken: 100%)  kimThe glob of mercury hits the hound! The hound looks weaker.  The hound is heavily wounded.ki :h.ki)..kiN===6.0 (1Poisonous Vapourskiki  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a hound (asleep, chance to weaken: 100%)  The glob of mercury hits the hound! The hound looks weaker.  The hound is heavily wounded. _The hound barks!kiO ..# #.# #.##. ludeguy the Sneak#### #.# #.##. Octopode of Gozag Gold: 154#.# #.##### #. Health: 41/41 ========================#. #.#...## #. Magic: 8/12================--------#. #..###.## #. AC: 1Str: 8##.####.#####.#####. EV: 13Int: 19#.................#. SH: 5Dex: 12###.#..#................ XL:  7 Next: kiP  1% Place: Dungeon:4.......@.###.>##.####.## Noise: ===------  Time: 4196.0 (0.0)###.#.*### ##...## #.# c) +0 dagger (protect)#.* #.### #.## Cast: Poisonous Vapours#.h #.# #...#.. #.# #..#... #.# #... h   hound (weak)###. #.########.##. #..........#............Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a hound (heavily wounded, weak, chance to weaken: kiP L100%)  The glob of mercury hits the hound. The hound looks even weaker.ki :h.kiJ 8h.ki ki6 3-7.0 (1ki ki MConfirm with . or Enter, or press ? or * to list all spells.Aim  Press: ? - help, Shift-Dir - straight line: a hound (heavily wounded, weak, chance to weaken: 100%)  The glob of mercury hits the hound. The hound looks even weaker. _The hound is severely wounded.ki..# #.# #.##. ludeguy the Sneak#### #.# #.##. Octopode of Gozag Gold: 154#.# #.##### #. Health: 41/41 ========================#. #.#...## #. Magic: 7/12==============----------ki<4#. #..###.## #. AC: 1Str: 8##.####.#####.#####. EV: 13Int: 19#.................#. SH: 5Dex: 12###.#..#................ XL:  7 Next:  1% Place: Dungeon:4ki.......@.###.>##.####.## Noise: ==-------  Time: 4197.0 (0.0)###.#.h### ##...## #.# c) +0 dagger (protect)#.. #.### #.## Cast: Poisonous Vapours#.. #.# #...#.. #.# #..#ki... #.# #... h   hound (poisoned, weak)###. #.########.##. #..........#............ki<Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiuAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetkiAim: a hound (severely wounded, weak)  Poisonous fumes billow around the hound!ki3-8.0 (1ki>kiSonfirm with . or Enter, or press ? or * to list all spells.kiDAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a hound (severely wounded, weak)  ki#jPoisonous fumes billow around the hound! _The hound is poisoned. You block the hound's attack.ki $You hit the hound.  Your weapon exudes an aura of protection.ki{Skiڧ154  8 9-9Poisonous VapourskikiԯI _You kill the hound!kiw)#### #.# #.# # #.# #.##### # #.# #.#...## # #.# #..###.## ##.####.#####.###### #.................#####.#..#.................###.>##.####.# ###.#.@### ##...## #. #..# #.### #.# #..# #.# #.. #..# #.# # ...# #.# #..###.# #.#####ki**### #.# #.......... #.. . ###########ki<,0skiZ2s   scorpion (wandering)ki20-200ki7kiI9R _You encounter a scorpion.ki6<Q _You see here 6 gold pieces.ki   Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki(N-kioki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki #### #.# #.## ludeguy the Sneak#.# #.##### # Octopode of Gozag Gold: 154 #.# #.#...## # Health: 41/41 ========================kiz S#.# #..###.## # Magic: 5/12==========--------------##.####.#####.##### AC:  8  Str: 8# #.................# EV: 13Int: 19####.#..#............... SH: 5Dex: 12..........###.>##.####.# XL:  7 Next:  9% Place: Dungeon:4###.#.@### ##...## #.# Noise: ---------  Time: 4200.0 (0.0)#.*# #.### #.# c) +0 dagger (protect)ki #*.# #.# #.. Cast: Poisonous Vapours#*.# #.# #..*..# #.# #..ki [###.# #.########. s   scorpion (wandering)#.# #..........ki #.. ...........########### _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  ki5 Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiX Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a scorpion (wandering, hasn't noticed you, chance to weaken: 100%)kiij 9s.kiq -..kis ` 1 ==1.0 (1Poisonous VapourskiMy ki{  ki| Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiA| ing: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linekij| Aim: a scorpion (wandering, hasn't noticed you, chance to weaken: 100%) _The glob of mercury misses the scorpion.ki| ki c#### #.# #.## ludeguy the Sneak#.# #.##### # Octopode of Gozag Gold: 154 #.# #.#...## # Health: 41/41 ========================#.# #..###.## # Magic: 3/12======------------------ki ##.####.#####.##### AC: 1Str: 8# #.................# EV: 13Int: 19####.#..#............... SH: 5Dex: 12ki!..........###.>##.####.# XL:  7 Next:  9% Place: Dungeon:4kiB!O###.#.@### ##...## #.# Noise: ==-------  Time: 4201.0 (0.0)kif!#.*# #.### #.# c) +0 dagger (protect)#*.# #.# #.. Cast: Poisonous Vapourski!#s.# #.# #.....# #.# #..###.# #.########. s   scorpion (weak)#.# #..........#.. ...........###########ki!Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki"Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineki<"Aim: a scorpion (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the scorpion! The scorpion looks weaker.kis...2.0 (1kiNki` _The scorpion is heavily wounded.ki  #### #.# #.# # ludeguy the Sneak #.# #.##### # Octopode of Gozag Gold: 154  #.# #.#...## # Health: 41/41 ======================== #.# #..###.## # Magic: 2/12====-------------------- ##.####.#####.##### AC: 1Str: 8 # #.................# EV: 13Int: 19 ####.#..#............... SH: 5Dex: 12ki' ..........###.>##.####.# XL:  7 Next:  9% Place: Dungeon:4 ###.#.@### ##...## #.# Noise: ==-------  Time: 4202.0 (0.0)kiL #.s# #.### #.# c) +0 dagger (protect) kio#..# #.# #.. Cast: Poisonous Vapours #..# #.# #..ki ...# #.# #.. ###.# #.########. s   scorpion (weak) #.# #.......... #.. ........... ###########Casting: Mercury Arrow (safe; 1% risk of failure)  ki7Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  kiYPress: ? - help, Dir - move targetAim: a scorpion (heavily wounded, weak)  ki|3Poisonous fumes billow around the scorpion!kiw #### #.# #.#  ki[#.#   ki?#.# #.#...##  #.# #..###.## kit ##.####.##kir # #......... ki3####.#..#.... ....kiy###.> ###.#.@###  ki #.s# #.###  #..# #.#  #..# #.#  ki...# #.#  ###.# kiY poisoned, weak) ki2#.#  #.. ki8R3==-kig3.0 (1kikionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a scorpion (heavily wounded, weak)  kiUPoisonous fumes billow around the scorpion! _The scorpion is poisoned.kiA  You hit the scorpion.  Your weapon exudes an aura of protection.  Your grab misses the scorpion.  The scorpion is almost dead.  The scorpion stings you.  You are poisoned.ki &39ki% ======-- 8 -4Pois kiH ki۽ ki1 o _The scorpion poisons you! The scorpion barely misses you.ki< v $You hit the scorpion.ki s You kill the scorpion!kiZ ki 01546ki ---==235Poisonous Vapourski ki' T _You feel very sick.ki ( >You now have 160 gold pieces (gained 6).ki( &60ki( O4----6.0 (2kix- ki/ $ _You feel sick.ki U  ####ki!...##.###.### ##.####.#####.#####.#.................####.#..#.................###.>##.####.# ###.#..### ##...## ki7! #.@# #.### . #..kiQ!'.kii!(###ki! ki(ki)63--ki*+-7.0 (1ki%/kii6c _You feel sick.  You now have 166 gold pieces (gained 6).ki77%6kiX7;2-8.0 (2kiY:ki;$ _You feel sick.ki-M#### #### #...##  #.# #..###.## # ##.####.#####.####kio #.#.........#####.#..#.........................###.>##.###ki4###.#.@### ##...#### #.##...# #.# #..ki3kiF###kiWD ki ki #1ki -ki- 6 1 9.0 (1kiBkiN$ _You feel sick.ki73kiCkiȲ _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiyVkiWkiWki[ki^j4==kiud _You feel sick.0-kig3 _You feel sick.ki'h`29=--ki6ikilmI _You feel sick.  You feel sick.kin8=-kimpj _You are no longer poisoned.kip69==kipkiqkiskiskitki\wkiwki@xkizkizkir{ki~kim~830=ki~M5==kigkikiNkikikiki`ki<kickiˆkiNkiz1====kiIki},kiki9ki`ki̎kidkiki kiki(Q2=6kiC1==kikikikiki8ki`kikikiBkikiki53=kiǞ3==ki2ki*kiSkikiQkixkikiPkiwkiʧkikim#4kic=7==kiRkiǮkikiki,kiki·kiki"D5=kiӸkiki:==kiki&Bki,kikiki`kivK6==kiG8==ki<ki kiQkiki%kiakiiki},kikikia7===ki2ki+ki`kiki,kikikikikihki#8kiY=9==kikihkikikkiqkikizkiki*kikiXki#9kiE===kikikiXkiNkikikikir,kikikiki7O40=10/12kiU)==ki kikiki^kiki)kiki ki h1==ki ki~ 1 _HP restored.ki :==kiFkikikiOkikikiPkikiMR=1==kiqkikij,kikikiki=ki,kiCki_f==kiO.ki.ki7/ki12,ki2kiV6ki~6ki97ki9ki:#2ki2:)==ki;kiSAXki@BkiDki4EkiEkiFkiAKBkiKkiNkiN:==kihOkiPkigRkiRkiRkiTki:VkibVkiVkiWkiZBki[ki^kiA_,ki kkioXkisBki)tkiukiwkiwki4xkiyki{ki{kiD|ki}kikiki^kiցki:kiZki݃ki_kiՇkikiوkikikiҋki+kikikiˎki&kikiZ,kikilki1,kikivkikikikiwkio,kiԛki֜ki,kikiki ,kinki+ki,kikiki&kiIkikikiSkiӪkikikickikiBkiqki"kibkikikikiȹkiikiki?kiikiʽkikiN,kiki.ki,kikikikikikikiJkitkiLkiki,kieki!ki,kiki<82kizkiN _You now have 182 gold pieces (gained 16).ki3kieki`ki,ki@kiHki,kikiki<ki\kiki     ki ...   ...  kid ..  ki- .# .  kiD ####.###..  kil #@...#.... #  ki  #......... #.#.#  #.........# #...  # ##..##.##.# ####  #.##..##.##.. #  #...........#ki  ####..##.##.## ki #..##.##..# ki-a #.........#kiT231607.0)ki,78kiki Z _o - a murky coppery potionki{kikiYkikikiBki ki ki ki kiL"  #.....#.. .....#. ......  ....  >..  #.# .  ####.###.. # #...@#.... # ###9.0 (2.0)ki* #.........# #.#.##... #.........# #... # ##..##.##.# ####... #.##..##.##... ##. #...........# #.#  ####..##.##.## #[# ki s #..##.##..# #[#  #.........# #<# ki kij,20.0 (3ki"kiA%; _Found a stone staircase leading down.kikiki@kikikikikikikirkiEkiSkiki  ki ki.0You encounter a ribbon worm.kihkij #.#  #.# ###.### ####.....#...####.....#.##w.......... #.....#   #.>@..#  ###.### . ####.###.. # #....#.... # #### #.........# #.#.##... #.........# #........ w   ribbon worm (asleep)##..##.##.#.##..........kiR+2.0 (2ki 23.0 (3 _kiVkiki  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki6 4ki ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiQ   .#  #.#ki\  #.#   ###.### ###  #.....#...kiy  ####.....#.##ki  #w..........#  #.@...#  #.>...#   ###.### .   ####.###..  #....#.... # ### ki #.........# #.#.##  #.........# #....  # ##..##.##.# ####..  #.##..##.##...#.kikic24.0 (1 _kiZkiEkiV    ki! .#  #.# kiRw #.#  kir ###.### ###  #.....#...ki  ####.....#.##  #w..@.......#ki  #$##.....#.. ki"  #.>...#   ###.### . kip0 ####.###..  #....#.... # ## kiy #.........# #.#.##  #.........# #....  # ##..##.##.# ##kiki#ki#?5Poisonous Vapourski(ki+* _Found 9 gold pieces.kia! ludeguy the Sneak Octopode of Gozag Gold: 182 .#kibnHealth: 41/41 ======================== #.#Magic: 10/12 ====================---- #.#AC: 1Str: 8 ###.### ###EV: 13Int: 19 ki,b#.....#...SH: 5Dex: 12kiRb  ####.....#.##kivb XL:  7 Next: 23% Place: Dungeon:4  #w**@.......#kibNoise: ---------  Time: 4325.0 (0.0) kib #$##.....#..kib_c) +0 dagger (protect) kib#.>...#Cast: Poisonous Vapours kicd###.### . ki...#  ###.### .   ####.###..  #....#.... #  ki+L #.........# #.#.##  #.........# #  # ##..##.##.# ####ki2kiz3.-7ki7ki:9 _You block the ribbon worm's attack.ki^  You barely miss the ribbon worm. You grab the ribbon worm.  The ribbon worm is moderately wounded.ki_@-8kidkiZfx _You constrict the ribbon worm. The ribbon worm closely misses you.ki߽ catching breath, weak)The ribbon worm is moderately wounded.ki7You constrict the ribbon worm. The ribbon worm closely misses you.  You hit the ribbon worm.  Your weapon exudes an aura of protection.  The ribbon worm is severely wounded.  ki  `````The ribbon worm expels a string of sticky webbing.kiJ<@....kiYKM 8 9kiQki3SW _The stream of webbing misses you.kiw $You hit the ribbon worm.kiRki182 30Poisonous VapourskikipO _You kill the ribbon worm!kim4     .#  #.# ki4  #.#  ###.### ###  #.....#...ki4  ####.....#.##  #..#ki#5  #$##.....#..kiJ5  #. #.>...#  #S ##kiu5 #.### .  #.####.###..ki5 T  #.#....#.... # S   adder (asleep)  #.#ki5 (.# #.#.#ki5 ki6   #.#.# #....ki/6 kiN6   # ##..##.##.# ki@ ki&A .-1kiCA Poisonous VapourskiE kiF : _You encounter an adder.kiG kiH Q _You see here 8 gold pieces.ki5*  .# #.#  #.# ###.### ###  #.....#...  ####.....#.##  #.$.........#  #@##.....#..  #.##.>...#   #S####.### .  #.####.###..  #.#....#.... #ki*  #.#.........# #.#.  #.#.# #...  #.##..##.##.# ##  #.##..##.##...kiG3ki4G-2 _ki8ki9Q _You see here 9 gold pieces.ki2).#####.### ###.....#... ####.....#.##.$.........$##.....#.. >...# kiv)S####.### .......#..#.....# #.#..ki)Z#..##.##.# ##..ki)5..........#ki1ki2#1ki2==ki2&3 _ki6kiG8ki8 $The helpless adder fails to defend itself.  You puncture the adder!ki8@ )kiB ==64Poisonous VapourskiCF kiJH I _You kill the adder!kiюF #ki2###.### ###.....#... #####.$.........$##.....#.. .##.>...# ki]x##.### .......#..ki##..  ####..##.##.##kiLkiw&5kiokiFkiڢG96.0 (2kikiȨ> _You now have 189 gold pieces (gained 7).kiM  #.# ##.### ### ..###.....#.#.$.........#$##.....#..ki!r.>...# . ###.###   #.#....#.... ##..kiki=> 1 7.0 (1kikickiOM   #.# ##.### ###kiCP #.....#...###.....#.#.$.........#....#...##.>...# .kicP.  kiP #.####.###..#.#kiUkiU&8kiYki^ki^$98ki^$9.0 (2kiRakid> _You now have 198 gold pieces (gained 9).ki"    .#  #.#   #.#  kip###.### ### #.....#...  ####.....#.##  #.@.........# #.##.....#.. #.##.>...# ki #.####.### . #.####.###..ki #.#....#.... #kiѨx #.#.# #.#.#ki  #.#.........# #.... ki  #.##..##.##.# ### kiki [2==40.0 (1kikiki82061.0 (2kiNkiֿ> _You now have 206 gold pieces (gained 8).ki ki kid kiB kij kiI Bki  ,ki ki~ kif ki :==kiF! ki" kii% ki% kiU& ki' kic+ ,ki, ki`- ki!1 ki6 ki7 kiG9 ki?< ki< ki< kiJ> kiF XkiL ,kiL kiM kiP kiP ki\Q ki>S ki+V kiRV kiV ki;X kiZ kiZ ki5[ kiR\ ki] ki%^ kie^ ki;_ ki` ki6a ,kia ki3c ki[c kic kil kif ki ki ki' ki kia kiË ki݌ kiՏ ki ,kiR ki ki kiK ki ki ki ki@ ki ki %  kiԛ AYou encounter an adder.ki_ O     ###  ##.######  #.......#  ##.####.# ####.  #.# #.#..S...  #.# #  #.# ###.#####  #.### .# # #...# # ### ###.# .. #.#S   adder (wandering) ###.### ###kiݭ #.....#... ####.....#.## .ki b.S63.0 (22.0)kiJ C.Skiv I4.0 (23 _ki ki ki*"i ### ### #.......# ##.####.# ####.  #.# #.#....S.  #.# #@.......  #.# ###.#####  #.### .#  kiq"y#...# #  ###.# #.# ###.### ###  #..ki"O  ####. kiS ### ### #.......# ##.####.# ####.  #.# #.#....S.  #.# #@.......  #.# ###.#####  #.### .#  #...# #  ###.# #.# ###.### kim #.. ####. kivkiؾkiki] _An adder is nearby!ki.&1 ### ### #.......# ##.####.# ####.  #.# #.#....S.  #.# #@.......  #.# ###.#####  #.### .#  #...# #  ###.# #.# ###.### ###  #..  ####. ki  ### ### #.......# ##.####.# ####.  #.# #.#....S.  #.# #@.......  #.# ###.#####  #.### .#  #...# #  ###.# #.#ki ###.###  #.. ####. ki} ki ki ki ] _An adder is nearby!kif  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki0 4ki-:  _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiW     ###  ##.######  #.......#  ##.####.######.# #.# #.#....S. #.# #. #.# ###.# #.### .# #  #...# .# ###.   ###.# .#.   #.# ...   ###.### ### #.. ####.....#.## .#S.ki8 ki /5.0 (1.0) ki) _ki< ki ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki>4kiki  Casting: Mercury Arrow (safe; 1% risk of failure)kieonfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failureki&V)onfirm with . or Enter, or press ? or * to list all spells. kiJ_You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki3 ###  ##.###### ki. #.......#  ##.####.######S#. #.# #.#. ki{#.# #.# ki#.# ###.######. #.### #.# kiC{#  #...# # ###.# #.# ...# #.# #.. kiou. ###.####### ki`# #.....#... kiv# ####.....#.## .#kikiQ.Ski%ki'-6 _kim+ki?-kiB&y### ##.###### #.kiq&# ###.####.######.#.#ki&#.# #.#......S.##.# #.ki&"##ki&y#.# ###.######.#ki&{.#.### #.# ki&}# #...# #.#ki&!ki'###.# #.# ...#ki'#.# #.. .###.####### ki#'<#.#.....#... ki5'h#.####.....#.## .#ki(9S.ki*.ki-Rki//&7ki1kiM3kiP ### ##.###### #.# # ##.####.######.#.# #.# #.#.# #.# #.# ##.# ###.######.# .#.### #.# # ##...# #.# ki ###. ####.# #.# ...##.# #.. ...####.####### #.##.....#... #.####.....#.## .###.ki 2Ski S   adder (wandering)kiq &8ki ki ki{### ##.###### ##.# .# ###.####.######.#S# #.# #.#.# #.# #.# ### #.# ###.######.# .#.### #.# # #.#...# #.# ###. #.###.# #.# ...##.# #.. ...#.###.# #.#.#.....#... #.####.....#.## .###.#.S9Poisonous Vapourskiki ki*  ludeguy the Sneak  Octopode of Gozag Gold: 206  Health: 41/41 ======================== ###ki Magic: 10/12 ====================----  ##.###### #  AC: 1Str: 8  #.......# .# #  EV: 13Int: 19 ki ##.####.######.#.#  SH: 5Dex: 12 #.# #.#......$.#  XL:  7 Next: 26% Place: Dungeon:4 #.# #.....@....# ###  Noise: ---------  Time: 4369.0 (0.0)ki #.# ###.######.# ... c) +0 dagger (protect) kiO#.### #.# # #. Cast: Poisonous Vapours #...# #.# ###. #.kit- ###.# #.# ...#### ki#.# #.. ...#. S   adder (wandering) ###.####### #.#. #.....#...kiѳ2#...  ####.....#.## .###.#kiCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineki<Aim: an adder (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker.kii ### kiƷ  #   .# #  kiڷ7#  kiL#.# #.kin*$.#  ki=#.# #.....@*...# ###  kiU_#.# ### kij ki #.### #.# #  #...# #.# ###.  kia###.# #.#  kiĸZ#.# #.. ki     ki7   ki/)  ki?ki <'..ki>206 8==70.0 (1Poisonous VapourskiDki`Gonfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an adder (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker. kiG>_You kill the adder!kiO  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki 4kil ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki ### ####.###### .# #.# .# # ##.####.######.#.# #.# #.#......$.# #.# #.# ### #.# ###.######.# ... ki #.### #.# # #.##...# #.# ###. #.###.# #.# ...##.# #.. ki T...#.###.# #.#.kiA #.....#... #...#####.....#.## .###.#kiLki6--1 _kiKki`kiZ3r### ### ##.##.###### ..# .##.# #.#.# ###.####.######.#.# ##.# #.#......$.# ##.# #.# ### ##.# ###.######.# ... ##.### #.# # # #.##...# #.# ###. #.###.# #.# ...#####.#.# #.. ...#...###.# #.#...#.....#... #...## ####.....#.## .###.##ki*4ki4A--2ki^7ki8ki1### ####### .##.###### ..#.. #.#.# #.#.# #.##.####.######.#.# #.#.# #.#......$.# #.#.# #.# ### #.#.# ###.######.# ... #.#.### #.# .# # #.##.#...# #.# .# ###. #...####.# #.# .# ...#####.#.# #.. .#...#...####.# .##.#.#.....#... ..#...# kikiE&3kigkiki/4 ^M  ### #######.#.###### ..#.........# #.###.####.######.## .........###  ###.######ki4 ^ ... #.### #.# .# # #.##... ki; ki< &4ki"@ kiE kiJF H125.0 (2kiI kiL > _You now have 212 gold pieces (gained 6).kickiXf Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft6% 1b - Olgreb's Toxic RadianceAlchemy9% 4  c - Sigil of BindingHexes17% 3  d - Sticky FlameFire/Alchemykif21% 4 6 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitki3 ludeguy the SneakOctopode of Gozag Gold: 212 Health: 41/41 ========================Magic: 10/12 ====================----##########.. AC: 1Str: 8  ##.###### ..#..#. EV: 13Int: 19  #.......# #.#.##. SH: 5Dex: 12  ##.####.######.#.##. XL:  7 Next: 28% Place: Dungeon:4#.# #.#......@.##. Noise: ---------  Time: 4375.0 (0.0)#.# #..........#### #. c) +0 dagger (protect)#.# ###.######[39;4ki 9m.#... #. Cast: Poisonous Vapours#.### #.# .# # #.##.#...# #.# .# ###. #...####.# #.# .# ...#####.. #.# #.. .#...#...# ###.####### .##.#.... #.....#... ..#...### The glob of mercury hits the adder! The adder looks weaker. _You kill the adder!Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You now have 212 gold pieces (gained 6).ki P  Okay, then.kie ki ki . _ki6kia Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b + Mercury ArrowConjuration/Alchemy 1% 2 c - Mephitic Cloudkip-Conjuration/Alchemy/Air 4%3 Select a spell to describe [?] help [!]/[I] toggle spell headerskiRki0ki<ludeguy the SneakOctopode of Gozag Gold: 212 Health: 41/41 ========================Magic: 10/12 ====================----##########.. AC: 1Str: 8  ##.###### ..#..#. EV: 13Int: 19  #.......# #.#.##. SH: 5Dex: 12  ##.####.######.#.##. XL:  7 Next: 28% Place: Dungeon:4#.# #.#......@.##. Noise: ---------  Time: 4375.0 (0.0)#.# #..........#### #. c) +0 dagger (protect)#.# ###.######ki.#... #. Cast: Poisonous Vapours#.### #.# .# # #.##.#...# #.# .# ###. #...####.# #.# .# ...#####.. #.# #.. .#...#...# ###.####### .##.#.... #.....#... ..#...###  _You kill the adder!Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You now have 212 gold pieces (gained 6). _Okay, then.kiki@kikiv ki Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft6% 1b - Olgreb's Toxic RadianceAlchemy9% 4  c - Sigil of BindingHexes17% 3  d - Sticky FlameFire/Alchemy21% 4 6 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exit ki  ki  kib ludeguy the SneakOctopode of Gozag Gold: 212 Health: 41/41 ========================Magic: 10/12 ====================----##########.. AC: 1Str: 8  ##.###### ..#..#. EV: 13Int: 19  #.......# #.#.##. SH: 5 ki] sDex: 12  ##.####.######.#.##. XL:  7 Next: 28% Place: Dungeon:4#.# #.#......@.##. Noise: ---------  Time: 4375.0 (0.0)#.# #..........#### #. c) +0 dagger (protect)#.# ###.######.#... #. Cast: Poisonous Vapours#.### #.# .# # #.##.#...# #.# .# ###. #...####.# #.# .# ...#####..  kiW #.# #.. .#...#...# ###.####### .##.#.... #.....#... ..#...###  _You kill the adder!Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You now have 212 gold pieces (gained 6). _Okay, then. ki  ki Memorise Olgreb's Toxic Radiance, consuming 4 spell levels and leaving 2? Y - Yes  ki ' N - No ki kiludeguy the SneakOctopode of Gozag Gold: 212 Health: 41/41 ========================Magic: 10/12 ====================----##########.. AC: 1Str: 8  ##.###### ..#..#. EV: 13Int: 19  #.......# #.#.##. SH: 5Dex: 12  ##.####.######.#.##. XL:  7 Next: 28% Place: Dungeon:4#.# #.#......@.##. Noise: ---------  Time: 4375.0 (0.0)#.# #..........#### #. c) +0 dagger (protect)#.# ###.###### kiި9.#... #. Cast: Poisonous Vapours#.### #.# .# # #.##.#...# #.# .# ###. #...####.# #.# .# ...#####.. #.# #.. .#...#...# ###.####### .##.#.... #.....#... ..#...###  _You kill the adder!Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You now have 212 gold pieces (gained 6). _Okay, then.6.0 (1 kiB kiu _This spell is quite dangerous to cast! kiZ1==7.0 (2 ki ki^ ki+8.0 (3 ki3 ki kiS+9.0 (4 ki  ki ki,80.0 (5 ki& ki _You start memorising the spell. You continue memorising. x4 ki ki kic _You finish memorising. Spell assigned to 'd'. kiD  kiTH   Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   0.0   1.0   0   f + Spellcasting 3.4   4.8  -1           kiH d b - Unarmed Combat   0.0   1.0   0   g + Conjurations 3.2   4.0   0      h + Alchemy4.7   4.2  +1   c - Short Blades   0.0   1.0   0   i + Air Magic1.7   2.0   0   kiH         d + Dodging kiI 3.7   4.0   0   j - Evocations   0.0   0.8  +1  e + Stealth ki?I 5.2   3.0  +4   k - Shapeshifting   0.0   1.2  -1       kimI          kiI          ki#J                              kiPJ              kitJ          kiJ     The relative cost of raising each skill is in cyan.  kiJ The species aptitude is in white.  [?] Help[=] set a skill target  kiJ [/] auto|manual mode [*] useful|all skills [!] training|cost|targets ki ki kiludeguy the SneakOctopode of Gozag Gold: 212 Health: 41/41 ========================Magic: 11/12 ======================--########## ki-... AC: 1Str: 8  ##.###### ..#..#. EV: 13Int: 19  #.......# #.#.##. SH: 5 kiDex: 12  ##.####.######.#.# ki#. XL:  7 Next: 28% Place: Dungeon:4#.# #.#......@.##. Noise: ---------  Time: 4380.0 (0.0) ki0#.# #..........#### #. c) +0 dagger (protect) ki#.# ###.######.#... #. Cast: Poisonous Vapours#.### #.# .# # #.##. kiS#...# #.# .# ###. #...####.# #.# .# ...#####..  ki#.# #.. .#...#...#  ki*u###.####### .##.#....  kiLj#.....#... ..#...###   kiG_You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You now have 212 gold pieces (gained 6). _Okay, then. _This spell is quite dangerous to cast!  ki_You start memorising the spell. You continue memorising. x4 _You finish memorising. Spell assigned to 'd'. ki? ki ki, ki ki0  kiY1  kiG2  ki5  ki9 f _ ki9  ki<  ki=  ki=  ki@  kihA , kiJ 2==212 kiL  kiM  kiDM  kiN  kivQ , kiR  ki$S  kiU  kiU :== kiXV  kiZW  kiY  kiZ  kivZ  ki[  ki]  ki]  ki{^  ki~_  kigd X kie  ki;e  kie  kif  kiEi  kii  kii  kik  kil  kim  kim  kiRn  kip  ki.q  ki_q  kir  kit  ki`t  kit  kiu  kiOw  kiw  kiw  kix  kiz , ki#{  ki|  ki@~  ki~  ki~  ki  ki  ki , kiƃ  ki~ B ki?  ki  ki$  ki  ki׊  kiҌ , ki#  ki7  ki  kib  ki  ki  kiY , kiÓ  ki  ki  ki˖  ki  ki<  kiԙ  ki  kiL  ki  kiМ  ki  kiM  ki  ki  kiס  ki  ki  kiӤ  ki  ki]  kih  ki , kiE  ki  ki  ki!  kie  ki  kiF , ki  ki۰  ki2  kia  ki۳  ki  kib  ki  ki"  ki  ki , ki  ki  ki  ki½  ki-  ki  ki  kiW  ki  ki  ki2 , ki5  ki0  ki , kiq  ki  ki  ki  ki  ki  ki  ki  ki  ki+  ki  ki"  ki  ki  ki  kiP  ki<  kin  ki  ki  ki  ki  ki]  ki  ki7  ki!  ki6  kim  kiF  ki  ki  ki n ki1  ki  kiG , ki  ki   ki B ki4  ki  ki.  ki+  ki"  ki  ki  ki  ki_  ki* , ki , ki , kiY  ki,  ki  ki  kit  ki0  ki; , ki  kim  ki"  ki"  ki#  ki$  kit+ X ki+ f  You encounter an adder. ki/ ...#....####### #######........ ..# ...#....####### #.# ##.#.#####.# ##.#.# #.#############  ki30 w.....# #.#........... .....# ######.#.########### ####.# #...##.#.#  kiU0 #.# ###.#@##...#  ki{0 #.#######...#...#######  ki0 G #.##......#####...S....  #.##.####...#...#######  ki0 .###.##.# ###.#.............  ki0 /........######...#########... S   adder (wandering) ............###.##  #.# ki1  ####.######.# #.#  ki=1 # #:# #.# #### ki1 14460.0) ki9D f1.0 (61 _ ki.B...#.... ..# ...#.... #.# .#.#### #.# .#.# ..# .# #####.# #...##.#.#  #.# ###.#@##...#  #....#...#  #.##......#####...S....  #.##..####### .##.# . ....## kiB . #.#  #.# #.#  #..# #:# #.#  ki ...#.... ..# ...#.... #.# .#.#### #.# .#.# ..# .# #####.# #...##.#.#  #.# ###.#@##...#  #.ki...#...#  #.##......#####...S....  #.##..####.##.# .ki@....## .  #.#  kii #..# #:# #.# kiki^kikiX ki{O_An adder is nearby!kiU...#.... ..# ...#.... #.# .#.#### #.# .#.# ..# .# #####.# #...##.#.#  #.# ###.#@##...#  #....#...# ki . #.##......#####...S....  #.##..####### .##.# . ....## . #.#  #.# #.#  #..# #:# #.#  kiQD...#.... ..# ...#.... #.# .#.#### #.# .#.# ..# .# #####.# #...##.#.#  #.# ###.#@##...#  #....#...#kiQ0  #.##......#####...S....  #.##..####.##.# .....## .  #.#   #..# #:# #.# kiUkiuUki XkibZ] _An adder is nearby!ki7######........ ..# ..#....####### #.# #.#.#### #.# .#.# #.############## ....# #.#..............# ######.#.############ ki8Q###.# #...##.#.#  #.# ###.#.##...# #.#######...#.@.########.##......#####...S.... ki>8#.##.####...#...####### ###.##.# ###.#............. .......######...#########kic8..........###.## #.# ###.######.# #.# ki8  #..# #:# #.# #.#ki8####.## #.# #.# #.##.ki8kiE<4S.ki=p SThe adder hisses angrily.ki=,S.kiCSS   ball python (constriction, wandering)kiC*=2.0 (kiD(1.0)Poisonous VapourskiHkiJ kiJN_You encounter a ball python.ki\######........ ..#  ludeguy the Sneak ..#....####### #.#  Octopode of Gozag Gold: 212 #.#.#### #.#  Health: 41/41 ======================== #.#.# #.############## Magic: 10/12 ====================---- ....# #.#............. AC: 1Str: 8 ....# ######.#.############ EV: 13ki(Int: 19 ###.# #...##.#.#  SH: 5Dex: 12  #.# ###.#.##...#  XL:  7 Next: 28% Place: Dungeon:4  #.#######...#.@.#######  Noise: =--------  Time: 4442.0 (0.0)  #.##......#####$S......  c) +0 dagger (protect)  #.##.####...#...#######  Cast: Poisonous Vapours ###.##.# ###.#............. ki.......######...#########... ...........###.## #.#  S   adder ###.######.# #.# #.#  S   ball python (constriction, wandering) ki&O #..# #:# #.# #.####  #.## #.# #.# #.##.## kiNConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  kirPress: ? - help, Shift-Dir - straight lineAim: a ball python (wandering, hasn't noticed you, chance to weaken: 100%)  kiThe glob of mercury hits the ball python!  The ball python looks weaker. The mercury splashes! The adder looks weaker.ki  ..#  #.#  #.#  kiO   # #  #.# # kir !   ki ....  ####  ki Y #.# (weak)ki ; #.#  ki #..# #:# #.#  ki1 #.## #.# #.# ki5S.ki)kiT212 =3.0 (1ki4ki  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a ball python (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the ball python!ball python looks weaker. The mercury splashes! The adder looks weaker. _You kill the ball python!ki| r######........ ..#ludeguy the Sneak ..#....####### #.#Octopode of Gozag Gold: 212 #.#.#####.#Health: 41/41 ======================== #.#.##.############## Magic: 9/12==================------ ....##.#............. AC: 1Str: 8 ....#######.#.############ EV: 13Int: 19 ###.##...##.#.#ki1 %SH: 5Dex: 12#.# ###.#.##...#XL:  7 Next: 28% Place: Dungeon:4#.#######...#.@S#######Noise: ==-------  Time: 4443.0 (0.0)#.##......#####$.......c) +0 dagger (protect)#.##.####...#...#######Cast: Poisonous Vapours ###.##.# ###.#............. .......######...#########... ...........###.###.#S   adder (poisoned, weak) ###.######.# #.#ki #.##..# #:# #.##.#####.## #.# #.##.##.##Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an adder (weak)  Poisonous fumes billow around the adder!ki 3-4.0 (1ki# ki Sonfirm with . or Enter, or press ? or * to list all spells.ki- vAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an adder (weak)  Poisonous fumes billow around the adder! _The adder is poisoned. You block the adder's attack.kid Poisonous fumes billow around the adder! _The adder is poisoned. You block the adder's attack.  You hit the adder.  Your weapon exudes an aura of protection.  Your grab misses the adder. Your squeeze misses the adder.  The adder is almost dead.kiZeg 8 -5ki kkiom= _The adder bites you but does no damage.kicq $You hit the adder.ki(ki&j306Poisonous VapourskifkimI _You kill the adder!kiw~. ..# #....# #.# .#.#### #.# # .#.# #.## #.#.# ######.#.##.# #...##.#.# ##.# ###.#.##...#  #.#...#..@#######  #.##......#####$.  #.##.####...#...# .##.# ###.#..ki;######...#######.#.######.# #. #..# #:# # kiki.-7kikiki?a8-8.0 (2kiki> _You now have 218 gold pieces (gained 6).ki+g Jkih kir  .#....####### ##### # ############# ................######.#.############# ###...##.#.#  ###.#.##...# ######...#...#######......#####@.......####...#...####### # ###.#................##### #.#.# #.##.#.#.##10/12==9.0 (1ki r24 1 50.0 (2ki_ ki > _You now have 224 gold pieces (gained 6).ki3ki,ki&Xkiki/kiki:==kikikikikiv,kiykiki*224kikikiN61==kipki*ki,ki%kikikikikikikiki9:==kiki|,ki`ki}kikiqkiki2==kinBki==kikikikikiki",ki#kiG*ki|-ki-ki.ki0ki'3kiU3ki4ki?ki@kiBki.CkiCkigEki@G,kiHkiKki)LkiLkiOq _c - 6 potions of curing (gained 2)kiQkiNQkiQkiSki?UkiUki VkiVkiYkiYki^ZkiO[ki]ki.^ki.hkij,ki0lkidlkimki4okierkirkirki&tkidvkivki}kiBkikiԉkiXkiXkikikibki+kixkiki1kikiFkiki kiݥkiFkikikiki kiJkiخkiUkikiܳkiUkikiki\ki͹kikiȿv  You encounter an orc priest and an orc.ki9T ####.# kij  #.#  ki### ##.## #####  kiS..# ######...####...#  #.# #...............#  #kiE.# #.####...####...# #.########.# ##.## ##.##ki% #..........# #.# #.#kiE ###########kie># #.# ki### #.....oo..# #.# #ki.## #.######### #.#  Poisonous Vapourskip#.## #.#...##########.#  kiP###.####...†............#  # ##.##........##########   o   orc priest (wandering)ki ##....#.......#   o   orc (wandering) ki`.#..###........#  ....###........#  kil099.0 (49.0)ki,500.0 (50 ki _kikiki}  #.# ##.## ##### ..# ######...#ki؎0 #.# #........ #ki,.# #.####... #.kiB.# ##.## ##.## #..........# #.# #.# ki$,#@# #.# kiCT #.....oo..# #.# kio^ #.######### #.#   † # ki# ki"ki# [  #.# ##.## ##### ..# ######...# .# #........ .# #.####... ..# ##.## ##.## kiO$ V..........# #.# #.# #@# #.#  #.....oo..# #.#  #.######### #.#   kiu$ 9† ki$ ,  ki$ ki* ki* ki/ kim1  ki1 V_There are monsters nearby!kiP >  #.# ##.## ##### ..# ######...# #.# #........ #.# #.####... #..# ##.## ##.## #..........# #.# #.# #@# #.#  #.....oo..# #.#  #.######### #.#   † #  ki| "  #.# ##.## ##### ..# ######...# .# #........ .# #.####... ..# ##.## ##.## ..........# #.# #.# #@# #.#  #.....oo..# #.#  #.######### #.#   †   ki ki ki ki d _There are monsters nearby!kiG###########.#  ludeguy the Sneak#.#  Octopode of Gozag Gold: 224 #####.## #####  Health: 41/41 ======================== ..#######...####...#  Magic: 10/12 ====================---- #.##...............#  AC: 1Str: 8 ki#.##.####...####...#  EV: 13Int: 19 ki-#.########.# ##.## ##.##  SH: 5Dex: 12 ki۝#..........# #.# #.#ki  XL:  7 Next: 30% Place: Dungeon:4 ################@# #.#ki#  Noise: ---------  Time: 4500.0 (0.0) kiG### #.....oo*.# #.#ki{  c) +0 dagger (protect) #.## #.######### #.#  Cast: Poisonous Vapours .#.## #.#...##########.# kiО4###.####...†............#kiE # ##.##........##########ki   o   orc priest (weak) ki,###....#.......#  o   orc (wandering, weak) kiJ7.#..###........# ....###........#kik kiAiming: Mercury Arrow (safe; 1% risk of failure)  ki;Press: ? - help, Shift-Dir - straight linekiʟAim: an orc priest, wielding a +0 club (wandering, hasn't noticed you, chance  to weaken: 100%)  kiwThe glob of mercury hits the orc priest.  The orc priest looks weaker. The mercury splashes! The orc looks weaker.kis#A.oki+,J==1.0 (1ki01ki'4  Press: ? - help, Shift-Dir - straight line  Aim: an orc priest, wielding a +0 club (wandering, hasn't noticed you, chance  to weaken: 100%)  The glob of mercury hits the orc priest.orc priest looks weaker. The mercury splashes! The orc looks weaker. _The orc priest is heavily wounded.ki^} .# #. kiz^Z..# ##.## ##.## ..........# #.# #.# ki^#@# #.#  #.......$.# #.# ki_H #.######### #.#   †    ki)_k  kibh8=---6.0 (1kib;Poisonous Vapourski:gkii  Aiming: Poisonous Vapours (safe; 1% risk of failure)  kiiPress: ? - help, Dir - move target  Aim: an orc, wielding a +0 falchion and wearing a +0 scale mail (heavilykii8wounded, poisoned, weak)  kijPoisonous fumes billow around the orc! The orc looks even sicker. _You kill the orc!ki@ #.# ######.## ##### ...#######...####...# .#.# #...............# .#.# #.####...####...# .#.########.# ##.## ##.## ki A#..........# #.# #. ################.# #.#  #.......@.# #.# .## #.######### #.# .## #.#...##########.# ki(A##.####...†............# ##.##........########## .###....#kiDAr.#.#..##.#....###kiXA\.# ##.#.##..~~~..#.#kiki#3ki\=----7ki ki{k  You now have 250 gold pieces (gained 26).  Things that are here:ki6506ki=G==-8.0 (2kirki_ _a +0 falchion; a +0 scale mail; a +0 clubki6[ki[ki6`kic$  Things that are here:kid _a +0 falchion; a +0 scale mail; a +0 clubkiG kiVG kicH ki K kiM : _ki,P kiP #4kiP 2=kiQ kiS kiiT ki8U kiW kiX kiX 3==kiY kiZ kiB[ ki\ ki^ ki^ ki^ #250ki^ 5=ki^ ki_ kia kiTb N7==ki,c ki[e kie kif kih kih kii kil kiSl h6==kiKm kio kip $==kiJp kiq kips kis kit kiv kiv kiw kiy kiz U7=kiP{ ki.} kir} 88==ki} ki~ kiр ki ki ki kib ki3 ki< ki 58=kiЇ ki ki ki :==ki kim kiŽ ki ki ,ki ki 9=9==kiԛ ki< kid kiI ki kim kij ki $40kiТ (=ki ki ki :==ki ki ki, kiD kiQ ki h1==kiխ kif f10/12==ki kib ki ki ki ki* ki ki kiT 9=kiY kiy kiܽ $==ki ki ki kiU ki= ki5 kim kiB kib ki ki ki ki L1==ki ki1 kif ki ki> ki ki? ki5 kij ki* ki9 kiw :==kiC ki6 ki kim ki ki ki ki ,ki ki ki L2==ki kiV ki ,ki ki ki ki ki ki ki kiF ki ki? ki ki :==ki ki ki ki& ki ki ki ki ki ki ki  kiH kiH ki6 kir ki ki ki; ki  You encounter an orc priest. It is wielding a +0 hand axe.kic! ####...#.#..............# .......#.# #.####...####...# ####...#.##.# ##.## ##.## ki!  ##.##....# #.# #.#  #.#################.# #.# ki! f #.#### #.......).# #.#  #.##.## #.######### #.# ki9"  #.#.#.## #.#...##########.#  #..###.####.@..............#  #.## ##.##........##########  ##.###.o..#.......#  ####.#..###........# kif" #.......###........#  #.###.#.##..~§~..#.#ki" o   orc priest (wandering)  #.###.#.##.~~ki" §§~.#.##  #.##..#.##~~~~ß~~..... ki"  #.##.##.##~§§>§§§..###ki$ 862.0 (54.0).ki"% 'okiP8 T§~§ki9 *3.0 (55 ki9 _kiZB :§ki>J ki    ##.##   #.# #.#  ## #.#  ki #.......).# #.#   #.######### #.#   #.#...####  #.@.......  #.## ##.##........##  ...#.......# ki j .o###........#  #........#  kiϼ '..§§~..#.#  ki O#.~~§~~.#.##  #~~~~ߧ~.....  ki .> kisTH   ##.##   #.# #.#  ## #.#   #.......).# #.#   #.######### #.# kiUo  #.#...####  #.@.......  #.## ##.##........##  ...#.......#  .o###........#  kiUI#........#  ..§§~..#.#  #.~~§~~.#.#  #~~~~ߧ~...  >ki\ki\kimbkidb _An orc priest is nearby!ki}   ##.##   #.# #.#  ## #.#   #.......).# #.#   #.######### #.#   #.#...####  #.@.......  #.## ##.##........##  ...#.......#  .o###........#  #........#  ..§§~..#.#  #.~~§~~.#.##  #~~~~ߧ~.....  > kih3A   ##.##   #.# #.#  ## #.#   #.......).# #.#   #.######### #.#   #.#...####  #.@.......  #.## ##.##........##  ...#.......#  ki3n.o###........#  #........#  ..§§~..#.#  #.~~§~~.#.#  #~~~~ߧ~...ki 4Q  >ki:kiD;ki@ki{Bb _An orc priest is nearby!kiki`   Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   0.0   1.0   0   f + Spellcasting 3.5   4.8  -1  ki S         b - Unarmed Combat   0.0   1.0   0   g + Conjurations 3.2   4.0   0  ki     h + Alchemy4.8   4.2  +1  ki"  c - Short Blades   0.0   1.0   0   i + Air Magic1.8   2.0   0          d + Dodging3.8   4.0   0   j - Evocations   0.0   0.8  +1  e + Stealth5.3   3.0  +4   k - Shapeshifting   0.0   1.2  -1                  ki                                                        The relative cost of raising each skill is in cyan.  The species aptitude is in white.  [?] Help[=] set a skill target  [/] auto|manual mode [*] useful|all skills [!] training|[kia0;10;1mcost|targetskiki־kiN####...#.##...............# ludeguy the Sneak .......#.##.####...####...# Octopode of Gozag Gold: 250 kiG####...#.########.# ##.## ##.## Health: 41/41 ========================##.##..........# #.# #.# Magic: 12/12 ========================#.#################.# #.# AC: 1ki;Str: 8#.#### #.......).# #.# EV: 13Int: 19ki#.##.## #.######### #.# SH: 5Dex: 12ki1#.#.#.## #.#...##########.# XL:  7 Next: 38% Place: Dungeon:4#..###.####.@..............# Noise: ---------  Time: 4563.0 (0.0)ki"#.## ##.##........########## c) +0 dagger (protect)##.###....#.......#Cast: Poisonous Vapours####.#.o###........##.......###........##.###.#.##..§§~..#.#ki=xo   orc priest (wandering)ki\*#.###.#.##.~~§~~.#.###.##..#.##~~~~ߧ~.....kipG#.##.##.##~§§>§§§..### ki_a +0 falchion; a +0 scale mail; a +0 club  Things that are here: ki_a +0 falchion; a +0 scale mail; a +0 club _You encounter an orc priest. It is wielding a +0 hand axe. kiE_An orc priest is nearby! kiU_An orc priest is nearby!ki}4kikiki#...#.# #..#.# #.####...####...#...#.#.# ##.## ##. ##.##.# #.# #.# #.##########.# #.# #.#### #.......).# #.# #.##.## #.######### #.# #.#.#.## #.#...#.# #..###.####.# #.## ##.##.# ##.###....#.......# ####.#.o###.# #.###.# #.###.#.##..§§~..#.# #.###.#.##.~~§~~.#.## #.##..#.##~~~~ߧ~..... ki[39;49m #.##.##.##~§§>§§§..###~~~§ki)4.0 (1 ki$ _kikiki .........#.# #.####...#### ######...#.########.# ##.## ## ##.##..........# #.# #. #.#################.# #. #.#### #.......).# #. #.##.## #.######### #. #.#.#.## #.#...##########. #..###.####................ #.## ##.######## ##.###....#.......# ##.#..###........# #.......###..# #.###.#.##..~~~..#.#ki  #.###.#.##.~~~~~.#.## #.##..#.##~~§~ߧ~..... #.##.##.##~§~>~§§..### #.#....[..~~ß~~~§..#ki K§~§~ki &5kip N§§ki kim I#######...#.########.# ##.## ## ##.##..........# #.# # #.#################.# # #.#### #.......).# # #.##.## #.######### # #.#.#.## #.#...########## #..###.####..............kivn  #.## ##.######## ##.###...@#.......# ##.#..##...# #.......###.# #.###.#.##..~~~..#.# #.###.#.##.~~§~~.#kin <.## #.##..#.##~~§~ß~§..... #.##.##.##~§~>~§~..### #.#....[..~~ߧ~~§..# #######.#>.##.##.~~~§~..##kiv z§§§~~~§ß§~~~kiw &6ki} N§§~§ki ki"kikidkiki7#...#.#.# ##.##  ##.##.# #.#  #.#.#  #.#### #.).#  #.##.## #.### kiO #.#.#.## #.#... #..###.#### #.## ##.##. ##.###..@.#.# ####.#..###kin.# #.......###..#ki #.###.#.##..~~~..#.#ki #.###.#.##.~§§§~.#.## #.##..#.##~~§~ß~~kiJ..... #.##.##.##~~~>~§~..###kiw #.#....[..~§ß§~~~..#  #.#>.##.##.~~~§~..##ki"B~§ki"&7kiu':§ki)kiYl#...#.#.# ##.## # ##.##.# #.# #.#.# #.#### #ki.).# #.##.## #.######### #.#.#.## #.#... #..###.####. #.## ##.##. ##.###.@..#.# ####.#..###.# #.......###........#ki/ #.###.#.##..~~~.#.# #.###.#.##.~§§~~kiR.#.## #.##o.#.##~~§~ß~~.....kiuo   orc priest (wandering) #.##.##ki.##~~~>~§§..### #.#....[..~§ß§~~~..# # kij#.#>.##.##.~~~§~..##ki.kiTMoki&8kiIki ki*1_The orc priest leaves your sight.kiW  ##.##..........# #. #.#################.# # #.#### #.......).# # #.##.## #.######### # #.#.#.## #.#...####### kiiX # #..###.####............ # #.## ##.##.##### # ##.###....#.......# ###.#.@###.# #kiX e #.......###........# # #.###.#.##..~~~..#.# #.###.#.##.~§§~~.#.## #.##..#.##~~§~ß~~..... #.##o##.##~~~>~§§..###o   orc priest (wandering)ki4Y  #.#....[..~§ß§~~~..# ## #######.#>.##.##.~~~§~..## #................##..§~~...ki[ .kia Mokipb &9kig kii 7 _The orc priest leaves your sight.kiq   #.################ #.......).## #.########.#.## #.#...#######.###.####............## ##.##........######.###....#.......# ####.#..###.ki#.....###.#.##..~~~..# #.###.#.##.~§§~~.#.##.#..#..# #.###########.#...........##kiki6'70ki?ki~kizkikikikiڊ ki0 kiG ki kiha.# #.#.# .# #.#### #.).# .# #.##.## #.# .# #.#.#.## #.#... .# #..###.#### .# #.## ##.##. .# ##.###....#.# .# ####.#..###.# .# #.###.# ## #.###.#.##..~~~..#.# #.###.#.##.~§§~~.#.## #.##..#.##~~§~ß~~..... #.##.#.##~~~>~§§..### #.#....[..~§ß§~~~..#o   orc priest (wandering)  ## #.#[0;10;kib1m>o##.##.~~~§~..##  #......##..§~~...#  #.#.#.##.oki2ekise&1kijkilki,#.# #.#### #.......).# #.# #.##.## #.######### #.# #.#.#.## #.#...##### #.# #..###.####.......... #.# #.## ##.##### #.# ##.###....#ki.# #.#####.#..##.# ..# #.......###ki.# ###ki. #.###@#.##..~~~..#.# # kiL^ #.###.#.##.~§§~~.#.##ki_k #.##..#.##~~§~ß~~.....ki #.##.##.##~~~>~§§..### #.#....[..~§ß§~~~..### #######.#>.##.##.~~~§~..##ki #............o...##..§~~... #.###########.#...........ki ## #.# #.#.##...^....kiG.okiki&2kiki kiv.## #.#########.#.#.## #.#...#..###.####..........#.## ##.##.####.###....# ####.#..###. .#.......# ###.###.#.##..~~~..# # ~§§~~.#.## #.##..#.##~~§~ß~~.....#.#~>~§§..###....[..~§ß§~~~..### #######.#>.##.##.~~~§~..#................##..§~~...# ###########o#...........# #.#.##...^#...#ki%xG.oki^kiki3ki]ki؆ki -.#.## #.#...#..###.####...........## ##.##.####.###....# ####.#..###. ........ #####.#.##..~~~..# # #~§§~~.#.## #.##.@#.##~~§~ß~~.....#~>~§§..####....[..~§ß§~~~..# ## #######.#>.##.##.~~~§~..#................##..§~~...############.#...........# #o#.##...^#....#######.##.oki4 ki &4ki kiT ki 4ki ki kiq+#.# #..###.####......... .#.# #.## ##.## .#.# ##.###....#.# .#.###.#..##.# ...# #.......###.# .###ki,r #.###.#.##..~~~..#.#  #.###.#.##.~§§~~.#.## #.##..#.##~~§~ß~~.... # #.##@##.##~~~>~§§..## kiRr# #.#....[..~§ߧ~~~..# kir# ## #######.#>.##.##.~~~§~..## # #................##..§~~... # #.###########.#...........## kir,# #.# #.#.##...^.... # #.# #o#.##......kir#.# # #.##### #.#.####.##.#.# kis# #.#...## #.#.# ##.# #kiuF.oki}9~ki}&5kikikki7.## ##.##.###.###....# ####.#..###. ......... .#####.#.##..~~~..# ## ##~§§~~.#.## # ..#.##~~§~ß~~....##.##.##~§~>~§§..###.@..[..~~ߧ~~~..# ## #######.#>.##.##.~~~§~..#................##..§~~...# ###########.#...........# #.#.##...^###......#####o#.####.##...## #.#.# ##.# #.###.##.ki=\§6kiLki`#.###....# ####.#..###. .......#####.#.##..~~~..# ## ##.#.##.~§§~~.#.## # ..#.##~~§~ß~~....##.##.##~§~>~§§..##....[..~§ߧ~~~..# ## #######.#>@##.##.~~~§~..#................##..§~~...# ###########.#...........# #.#.##...^#.##......#####o#.####.##...## #.#.# ##.# #.###.##. ####.#####.#####.# #kii5o.kikiz&7kiY9§kiki ####.#..###. .......#####.#.##..~~~..# ## ##.#.##.~§§~~.#.## # ..#.##~~§~ß~~....##.##.##~§~>~§§..##....[..~§ß§~~~..# ## #######.#>.##.##.~~~§~..#............@...##..§~~...# ###########.#...........# #.#.##...^....# kiZ o#.##......#####.#.####.##...## ##.# # .###.##. ####.#####.#####.# # ...............#.#.ki ##ki 5o.kiV kiW &8ki{ Poisonous Vapourski} ki' ki .#.#####.#..###........# ludeguy the Sneak ...##.......###........# Octopode of Gozag Gold: 250 .###ki3 a#.###.#.##..~~~..#.# Health: 41/41 ======================== ###.###.#.##.~§§~~.#.## Magic: 10/12 ====================---- ##.##..#.##~~§~ß~~.... AC: 1Str: 8 ##.##.##.##~§~>~§§..## EV: 13Int: 19 #ki] #.#....[..~§ß§~~~..# SH: 5Dex: 12 ki # ## #######.#>.##.##.~~~§~..## XL:  7 Next: 38% Place: Dungeon:4 ki # #............@...##..§~~...#Noise: ---------  Time: 4578.0 (0.0) ki # #.###########*#...........##c) +0 dagger (protect) # #.#ki #o#.##...^....#ki5 =Cast: Poisonous Vapours kiG 8# #.#kiY i#.#.##......#.# kik # #.##### #.#.####.##.#.# ki # #.#...## #.#.# ##.# #ki ro   orc priest (weak) ki # #..###.## #.#.# #..# # ####.#####.#####.#.# #.## .# # ki ...............#.#.# #.###.#.##Press: ? - help, Shift-Dir - straight lineki+ Aim: an orc priest, wielding a +0 hand axe (wandering, hasn't noticed you,  chance to weaken: 100%)  The glob of mercury hits the orc priest.  ki| EThe orc priest looks weaker.  The orc priest is lightly wounded.ki5u 8o.ki| kiK} &====ki} $9.0 (1kir ki   Aim: an orc priest, wielding a +0 hand axe (wandering, hasn't noticed you,  chance to weaken: 100%)  The glob of mercury hits the orc priest.orc priest looks weaker.is lightly wounded. _kiƆ shouts!ki.#.#####.#..###........# ludeguy the Sneak ...##.......###........# Octopode of Gozag Gold: 250 .####.###.#.##..~~~..#.# Health: 41/41 ======================== ###.###.#.##.~§§~~.#.## Magic: 9/12ki ==================------ ##.##..#.##~~§~ß~~.... AC: 1Str: 8 ##.##.##.##~§~>~§§..## EV: 13Int: 19 ##.#....[..~§ß§~~~..# SH: 5Dex: 12 ki4# ## #######.#>.##.##.~~~§~..## XL:  7 Next: 38% Place: Dungeon:4 # #............@...##..§~~...#Noise: ====-----  Time: 4579.0 (0.0) ki[# #.###########o#...........##c) +0 dagger (protect) # #.##.#.##...^....#kilCast: Poisonous Vapours # #.##.#.##......#.# # #.##### #.#.####.##.#.# ki# #.#...## #.#.# ##.# #o   orc priest (poisoned, weak) # #..###.## #.#.# #..# # ####.#####.#####.#.# #.## .# # ki;...............#.#.# #.###.#.##Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc priest, wielding a +0 hand axe (lightly wounded, weak)  Poisonous fumes billow around the orc priest!  The orc priest is poisoned.ki739--ki Z=---80.0 (1kiki  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an orc priest, wielding a +0 hand axe (lightly wounded, weak)  Poisonous fumes billow around the orc priest!  kiTPThe orc priest is poisoned. _hits you with a +0 hand axe.ki{B $You hit the orc priest.  Your weapon exudes an aura of protection.  Your grab misses the orc priest. You squeeze the orc priest.kiJ)kiM250  8 45---1Poisonous VapourskixRkizTN _You kill the orc priest!kiϭ  ...... .#####.#.##..~~~..# ## ##~§§~~.#.## # ..#.##~~§~ß~~....##.##.##~~~>~§§..###.#....[..~§ß§~~~..# ## #######.#>.##.##.~~~§~..#................##..§~~...# kix ###########@#...........# #.#.##...^....# ##......##.# #................#.###.[.......ki 8§ki; .-2ki ki  You now have 257 gold pieces (gained 7).7 1 -3.0 (2ki j§ _You see here a +0 hand axe.ki.p  #####.#.##..~~~..# ## ##~§§~~.#.## # ..#.##~~§~ß~~....##.##.##~§~>~§§..##....[..~§ß§~~~..# ## #######.#>.##.##.~~~§~..#................##..§~~...# ###########)#...........#kip f #@#.##...^....# ...#######.##..# ..###.>##.####.###...........##kix kiKy e40=-4.0 (1ki  ki kiIki|10/12==kikiɗkiDkikiMh1==kikiޟkikiukiP==kiki5,kimkiO=kikiŮ,kiki'kikY2571==kikikikiKki9,kikifkikiHkiki:==kiki,ki'ki&,ki4kikikikikiL2==kikiki kiNki{ki@  You see here a +0 hand axe.ki%kiX _kiyki~kiV,kikiki'kic:==ki[ki:kikikiVkiqkiki*kikiki,kiwkiki,kikiki,kikiki5kidkikiki,kitkioki,kiOkiki!kiH"ki"ki$kir',ki'ki)kii,,ki1nki3ki4,ki6ki7ki^9ki9kiT:ki=>ki?ki@ki@kiAkiC,ki)Dki>EkiFkiFkiFGkiHkiIkiIkiSJkitKkiLkiLkiGMkiONkiO,ki7PkiRkiSkiSkiITkiUkiWki7WkiWkiXkiYkiYkiZkiZki[ki[kij\ki]ki^kiQ_ki_ki`kiaki3bkibkirdkie,ki&fkifkigkigkigki|hki1ikiTikiikijkijkikkixkkilkimki8nkinkioki!qkiXqkiqkivkiwkiDxkixki|ki~kiu~ki~kikiki@ki|kiÅkikikiۆki$kiBkiXkikikikikiki,kikiki0kiZkikikizkiki3kikiܩ,kihki߫kikiíki,ki,kikiǷkiù,ki7kikihkikikioki]ki|kikiki,kikiki&kihkikiXkikiki4ki^ki,kikiskiki kihkikikibkikikikikikikiskikikikiPkikikikikiki|kikikiikikikiki>kikiki,kikikiki7kikiki>kibkikikikikikiki,kikikifkiki"kikid,kiQkikiBkikikiGki: ,ki ki& ki ki kiW kiGkikiKki[kikikikikiki ki ki.,kikiQkiakikiki kiQ"ki"ki"ki#ki$ki$ki$ki%ki&ki&ki!'ki'ki<)Bki)ki*,ki6+ki+ki,,kiA-ki.ki 0ki.0ki1kix1kiC2kib2ki2kiJ3ki3ki4kiO4kiO5kiZ6ki~6ki6ki7ki=9ki]9kic:ki*=ki*?kig?ki}@ki)Bki.CkiSCkiCkiDkiqFkiFkiGkiVIki6LBkiMki0OkilOkiPPkiQkiRkiRki)TkiWkiYkiYkiZki&^ki`,kiakicki,fkifkihkiWo #..##.##... ##.#.....### .........# #.####.## ..##.##.## #[# #.# ..##.##..# #[# #.# kio.........# #<# #(# .###.....# #.# #.# ###### #.....##..# #.# #.# #..... #kio####.##..# #####.# #.# #.####  #.##..# #..@..# #.# # kio #.##..####.########.#  #.##.............##.# #.#### kipm #.##.#####.#####..#... ki#p9 #.##.### #.# #.###..###  #......###.# #.##.####.####kiap   ## #.#...........  kip ##########.#..#........  kip ##.....##.............###.>## kiw270117.0)kiw,28ki|kin~] _p - a glowing amethyst potionkihkikiki `ki)kiA*ki*ki/ki1f  There is a stone staircase leading up, spattered with blood here.ki 3ki3 _ki4ki7$  Things that are here:ki9  a +0 chain mail; a +0 glaive; an orc skeletonki<ki< _ki=kiAZ  Items here: ) [ ÷÷.kiDkiZD _kiEkiFki:IkiyIkiJkiPMkiOkiPkiQkiSkiUki2VkiWkiYki[ki[ki\ki^ki`,kiakirckiXekieki|fkikkim,kimkiokisBkiukiwkiwki ykirzki|ki|ki}kinkiLkikikikikikiWkiki,kiҍki8ki kiskiZki~ki:kizkiF,ki`kikikikiҝkiki[kikiϥkiki ki kikikiAki(kikikimkiLkiY,kikiki[,kikimki:ki\kikikinki>kikiKki"kiBkikirkiYki~kikikiٿkiki9kiki/BkiqkiBkiEkikiki0kiMkikiki,kikikikiki:kikikiki,ki=,kitkiki,ki^kiki,kikikiBkiXki+kiRki~ki,kikikikiLkiqkikikikiki-kikiBkigkiki5kiJXkiBkiLki kiDki}kikikiki7kikikikiSkikiskikikikiki?kixkiT5  #####   #...#   #.#.#   ####.#.####  #....#....#############  #.#######......@......# 62.0 (60.0)  #....#....###########.#  ####.#.#### #.# #####.#.# #.########## ........# #.#......... ........# ######.#.#### .######.# #...##.#.# .# #.# ###.#.##...# .# #.#######...#...######### _Done exploring.kikiki+ki{......0.0).........kikiLE _Done exploring.kigIkiF4kikiE _Done exploring.kiki9kikiki!kijP _kiEkizkiki-kiykiki*kiAkikikiakikikiCkikikickikiʲkikiٴki kikiykikikiqkikikikifkiPkiki kikizki>kikkikikiUkikiki#.#.#####.#.#####....#....############### #.#######.............##.###### #....#....###########.#.......# ####.#.####ki- #..####.######.#.##. #.# #.#........# #. #.# #..# ######.74.0 (12.0)  ki[ #.# ###.# #...##.kiv #.### #.# #.# ###.#.##.  #...# #.# #.#######...#... kiZ ###.# #.#### #.##......#####  #.# #....# #.##.####...#...#ki ki' ###.#######.###.##.# ###.#....  #.....#............######...### ###.....#.###............###.##ki !kikikiXpkipkitkiuki kiH ki ki ki ki kiC ki ki kiA ki ki kiG ki ki ki  kiJ ki ki kit ki ki ki ki ki ki ki ki~ ki ki kij ki- kiU ki ki. ki#! ,kiu! ki! ki" ki # ki;# ki# ki$ ,ki$ kif% ki&& kiH& ki& ki6' ki' ki-( ki[( ki-  #.#.......#  #.# #..........#  #.# ###.######.#   #.### #.# #.# ## kiP-   #...# #.# #.   ###.# #.#### #.##.....   #.# #....# #.##.### ki- .  ###.#######.###.##.# ##   #.....#@...........#####88.0 (14 ki-   ####.....#.###............#   #...........######.######.#   #.##.....#..# #..# #: ki-   #.##.>...#..# #.## #.# ki.   #.####.###..# #.# #.#    #.####.###..#####.# ###.#kiH.     #.#....#........#.#####....    #.#.........###.#.##.......kiz. E ki/ ki83 kie4  ki 4 ki5  ki{ !ki|i!kii!kiyj!kis!kit!kit!ki xX!kizx!kiz!ki{!ki{!ki{|!ki}!ki,!kit!ki!ki!ki!kiN!ki!ki!ki!ki;!kiV  #...# #.# #.###  ###.# #.#### #.##.  #.# #....# #.##. !ki ###.#######.###.##.  #.....#........... !ki ####.....#.###.. !ki..........######.###  #.##.....#..# #..# !ki$  #.##.@...#..# #.## 94.0 (6.0)!kiV  #.####.###..# #.#  !ki̐ #.####.###..#####.#  !kip #.#....#........#.### !ki #.#.........###.#.##..  #.#.........# #.......!ki5q  #.##..##.##.###.####..!kiM !kie #.##..##.##.....# ## !ki}+ #!kiL.....##### #!kit!kiؖ!kic _There is a stone staircase leading down here.!kit!ki!ki!ki!ki25.0 (1 _!ki"kiS'&5"ki+% ###.###  ###>......  ###.........  "ki+###<..........  #.............  #......  #.............  #.....@.......  #............! "kiI, #............!  #............. #............. #............. #.............# .###.........## "kii, "ki:6.5 (2.5< _You climb downwards.  Found a golden potion and a potion of curing.  Found a stone staircase leading up and a stone staircase leading down. _There is a stone staircase leading up here."ki9] "ki` sRead which item? Scrolls  a - a scroll of enchant armouri - a scroll of identify  V - 2 scrolls of vulnerability  c - 2 scrolls labelled MYGGURCHEWE  e - 2 scrolls labelled TACSIO LOMUTI "ki7a 4 h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selected#kix #kif #kiI Vludeguy the Sneak###.###Octopode of Gozag Gold: 257###>......#ki Health: 41/41 ========================###.........Magic: 12/12 ========================###<..........AC: 1Str: 8#.............EV: 13#ki Int: 19#.............SH: 5Dex: 12#ki #.............XL:  7 Next: 45% Place: Dungeon:5#.....@.......#ki Noise: ---------  Time: 4796.5 (0.0)#............!#ki c) +0 dagger (protect)#............!Cast: Poisonous Vapours#ki= #.............#.............#.............#ki #.............#.###.........## _Done exploring. _There is a stone staircase leading down here. _You climb downwards.  Found a golden potion and a potion of curing.  #ki Found a stone staircase leading up and a stone staircase leading down. _There is a stone staircase leading up here.#kip #ki] Identify which item? (\ to view known items) Scrolls (select first with ?)  c - 2 scrolls labelled MYGGURCHEWE #ki  e - 2 scrolls labelled TACSIO LOMUTI  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN Potions (select first with !) #ki o d - a pink potion  f - a sedimented cyan potion  j - a bubbling grey potion #ki a k - 2 golden potions  n - a bubbling amethyst potion  o - a murky coppery potion #ki p - a glowing amethyst potion[?] describe selected$ki $kiM $ki ludeguy the Sneak###.###Octopode of Gozag Gold: 257###>......Health: 41/41 ========================###.........Magic: 12/12 ========================###<..........AC: 1Str: 8#.............EV: 13Int: 19#.............SH: 5Dex: 12#.............XL:  7 Next: 45% Place: Dungeon:5#.....@.......Noise: ---------  Time: 4796.5 (0.0)#............!c) +0 dagger (protect)#............!Cast: Poisonous Vapours#.............#.............#.............#.............#.###.........## [$kif 39;49m_Done exploring. _There is a stone staircase leading down here. _You climb downwards.  Found a golden potion and a potion of curing.  Found a stone staircase leading up and a stone staircase leading down. _There is a stone staircase leading up here.  As you read the scroll of identify, it crumbles to dust.7.5 (1$ki $ki U _d -> E - a potion of experience%kiRead which item? Scrolls  a - a scroll of enchant armour  V - 2 scrolls of vulnerability  c - 2 scrolls labelled MYGGURCHEWE  e - 2 scrolls labelled TACSIO LOMUTI  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selected%ki4ludeguy the Sneak###.###Octopode of Gozag Gold: 257###>......Health: 41/41 ========================###.........Magic: 12/12 ========================###<..........AC: 1Str: 8#.............EV: 13Int: 19#.............SH: 5Dex: 12#.............XL:  7 Next: 45% Place: Dungeon:5#.....@.......Noise: ---------  Time: 4797.5 (0.0)#............!c) +0 dagger (protect)#............!Cast: Poisonous Vapours#.............#.............#.............#.............#.###.........##%kiE _You climb downwards.  Found a golden potion and a potion of curing.  Found a stone staircase leading up and a stone staircase leading down. _There is a stone staircase leading up here.  As you read the scroll of identify, it crumbles to dust. _d -> E - a potion of experience%ki0P  Okay, then.%ki%kiD _&ki&kiDrink which item? Potions  c - 6 potions of curing  g - a potion of magic  E - a potion of experienceb - a potion of brilliance  e - 4 potions of enlightenment  f - a sedimented cyan potion  j - a bubbling grey potion  k - 2 golden potions  n - a bubbling amethyst potion &ki" o - a murky coppery potion  p - a glowing amethyst potion [!] read|quaff|evoke[?] describe selected'ki\ 'kic^ludeguy the Sneak###.###Octopode of Gozag Gold: 257###>......Health: 41/41 ========================###.........Magic: 12/12 ========================###<..........AC: 1Str: 8#.............EV: 13'kicInt: 19#.............SH: 5Dex: 12#.............XL:  7 Next: 45% Place: Dungeon:5#.....@.......Noise: ---------  Time: 4797.5 (0.0)#............!c) +0 dagger (protect)#............!Cast: Poisonous Vapours#.............#.............'kic#.............#.............#.###.........##'kic=Found a golden potion and a potion of curing.  Found a stone staircase leading up and a stone staircase leading down. _There is a stone staircase leading up here.  'kidAs you read the scroll of identify, it crumbles to dust. _d -> E - a potion of experience _Okay, then.'kie%  'kie!You feel more experienced!'kin/  --more--'ki>'kiIDYou have gained great experience. Select the skills to train. Skill  Level > New  Apt Skill  Level > New  Apt  a - Fighting   0.0     0   f + Spellcasting 3.5  > 5.9 -1      'kitE     b - Unarmed Combat   0.0     0   g + Conjurations 3.3  > 6.1  0      h + Alchemy4.8  > 7.3 +1   c - Short Blades   0.0     0   i + Air Magic1.9  > 5.2  0          d + Dodging3.8  > 6.4  0   j - Evocations   0.0    +1  e + Stealth5.4  > 9.2 +4   k - Shapeshifting   0.0    'kiE[37m-1                          'ki8F,            'kiyF            'kiG                    'ki-G    Select the skills you want to be trained. The chosen skills will be raised to  'kiPGthe level shown in cyan.  [*] useful|all skills )ki]75.700 d * Dodging   3.8  > 7.78.8)ki&6.26.588 d - Dodging   3.8   9.6)kiXt5.9132 e * Stealth   5.4  > 11)kiJ 6.778.46.5 e - Stealth   5.4   *ki^ f * Spellcasting   3.5  > 8.16.57.85.8*ki  f - Spellcasting   3.5   8.19.37.4*ki0 g * Conjurations   3.3  > 9.58.46.5+kiA g - Conjurations   3.3   10.89.1+kiZ  9.4 i * Air Magic   1.9  > 10.3,kiw 14.2 i - Air Magic   1.9   .ki/ h * Alchemy   4.8.ki h - Alchemy   4.8   /ki h + Alchemy 4.8  > 14.21ki a + Fighting 0.0  > 8.80.84ki 7.1 h * Alchemy   4.8  > 12.1:ki1ludeguy the Sneak###.###Octopode of Gozag Gold: 257###>......Health: 41/41 ========================###.........Magic: 12/12 ========================###<..........AC: 1Str: 8#.............EV: 13Int: 19#.............SH: 5Dex: 12#.............XL:  7 Next: 189% Place: Dungeon:5#.....@.......Noise: ---------  Time: 4797.5 (0.0)#............!c) +0 dagger (protect)#............!Cast: Poisonous Vapours#.............#.............#.............#.............#.###.........##:ki6[mFound a stone staircase leading up and a stone staircase leading down. _There is a stone staircase leading up here.  As you read the scroll of identify, it crumbles to dust. _d -> E - a potion of experience _Okay, then.You feel more experienced!:ki;:kigA]ludeguy the Toxicologist###.###Octopode of Gozag Gold: 257###>......:kiAHealth: 54/54 ========================###.........Magic: 12/12 ========================###<..........AC: 1Str: 8#.............EV: 13:kiA|Int: 19#.............SH: 5Dex: 12#.............XL:  7 Next: 189% Place: Dungeon:5:kiBV#.....@.......Noise: ---------  Time: 4797.5 (0.0)#............!c) +0 dagger (protect):kiwB[#............!Cast: Poisonous Vapours#.............#.............#.............#.............#.###.........## _There is a stone staircase leading up here.  As you read the scroll of identify, it crumbles to dust. :kiB_d -> E - a potion of experience _Okay, then.You feel more experienced!  :kiCZYour Fighting skill gained 7 levels and is now at level 7!:kiADv _d -> E - a potion of experience _Okay, then.  You feel more experienced!  Your Fighting skill gained 7 levels and is now at level 7!Your Alchemy skill gained 8 levels and is now at level 12!You have reached level 8!:kirR/  --more--;kiLt 60/603/13845% 8.5 (1 _;ki1N;kiP......Health: 60/60 ========================###.........Magic: 13/13 =========================kig###<..........AC: 1Str: 8#.............EV: 13Int: 19#.............SH: 5Dex: 12#.............XL:  8 Next: 45% Place: Dungeon:5#.....@.......Noise: ---------  Time: 4798.5 (0.0)#............!c) +0 dagger (protect)#............!Cast: Poisonous Vapours=ki#.............#.............#.............#.............#=ki .###.........## _d -> E - a potion of experience _Okay, then.=ki-You feel more experienced!  Your Fighting skill gained 7 levels and is now at level 7!Your Alchemy skill gained 8 levels and is now at level 12! =kiLP_You have reached level 8!=ki=ki֚=ki=ki֢>ki{  You have 6 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 1.0.>ki(>ki>ki^  Your damage rating with your +0 dagger of protection is about 8 (Base 4 x 105% _(Dex) x 112% (Skill) + 4 (Slay)).>ki3 >ki  Spells (Memorise)TypeFailure Level >ki9  a - Sticky FlameFire/Alchemy4% 4b - Kinetic GrapnelForgecraft>kiO 6%1  >kic 'c - Sigil of BindingHexes>ki g17% 3 4 spell levels left >kiš ^[!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exit@ki @ki1ludeguy the Toxicologist###.###Octopode of Gozag Gold: 257@ki###>......Health: 60/60 ========================@ki###.........Magic: 13/13 ========================###<..........@kiAC: 1Str: 8#.............@ki' EV: 13Int: 19#.............SH: 5Dex: 12#.............@kiJXL:  8 Next: 45% Place: Dungeon:5#.....@.......@kihNoise: ---------  Time: 4798.5 (0.0)#............!c) +0 dagger (protect)@ki#............!Cast: Poisonous Vapours@ki#.............#.............#.............@kiA#.............#@kiV.###.........##@kiYour Alchemy skill gained 8 levels and is now at level 12! _You have reached level 8!@kiMYou have 6 tentacles available for constriction.  @kiFYour movement speed is average. Your attack delay is about 1.0.  @ki/Your damage rating with your +0 dagger of protection is about 8 (Base 4 x 105% _(Dex) x 112% (Skill) + 4 (Slay)).@kiQ@kiMemorise Sticky Flame, consuming 4 spell levels and leaving 0? Y - Yes  N - NoAki)Aki4ludeguy the Toxicologist###.###Octopode of Gozag Gold: 257###>......Health: 60/60 ========================###.........Akiy4[Magic: 13/13 ========================###<..........AC: 1Str: 8#.............EV: 13Int: 19#.............SH: 5Dex: 12#.............Aki4XL:  8 Next: 45% Place: Dungeon:5#.....@.......Aki4Noise: ---------  Time: 4798.5 (0.0)#............!c) +0 dagger (protect)#............!Cast: Poisonous Vapours#.............Aki56#.............AkiA5w#.............#.............#Akic5.###.........##Your Alchemy skill gained 8 levels and is now at level 12! Aki5_You have reached level 8!You have 6 tentacles available for constriction.  Aki5Your movement speed is average. Your attack delay is about 1.0.  Your damage rating with your +0 dagger of protection is about 8 (Base 4 x 105% _(Dex) x 112% (Skill) + 4 (Slay)).AkiD7+9.5 (1Akij=AkiFo _This spell is dangerous to cast!AkiJ-800.5 (2AkiMAkiUAkilV+1.5 (3AkiO[Aki`Aki`+2.5 (4Aki4dAkiaf S _You start memorising the spell. You continue memorising. x4AkiDkS   adder (wandering)Akik+3.5 (5AkiioAki$qn _You encounter an adder.AkiqAki'vAkiyc _You finish memorising. Spell assigned to 'e'.Aki`Akiv  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   f + Spellcasting 3.5   4.8  -1           b - Unarmed Combat   0.0   1.0   0   g + Conjurations 3.3   4.0   0      h + Alchemy12.1  12.6  +1   c - Short Blades   0.0   1.0   0   i - Fire Magic   0.0   1.0   0  Aki[7;22H    j + Air Magic1.9   2.0   0  d + Dodging3.8   4.0   0      e + Stealth5.4   3.0  +4   k - Evocations   0.0   0.8  +1       l - Shapeshifting   0.0   1.2  -1                  Aki8        Akia        Aki            Aki        Akia    Aki         AkiApThe relative cost of raising each skill is in cyan.  AkicThe species aptitude is in white.  [?] HelpAkiG[=] set a skill target  Aki[/] auto|manual mode [*] useful|all skills [!] training|cost|targetsCkiQ h * Alchemy  12.1Ckip h - Alchemy  12.1Cki> i + Fire Magic 0.0DkiDkiDkiludeguy the Toxicologist###.###Octopode of Gozag Gold: 257DkiӮ###>......Health: 60/60 ========================###.........Magic: 13/13 ========================###<..........DkiAC: 1Str: 8#.............EV: 13DkiInt: 19#.............SH: 5Dex: 12Dki;#.............XL:  8 Next: 45% Place: Dungeon:5#.....@.......Dki]Noise: ---------  Time: 4803.5 (0.0)#............!Dkic) +0 dagger (protect)#............!Cast: Poisonous VapoursDkil#.............#.............DkiV.#............SS   adder (wandering)#.............#.###.........##Your damage rating with your +0 dagger of protection is about 8 (Base 4 x 105% _(Dex) x 112% (Skill) + 4 (Slay)). _This spell is dangerous to cast! Dki|_You start memorising the spell. You continue memorising. x4 _You encounter an adder. DkiV_You finish memorising. Spell assigned to 'e'.DkiѶDkiWDkiKDkiDki Dkiy  Your spells (describe)TypeFailure Level  a + Poisonous VapoursDkiު Alchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  Dki >d - Olgreb's Toxic RadianceAlchemy1%4  Dki( Ee - Sticky FlameFire/Alchemy4%DkiZ 4 Dki Select a spell to describe [?] help [!]/[I] toggle spell headersFki Fki Fki' 8ludeguy the Toxicologist###.###Octopode of Gozag Gold: 257###>......Health: 60/60 ========================###.........Magic: 13/13 ========================###<..........AC: 1Str: 8#.............Fkid( EV: 13Int: 19#.............SH: 5Dex: 12#.............XL:  8 Next: 45% Place: Dungeon:5#.....@.......Noise: ---------  Time: 4803.5 (0.0)#............!Fki( c) +0 dagger (protect)#............!Cast: Poisonous VapoursFki( #.............#.............#............SFki( S   adder (wandering)#.............#.###.........##Fki$) Your damage rating with your +0 dagger of protection is about 8 (Base 4 x 105% _(Dex) x 112% (Skill) + 4 (Slay)). _This spell is dangerous to cast! _You start memorising the spell. You continue memorising. x4 _You encounter an adder. FkiE) V_You finish memorising. Spell assigned to 'e'.Fki/ Fki}/ Fki4 Fki*7 Hki###.######>......###....###<..#....#.#.#.....<#.!#.!.#..#.#.S##..##.##### ###.<..##HkiW.SHki9<Hki+4.5 (1HkiHki+9 _Found a stone staircase leading up.Hki  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Hki  _You can't see any susceptible monsters within range! (Use Z to cast anyway.)HkiI###>......###....###<..##....##.##.#.....<#............!#.!.#..#.#.###..S##.#####  ###.<..## ###### ##.SHkiMHkiN-5 _HkilUHkiwWIki   Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Iki IkiIkiIki  Casting: Poisonous Vapours (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Poisonous Vapours (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Iki@###....###<..# #....# #.#♣#..#.....<#............!#.!.#..#.##.####...###S## ###.<..##..  ###### ## ##IkiA9S.Iki C9S.IkiJIki LI6Poisonous Vapours _Iki&RIkiCTIkiO  ###..........#  ludeguy the Toxicologist ###<...........#  Octopode of Gozag Gold: 257 #..............#  Health: 60/60 ======================== Iki #..............#♣  Magic: 11/13 ====================---- #................  AC: 1Str: 8 #.....<..........  EV: 13Int: 19 #............!...  SH: 5IkiΏ <Dex: 12 Iki #............!...  XL:  8 Next: 45% Place: Dungeon:5 Iki? i#........@.......  Noise: ---------  Time: 4806.5 (0.0) #...............#  c) +0 dagger (protect) #........$....###  Cast: Poisonous VapoursIkiZ [ #.............## Ikis V .###.........##  Iki ###.<..##..  S   adder (wandering) Iki ####### ##.  Iki ## Ikiא Casting: Poisonous Vapours (safe; 1% risk of failure)  Iki Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Iki9 Press: ? - help, Shift-Dir - straight lineAim: an adder (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker.Iki    ###<...........#  #..............#  Iki9 #..............#♣  #.......  #.......  #.......  #.......  #.......  #........*......#  #....###  #.....# .###.. ###.<..##.. Ikit ###### ##. ## Iki .Iki 257 6==7.5 (1Poisonous VapoursIki# Iki& %onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Iki& Aim: an adder (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the adder! The adder looks weaker. _You kill the adder!Jki ###<....♣..<.!!...#$....###.....## --8JkiJki1Jki...♣..<.Jki&Y!!...#JkiEc####.....## Jkic@.##### Jki ###.<..##... ###### ##..Jki< ##.. .JkiJkidA--9JkiJkiJki$64Jki'%10.5 (2JkiJki> _You now have 264 gold pieces (gained 7).Jkiv f#.# #.#♣.#.#.....<.#.!.#.!.#.##.# #.### #.## .###.## ###.<..##...###### ##..##...1.5 (1Jki Jki Kki###<# #.# .#.#♣#.......#.....<.#.!.#.!#.#..# ##.....###.........#####.<..##...#########..##...KkiKki&2KkiKkijKkitr #### ###<# ♣##.# ..##.#♣..##.......##.....<.....##.!.#.!#.#..##.....###.........#####.<..##...#########..##...Kki Kki U2==3KkiKkiKki  ###>#  #### ###<# ♣# #.# ..# #.#♣..# #.......# #.....<Kki L.....# #.!.#.#.#..##.....###.........#####.<..##...#########..##..Kki Kki &4Kkii Kki Kki +5.5 (2Kki$ KkiT( b _c - 7 potions of curing (gained 1)Kki M ###.###  ###># ### ##< ♣ .#♣.<..#.##.###...............########Kkif Kki( 82646.5 (1KkiI KkiV n  k - 3 golden potions (gained 1)Kki H==7.5 (2Kkiĺ Kkiݽ / _You see here a +0 glaive.Lki4LkiLkiK _You can't see any susceptible monsters within range! (Use Z to cast anyway.)LkiLkiLkiLki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Lki Lki Lkin Lki Lki : _LkiL Lki Lki Lki Lki Lki Lki% Lki_ L3==Lki Lki 4 _Magic restored.Lki Lki Lki Lki Lki+ ,LkiZ Lki LkiS ,Lki Lki Lki    #.   ###.###  >......##  ##.....####  ##<.....#∩.♣#  ......#...#  LkiQ p..............#♣..#  ......@.#  24.5 (7 .....<.....#  ....).....#  ....##  ....Lki ?##  ...##    ......###    ............##    ##.........##   Lki Lki H==5.5 (8LkiA" Lki$ 8 _Found Rabinoy's Assorted Antiques.Lki Lki Lki Lki LkiD Lki3 BLki Lki Lki Lki Lki LkiD Lki Lkio LkipWelcome to Rabinoy's Assorted Antiques! What would you like to do?  a -  180 gold a shiny chain mail  b -  90 gold a cloak  c -  120 gold a runed hand axe Lki d -  100 gold a glowing leather armour  e -  800 gold a lightning rod (4/4)  f -  20 gold a scroll labelled EQUGIAGHAO LkiJ g -  20 gold a scroll labelled TACSIO LOMUTILkih -  240 gold a wand of paralysis (5) You have 264 gold pieces. [Esc] exitLki'[!] buy|examine items[a-h] mark item for purchase LkiI[/] sort (type)[A-H] put item on shopping listPki38 ~  a -  180 gold a shiny chain mail  f +  20 gold a scroll labelled EQUGIAGHAO After the purchase, you will have 244 gold pieces.[Enter] buy marked itemsQkiX Purchase items for 20 gold? (y/N)RkisN-TACSIO LOMUTI  g -  240 gold a wand of paralysis (5) RkiOgGRki3RkiRkiyludeguy the ToxicologistOctopode of Gozag Gold: 244Health: 60/60 ========================Magic: 13/13 ========================#.AC: 1Str: 8###.###Rki+EV: 13Int: 19###>......##SH: 5Dex: 12###..........####RkiXL:  8 Next: 46% Place: Dungeon:5 ###<...........#@.♣#RkiNoise: ---------  Time: 4828.5 (3.0) #..............#...#Rki 5c) +0 dagger (protect) RkiA#..............#♣..#Cast: Poisonous Vapours #..................# Rkif#.....<............# #............).....# Rki#.................## #................## #...............## Rki_You see here a +0 glaive. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) Rki_You can't see any susceptible monsters within range! (Use Z to cast anyway.) Rkiy_Magic restored. _Found Rabinoy's Assorted Antiques.  There is an entrance to Rabinoy's Assorted Antiques here.RkiI _You can't see any susceptible monsters within range! (Use Z to cast anyway.) _Magic restored. _Found Rabinoy's Assorted Antiques.  There is an entrance to Rabinoy's Assorted Antiques here.  d - a scroll labelled EQUGIAGHAORkiSRkil _Thank you for shopping at Rabinoy's Assorted Antiques!SkiF    #.  ###.###  Ski*G\###>......##  ###.####  <.#∩@♣#  SkiSGq.#...#  .SkiG#♣..#  ..................# .....<............# ............).....#   .SkiG|...##    Ski H\..........##  Ski%H6  .Ski@H^..##   SkiZHSkixPSkiQ)9.5 (1 SkiQ _SkiWSkiYSkiF] Ski] Ski)^ Skia SkiTd Skih BSkiSj Skij Skigk Skim Skin Ski`o Skip Skiq Skit Skirt Skiu Skiw Skiy ,Skiz Ski } Ski~ ,Ski SkiĂ Ski ,Ski Ski Ski ,Ski6 Ski Skinj ,SkiÍ Ski\ Skiy ,Skih SkiK Skin ,Ski Ski Ski Ski Ski+ Ski Ski Skiɟ Ski Skiš Ski SkiA Ski Ski Skip Ski٨ Ski8 Skiժ Ski SkiQ SkiӬ Ski Skic Ski Ski\ Ski Ski Ski Skio Ski SkiF ,Ski Ski Ski" ,Ski Ski SkiD ,Ski Ski} Ski j  You encounter a black bear.Ski .# . h##  ..#  #.#######  #.#...... Ski  #........  #@#   ##.# SkiC ]  #..#   Skim #.## ##.# Ski #.##  h   black bear (wandering)Ski b #.# Ski ##.# #.##Ski /50.5 (21.0)Ski Ski *1.5 (22 Ski _Ski Ski SkiSkiRead which item? Scrolls  a - a scroll of enchant armour  V - 2 scrolls of vulnerability  c - 2 scrolls labelled MYGGURCHEWE  d - a scroll labelled EQUGIAGHAO  e - 2 scrolls labelled TACSIO LOMUTI  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedUkiUki Uki`ludeguy the Toxicologist.#Octopode of Gozag Gold: 244Uki.Health: 60/60 ========================h##Magic: 13/13 ========================..#UkiAC: 1Str: 8#.#######EV: 13Int: 19Uki#.#......SH: 5Dex: 12Uki#........XL:  8 Next: 46% Place: Dungeon:5#@#UkiKANoise: ---------  Time: 4851.5 (0.0)##.#c) +0 dagger (protect)#..#Cast: Poisonous VapoursUki2#.####.##.##h   black bear (wandering)#.#UkiH##.##.## Uki5V_Magic restored. _Found Rabinoy's Assorted Antiques.  UkiUThere is an entrance to Rabinoy's Assorted Antiques here.  d - a scroll labelled EQUGIAGHAO _Thank you for shopping at Rabinoy's Assorted Antiques! Uki{F_You encounter a black bear.Uki h.  As you read the scroll labelled TACSIO LOMUTI, it crumbles to dust.  UkioYou feel strangely unstable. It was a scroll of teleportation.Uki Uki!a2.5 (1Tele Uki%Uki*(8 _e -> t - a scroll of teleportationUkiam Read which item? Scrolls  t - a scroll of teleportation (cancels current teleport)  a - a scroll of enchant armour  V - 2 scrolls of vulnerability  c - 2 scrolls labelled MYGGURCHEWE  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedVki"Vkio-Vki- ludeguy the Toxicologist.#Octopode of Gozag Gold: 244hVki-Health: 60/60 ========================.##Magic: 13/13 ========================..#Vki.AC: 1Str: 8#.#######EV: 13Vki/Int: 19#.#......SH: 5Dex: 12#........XL:  8 Next: 46% Place: Dungeon:5#@#Vki5/Noise: ---------  Time: 4852.5 (0.0)##.#c) +0 dagger (protect)VkiV/#..#Cast: Poisonous Vapours#.##Vkiu/Tele ##.##.##Vki/h   black bear (wandering)#.#Vki/I##.##.##Vki/d - a scroll labelled EQUGIAGHAO _Thank you for shopping at Rabinoy's Assorted Antiques! Vki4_You encounter a black bear.As you read the scroll labelled TACSIO LOMUTI, it crumbles to dust.  You feel strangely unstable. It was a scroll of teleportation. _e -> t - a scroll of teleportation  As you read the scroll labelled MYGGURCHEWE, it crumbles to dust.  It is a scroll of brand weapon.Vkio>/  --more--WkiIWki $Wki:Brand which weapon? Hand Weapons  c - a +0 dagger of protection (weapon)Wkiatb - a +0 dagger[?] describe selectedYkif Ykiϟ +Yki ludeguy the Toxicologist.#Octopode of Gozag Gold: 244Yki hYki# Health: 60/60 ========================.##YkiK Magic: 13/13 ========================..#AC: 1Ykir Str: 8#.#######EV: 13Yki Int: 19#.#......SH: 5Yki ^Dex: 12#........Ykiؠ XL:  8 Next: 46% Place: Dungeon:5#@#Yki Noise: ---------  Time: 4852.5 (0.0)##.#Yki' c) +0 dagger (protect)#..#Cast: Poisonous VapoursYkiR K#.##Tele Ykix ##.##.##h   black bear (wandering)Yki [#.###.#Yki #.## Ykiߡ M_You encounter a black bear.Yki As you read the scroll labelled TACSIO LOMUTI, it crumbles to dust.  You feel strangely unstable. It was a scroll of teleportation. _e -> t - a scroll of teleportation  YkiE gAs you read the scroll labelled MYGGURCHEWE, it crumbles to dust.  It is a scroll of brand weapon.Yki   .# h .## ..#Yki - #.#######  #.#......  #........  #@#Yki[  ##.# #..# #.## ##.# Yki <#.## Yki w#.# ##.# Ykiѩ [#.##Your +0 dagger projects an invisible shield of force!Zki V .# h .## ..# #.#######  Zki #.#......  #........  #@# ##.# #..# #.## ##.#Zki  #.## #.# ##.#Zki( H #.##ZkiX .hb - a +0 dagger of protection; c -> W - a scroll of brand weaponZkiWhZki3==3.5 (1ZkiZki("4 _The black bear growls angrily.[ki` .# . h## [ki..# #.#######  #.#......  #........  #@# ##.# #..# #.## ##.# [kig#.## #.# ##.# #.##[kiR/ .# . h## ..# #.#######  #.#......  #........  #@# ##.# #..# #.## ##.# #.## #.# ##.# #.##[ki&0[ki2a _A black bear is nearby!\kiWield or unwield which item (- for none)?- - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection[?] describe selected [!] equip|wield|put on[tab] equip|unequip \kid \ki߻ \kie ludeguy the Toxicologist.#Octopode of Gozag Gold: 244.Health: 60/60 ========================h##Magic: 13/13 ========================..#AC: 1Str: 8#.#######EV: 13Int: 19#.#......SH: 5Dex: 12#........XL:  8 Next: 46% Place: Dungeon:5#@#Noise: ==-------  Time: 4853.5 (0.0)##.#c) +0 dagger (protect)#..#Cast: Poisonous Vapours#.##Tele ##.##.##h   black bear#.###.##.##As you read the scroll labelled MYGGURCHEWE, it crumbles to dust.  It is a scroll of brand weapon.  Your +0 dagger projects an invi\ki" sible shield of force!  b - a +0 dagger of protection; c -> W - a scroll of brand weapon _The black bear growls angrily. _A black bear is nearby!\ki+ m  Okay, then.\ki \ki* . _]kiwB]kiB]ki G]ki/I]kiM .. .#.. h#..# #######....... #.########.#.. #.###..## #.#..h]kiR l--4.5 (1Poisonous Vapours _]ki=V ]kiX ]ki.t ludeguy the Toxicologist..Octopode of Gozag Gold: 244.#Health: 60/60 ========================..Magic: 11/13 ====================----.##AC: 1Str: 8h.#EV: 13Int: 19#*#######SH: 5Dex: 12]ki&u ##*#......XL:  8 Next: 46% Place: Dungeon:5#@.......Noise: ---------  Time: 4854.5 (0.0)#.#######c) +0 dagger (protect)##.#Cast: Poisonous Vapours#..#Tele #.####.#h   black bear#.###.###.#Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a black bear (chance to weaken: 76%)  The glob of mercury hits the black bear!]kiC G.h]ki ]kir .]ki ]ki ==]ki: 5.5 (1]ki]kiP]kiLonfirm with . or Enter, or press ? or * to list all spells.]ki7~Aiming: Mercury Arrow (safe; 1% risk of failure)  ]ki TPress: ? - help, Shift-Dir - straight line  ]kit SAim: a black bear (chance to weaken: 76%)  ]ki 1The glob of mercury hits the black bear! ]ki Z_The black bear is moderately wounded.^ki|ludeguy the Toxicologist..Octopode of Gozag Gold: 244.#Health: 60/60 ========================..^ki>Magic: 10/13 ==================------.##AC: 1Str: 8..#EV: 13Int: 19#h#######SH: 5Dex: 12#.#......XL:  8 Next: 46% Place: Dungeon:5#@.......^kiNoise: ==-------  Time: 4855.5 (0.0)#.#######c) +0 dagger (protect)##.#Cast: Poisonous Vapours#..#Tele #.####.#h   black bear (poisoned)^ki~#.###.###.#^ki'Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.^kiHAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target^kiiAim: a black bear (moderately wounded)  Poisonous fumes billow around the black bear!^kio≈≈≈≈≈≈≈≈≈≈...........:.......#.!........................####...................@# ^ki%=......## ....... ....... ......#...........###... ^kiLonfirm with . or Enter, or press ? or * to list all spells.^kiEAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a black bear (moderately wounded)  ^ki?RPoisonous fumes billow around the black bear!  The black bear is poisoned.^ki2O  Your surroundings suddenly seem different.^ki^ki|--6.5 (1Poisonous Vapours^ki;^ki( _Found three items._kiXn K≈~≈≈≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈.......:.#.#!.....# ####..............####..=......##.#..#.##.......###..._kibr _kir A--7_kix _kiz `kiˇ#####........≈~≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈.......:#.#!...#`kiI..# ####..............####..=.##.#..#$.##.`kipG.......#.....#`ki`ki,&8`ki"`ki + _Found 13 gold pieces.`kix.≈≈# .#.###.©$≈≈#####.........≈~≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈.......:#.#!...#..# ####...`ki...........####..=.##.#...#$.##........#`ki^`ki&9`ki`ki* _Found 9 gold pieces.`kiSY#.≈≈ ##©###..≈≈# .#.###.©$≈≈#####........#.≈~≈≈≈#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈.......:#.#!...#..## ####...........`ki*...####..=.##.#...#$.##`ki`kiI`kin 60`kiH`kit* _Found a transporter.`kiP #.≈≈ jj . #.≈≈ ##©###..≈≈# .#.###.©..$≈≈#####........ #.≈~≈≈≈##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈#..........#.....:#.#`ki\Q#.....!...#..## ####..............####..jj 2 gnolls (1 wand, asleep)=.##`kiQZ.#...#`kim`kin1`kigw`ki{  You encounter 2 gnolls. _A gnoll is carrying a wand of polymorph.`ki8 ..#.≈≈ jj ..#.≈≈ ##©###.≈≈# .#.###.©. ..$≈≈#####. #.≈~≈≈≈ ##.≈~≈≈≈ #.`kip9 _ #......#.# #.....!.#.##.####.....####..   gnoll (asleep)......=......###.# `ki9 H .#`kiPF `kiF U1==2`kiV `kip  You pick up a parchment of Curse of Agony and begin reading...3.5 (2 _You add the spell Curse of Agony to your library.aki>..#.≈≈ jj .##W###..≈≈# .#.###.©. ..$≈≈#####........ #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈#................. #.# .........## ####.......####..=## W   phantom (wandering)#......## .$#4.5 (1 _You encounter a phantom.5.5 (2aki| _j - 2 bubbling grey potions (gained 1)akiPC##W###....≈≈# .#.###.©. ..$≈≈#####........ #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈#................. #.# ....## ####.......####..=###......# ##.$# .#==6.5 (1aki7  ..≈≈# .#.###.©. ..$≈≈#####........ #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈#................. #.# ...## ####.......####.. ##........# #7aki #  ..$≈≈#####........ #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈#................. #.# ...## ####.......####.. =## ###.....## ##...akiv aki &8aki aki& akiv   #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈#................. #.# ...## ####.......####.. =## #...... ###...#akiPw aki| &9akiF~ aki bkiE#.≈~≈≈≈ #.................# ##.##.#...##.####...#........##### #...... ##.# ##.$## ##. ##### ###... ##.#bkiBLl2==70bki{1.5 (2 _i - a +4 ring of slayingbki bkiQ JPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)g - an amulet of guardian spirit  i - a +4 ring of slaying Talismans (go to first with %)bki {a - a riddle talisman[?] describe selected [!] equip|wield|put on[tab] equip|unequip dkifdkiJdkiD##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈ludeguy the Toxicologist#.................Octopode of Gozag Gold: 244# #.............#.#Health: 60/60 ========================#.#...............#Magic: 12/13 ======================--#...............##AC: 1Str: 8#..............####...EV: 13Int: 19dkiv&#.....................SH: 5Dex: 12#..............####..XL:  8 Next: 46% Place: Dungeon:5.......@......##Noise: ---------  Time: 4871.5 (0.0).#............#c) +0 dagger (protect)##...........#Cast: Poisonous Vapoursdki##.$.......####........####.....#####...###.# _A gnoll is carrying a wand of polymorph.You pick up a parchment of Curse of Agony and begin reading... _You add the spell Curse of Agony to your library. _You encounter a phantom. _j - 2 bubbling grey potions (gained 1) _i - a +4 ring of slayingdkiqdki-2.0 (0.5dkijdkiV5 _i - a +4 ring of slaying (worn)dkiI #.................#.##.# #.#...# #.# ###... #........#####  .#. ##.# ##.$#dkiН3 ##. ##### ###... ##.# ##dkidki -3.0 (1.0dki%dkiѭdki #.##.# #.#...# #.# ###... #........#####   .#. ##.# ##.$# ##. #### ###... ##.# ## dki dki &4dki dki dki   #.#...#   #.#   ###..   #....  #####   #   .#.   ##.#   ##@$#   ##.   ####   ###...   ##.#   ##    dkiq dki &5dki dkiZ ekiQeki5& n #.#.#.#  #.#. #.  #.#### #..... ####.. #...# .#..#  ##..@.  ##.$# ##...  ###.....# ###...# eki& ##.# ## eki- ekiB. &6eki4 eki5 fki ..## ####.......#####.. #.##  .#  ## ### ##.  ###.....##fkiϐfki&7fkiƕfki8fkic573==8.0 (2fki,fki? _You now have 257 gold pieces (gained 13).fkiT  You have 6 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 1.0.fki-UfkiXfki[  Your damage rating with your +0 dagger of protection is about 12 (Base 4 x 105%_(Dex) x 112% (Skill) + 8 (Slay)).gkiO gki 3gki! gki# gki"( : _gki5) gki+ gki+ gki, gki]/ gki1 gki 2 gki2 gki5 gki*7 gki{7 :==gki7 gkif9 gki: gki: gki; gki> gki@ ,gki+B gki,D gkiF gkiF gkiG gki]I gkiJ gkiJ gkiK gkiL gki9O gkiyO gkiP gkiQ gki S gkiIS gkiS gkiEU gkinV gkiV gki$W gki+X gkiZ gki [ gki[ gkib^ gkia  You encounter an orc. It is wielding a +0 short sword.gkig     #.≈≈.##  #. #.~~.#   #.≈≈.##   #...#.≈≈.ß#.#  gkih ###...#.≈≈###..jj .  ......#.≈≈#... ##W###  ........≈≈#.#.#.###.©.  .......@≈≈#####........  ......#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈  o....##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈  ...#.#.................  .. #.#.............#.#  . #.#...............#o   orc (asleep)  #...............##  gkii #..............####..  #....................gkij c90.0 (12.0)o.gkisq Uogki#r 31.0 (13 _gkiPv gki} Q _You see here 9 gold pieces.gki+ #.≈≈.##  ##. #.~~.#  #.. #.≈≈.##  #...#.≈≈.ß#.#  ###...#.≈≈###..jj .  ......#.≈≈#...   ........≈≈#.#  .......@≈≈##  .o....#. .....##. ...#.#......... gki[+ .. #.#.........  . #.#.........  #...........  #........... #....hki+|#.≈≈.##  ##. #.~~.#  #.. #.≈≈.## hki|< #...#.≈≈.ß#.#  ###...#.≈≈###..jj .  ......#.≈≈#...  hki| ........≈≈#.#  .......@≈≈##  .o....#.hki }: .....##. ...#.#......... .. #.#.........hki}t . #.#.........  #........... #........... #....hkiLhkihkiq _An orc is nearby!hkiv #.≈≈.##  ##. #.~~.#  #.. #.≈≈.##  #...#.≈≈.ß#.#  ###...#.≈≈###..jj .  ......#.≈≈#...   ........≈≈#.#  .......@≈≈##  .o....#. .....##. ...#.#.........  .. #.#.........  . #.#.........  #...........  #........... #....hki*,Z#.≈≈.##  ##. #.~~.#  #.. #.≈≈.##  #...#.≈≈.ß#.#  ###...#.≈≈###..jj .  ......#.≈≈#...   ........≈≈#.#  .......@≈≈##  .o....#. .....##.hki," ...#.#......... .. #.#......... . #.#.........  #........... #...........hki,A #....hki3hki14hkiu9hki;[ _An orc is nearby!hki" hki CPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn) hki)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)g - an amulet of guardian spirit Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|put onhkiO [tab] equip|unequip iki iki iki' \ ludeguy the Toxicologist  #.≈≈.##Octopode of Gozag Gold: 257  ##. #.~~.#Health: 60/60 ========================  #.. #.≈≈.##Magic: 13/13 ========================  iki@( @#...#.≈≈.ß#.#AC: 1Str: 8  ###...#.≈≈###..jj .EV: 13Int: 19  ......#.≈≈#... ##W###SH: 5Dex: 12  ........≈≈#.#.#.###.©.XL:  8 Next: 46% Place: Dungeon:5  iki( %.......@≈≈#####........ Noise: ---------  Time: 4891.0 (0.0)  iki( .o....#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈ c) +0 dagger (protect)  iki) ].....##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈ Cast: Poisonous Vapours  ...#.#.................  ikiR) <.. #.#.............#.#  . #.#...............#o   orc  #...............##  #..............####..  iki) #....................Your damage rating with your +0 dagger of protection is about 12 (Base 4 x 105%_(Dex) x 112% (Skill) + 8 (Slay)). _You encounter an orc. It is wielding a +0 short sword. _You see here 9 gold pieces. _An orc is nearby! _An orc is nearby!iki/ P  Okay, then.iki60 iki8 D _jkisA8o.jkiVGjki4H4662.0 (1jkiOjkiR> _You now have 266 gold pieces (gained 9).jkiK  #..#.≈≈.##  ##..#.~~.#  #...#.≈≈.##  #...#.≈≈.ß#.#  #...#.≈≈###..jj .  .#.≈≈#... ##W###  .≈≈#.#.#.###.©.  .o...@.≈≈#####.  jki.#.≈~  .##.≈~  .#.#..  . #.#......#.#  . #.#..#  jki. #........##   #....####  jki;B #...jkiG.ojkijkiu?3Poisonous Vapoursjkijkijki    #..#.≈≈.##  ##..#.~~.#.  #...#.≈≈.##  #...#.≈≈.ß#.# #...#.≈≈###..jj . #.#.≈≈#... ##W### jkiA .≈≈#.#.#.###.©. .o.@..≈≈##### .#.≈~ .##.≈~ jkii .#.#... o...##.#....jki ......#.# $... #.#.....jki .# o   orc priest (asleep)jkiʰ j .. #........jki .## o   orc jki h.. #..............#### jki ? #jki) .oYou encounter an orc priest. It is wielding a +0 hand axe.jki< jki &4jki< jki  jki' _Found 17 gold pieces.jki'  You hit the orc but do no damage.Your weapon exudes an aura of protection.jki( 58- 8 =5jki3  _Your grab misses the orc. The orc hits you with a +0 short sword.jki $You hit the orc. You grab the orc.  The orc is heavily wounded.You constrict the orc!jki$(jki266 6Poisonous Vapoursjki]jki*G _You kill the orc!kki   #..#.≈≈.##  ##..#.~~.#.  #...#.≈≈.##  #...#.≈≈.ß#.#  #####...#.≈≈###..jj . kki>8#.#.≈≈#... ##W### .≈≈#.#.#.###.© .@...≈≈##### .#.≈~ .##.≈~ .#.#.....  .o...##.#.......#.kkif  .$... #.#....... . #........kkig.## .. #...kkiH  #kkikkiJ.-7kkikki$  Things that are here:kkiU _6 gold pieces; a +0 short swordkki Y   #..#.≈≈.##  ##..#.~~.#.  #...#.≈≈.## kkilE #...#.≈≈.ß#.#  #####...#.≈≈###..jj . #.#.≈≈#... ##W  #.≈≈#.#.#.###.  #$...≈≈##### .#.kki≈ .##.≈ .#.#.....kkiŀ'  ..o...##.#.#  ..$... #.# kkio.o #...# o   orc (asleep) .# #..kkiHZ.  #kkiq o.  You encounter an orc. It is wielding a +0 hand axe.kkisI.okkiowandering)o9-==8kki;kki% _The orc shouts!kki V  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kki kki" kkiN% kkiB(  kki~( _You can't see any susceptible monsters within range! (Use Z to cast anyway.)lki6#..#.≈≈.####..#.~~.#....#.≈≈.##.ß#.########..jj .###.......#.≈≈#... ##W##....≈≈#.#.#.###.$...≈≈#####.......#.≈≈≈≈≈≈≈≈≈≈≈≈##.#.#..............###$o.o ..... #..####.... #.....#lki9##lki9o.lki6o.lkiϸXolkiG=9Poisonous Vapours _The orc priest shouts!lkih #..#.≈≈.##ludeguy the Toxicologist ##..#.~~.#.Octopode of Gozag Gold: 266  #...#.≈≈.##Health: 59/60 =======================- #...#.≈≈.ß#.#Magic: 11/13 ====================---- lki]#####...#.≈≈###..jj . AC:  8  Str: 8  ###.......#.≈≈#... ##W## EV: 13Int: 19  #...........≈≈#.#.#.###. SH: 5Dex: 12  #.......$...≈≈#####..... XL:  8 Next: 46% Place: Dungeon:5  .......@..#.≈≈≈≈≈≈≈≈≈≈≈≈ Noise: ===------  Time: 4899.0 (0.0) lki ......*..##.≈≈≈≈≈≈≈≈≈≈≈≈ c) +0 dagger (protect)  .....*.#.#.............. Cast: Poisonous Vapours lki9 ....oo##.#.............#  ..$... #.#..............lki  ...... #...............# o   orc priest (weak)lki  .....# #..............## o   orc (weak) lkiI #.... #................ ##..............##lkioAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linelkiAim: an orc priest, wielding a +0 hand axe and wearing a +0 ring mail (chance  to weaken: 100%)  The glob of mercury hits the orc priest!  The orc priest looks weaker. The mercury splashes! The orc looks weaker.lki?i;o.lkii5o.lki1p&.lkipH 1 -900.0 (1lkiAvlkix  Press: ? - help, Shift-Dir - straight line  Aim: an orc priest, wielding a +0 hand axe and wearing a +0 ring mail (chance  to weaken: 100%)  The glob of mercury hits the orc priest!orc priest looks weaker. The mercury splashes! The orc looks weaker. _The orc priest is severely wounded.mkis9 #..#.≈≈.##  ludeguy the Toxicologist ##..#.~~.#.  Octopode of Gozag Gold: 266  #...#.≈≈.##  Health: 59/60 =======================- #...#.≈≈.ß#.#  Magic: 10/13 ==================------ #####...#.≈≈###..jj .  AC: 1mki Str: 8 ###.......#.≈≈#... ##W## EV: 13Int: 19 #...........≈≈#.#.#.###. SH: 5Dex: 12 #.......$...≈≈#####..... XL:  8 Next: 46% Place: Dungeon:5 .......@..#.≈≈≈≈≈≈≈≈≈≈≈≈ Noise: ==-------  Time: 4900.0 (0.0) mkiQ.........##.≈≈≈≈≈≈≈≈≈≈≈≈ c) +0 dagger (protect) .....$o#.#.............. Cast: Poisonous Vapours ......##.#.............# ..$... #.#.............. ...... #...............# o   orc priest (weak) .....# #..............## o   orc (weak) #.... #................ ##..............##Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc priest, wielding a +0 hand axe and wearing a +0 ring mail (severelywounded, weak)  Poisonous fumes billow around the orc priest!  The orc priest is poisoned.mkid9o.mkiįI   ##..#  #...#.≈≈.##  #...#.≈≈.ß#.#  #####...#.≈≈# .  ###.#.≈≈#...  #....≈≈# #....≈≈# ....# .......o.##mki .....$.#.# ......##.# ..$... #.# ...... #..o   orc (weak) .....# #.. #.... #... .mkik60=50-1.0 (1mkimki;  Press: ? - help, Dir - move target  Aim: an orc priest, wielding a +0 hand axe and wearing a +0 ring mail (severelywounded, weak)  Poisonous fumes billow around the orc priest!  The orc priest is poisoned. _You kill the orc priest!mki# g #..#.≈≈.##ludeguy the Toxicologist ##..#.~~.#.Octopode of Gozag Gold: 266  #...#.≈≈.##Health: 60/60 ======================== #...#.≈≈.ß#.#Magic: 9/13================-------- mki #####...#.≈≈###..jj . AC: 1Str: 8  ###.......#.≈≈#... ##W## EV: 13Int: 19  #...........≈≈#.#.#.###. SH: 5Dex: 12  #.......$...≈≈#####..... XL:  8 Next: 50% Place: Dungeon:5  .......@..#.≈≈≈≈≈≈≈≈≈≈≈≈ Noise: =--------  Time: 4901.0 (0.0) mkiF  .......o.##.≈≈≈≈≈≈≈≈≈≈≈≈ c) +0 dagger (protect)  .....$.#.#.............. Cast: Poisonous Vapoursmki   ......##.#.............#  ..$... #.#..............  ...... #...............# o   orc (poisoned, weak)  .....# #..............##mki 8  #.... #................ ##..............##Casting: Poisonous Vapours (safe; 1% risk of failure)  mkip Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetmki Aim: an orc, wielding a +0 hand axe and wearing a +0 leather armour (weak)  Poisonous fumes billow around the orc! The orc is poisoned.mki +2.0 (1mki mki@ 0Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an orc, wielding a +0 hand axe and wearing a +0 leather armour (weak)  Poisonous fumes billow around the orc! The orc is poisoned. _The orc barely misses you.mkiE $You hit the orc.  Your weapon exudes an aura of protection.  You grab the orc. You squeeze the orc.mkigLSmkiN 8 3Poisonous VapoursmkirRmkiqTG _You kill the orc!nki\ ##..#.~~.#....#.≈≈.##ß#.######...#.≈≈###..jj .###.......#.≈≈#... ##W##....≈≈#.#.#.###.$...≈≈#####.....nki9]..#.≈≈≈≈≈≈≈≈≈≈≈≈##$.#.#...............###..#### ##...nkig]E #..............##nkienki f.-4nkiDknkitj  You now have 274 gold pieces (gained 8).  Things that are here:nkiDub74-5.0 (2nkiznki}X _a +0 hand axe; a +0 leather armournki4nki&!nki#$  Things that are here:nki%x _a +0 hand axe; a +0 leather armournkiEM #..#.≈≈.###..#.~~.#.##  #...#.≈≈.ß#.#  #####...#.≈≈###..jj . ###.≈≈#... ##W##....≈≈#.#.#.###nkin#$...≈≈#####......#..).##.≈≈≈≈≈≈≈≈≈≈≈≈$.#. nki ......##.#.............#.nki! nkik. #### ##...nki"D nkinkisz10/13== 1 6.0 (1 _nkionkinkiz ` #..#.≈≈.##  ##..#.~~.#.  #...#.≈≈.##  #...#.≈≈.ß#.#  #####...#.≈≈###..jj .  ###.#.≈≈#... ##W# #.≈≈#.#.#.###.© #.$...≈≈#####. .#.≈~ .nki V).##.≈~ .....$.#.#. ......##.#.#. ..$... #.#. ...... #...# .....# #...nki] # #.... #.... #### ##.#nki nki 32747nki$" nki $ nki? vM  #..#.≈≈.###..#.~~.#.##  #...#.≈≈.ß#.#  #####...#.≈≈###..jj . ###.≈≈#... ##W###....≈≈#.#.#.###.©#nki ..≈≈#####.........#...).##.≈≈≈≈≈≈≈≈≈≈≈≈~   .....$.#.#................nki P.... #..nki nki &8nki nki M  You now have 280 gold pieces (gained 6).nkih 4809.0 (2nki nki 4 _You see here a +0 short sword.oki92   #..#.≈≈.##  ##..#.~~.#.  #...#.≈≈.##  #...#.≈≈.ß#.#  #####...#.≈≈###..jj .  ###.#.≈≈#... ##W  #oki 3.≈≈#.#.#.###.  #)...≈≈#####  .#.≈  .).##.≈  .....$.#.#.....  ......##.#.#oki3  ..$... #.#  ...... #...  .....# #...  #.... #oki=_==10.0 (1okiOokiQoki(7  #..#.≈≈.## #..#.~~.#.  #...#.≈≈.##  #...#.≈≈.ß#.# #####...#.≈≈###..jj .oki7 ]  ###.......#.≈≈#... ##W#  #....≈≈#.#.#.#  ##)...≈≈#####... ...#.≈≈≈≈≈≈≈≈≈≈≈  #).##.  #.....$.#.#.............  #......##.#  #..$... #.#.  #...... #.okiI8 G  #.....# #.  ##.... #...  #### ###oki@ okiA  okiA w A malevolent force fills the Dungeon...okiM /  --more--pki9:*pki C ==========1Mark You see here a +0 short sword.  A malevolent force fills the Dungeon...  With a horrendous wail, an alarm goes off!  A sentinel's mark forms upon you.  You hear a shout! x7; You hear an angry buzzing noise. You hear a shout! x8  You hear an angry hiss. You hear a loud, deep croak! You hear a shout! x3pki 7@pki3 7 _You hear a howl! You hear a bark!qkir ##..#.~~.#....#.≈≈.##ß#.#########..jj .###.......#.≈≈#... ##W#....≈≈#.#.#.###)####.......#.≈≈≈≈≈≈≈≈≈≈≈).##$.#.#..............##.$... #.###### #..............## --------- 2qki6a J  #...#.≈≈.##  #...#.≈≈.ß#.# #####...#.≈≈###..jj  ###.......#.≈≈#... ##W  #....≈≈#.#.#.#  ##qkiwa )...≈≈#####...  ...#.≈≈≈≈≈≈≈≈≈≈  #).##.qkia k  #.#.#............qkia  #......##.#  #..$...##.#qkia  #......##.  #.....###qkia ]  ##.... #.qki)b  ##### ##    #.#.qkip qki?q G---------3qkiuw qki j  You now have 284 gold pieces (gained 4).  Things that are here:qki a41==4.0 (2qki qki S _a +0 hand axe; a +0 ring mailrkid  #...#.≈≈.ß#.# #####...#.≈≈###..jj  ###.......#.≈≈#... ##  #....≈≈#.#.#.#  ##)...≈≈#####..  ...#.≈≈≈≈≈≈≈≈≈  #).##.  #.....).#.#...........  ##.#  #..$...##.#  #......##.  ###  ##....# #  ########    #.#rki\.  #.##.rkirkiX*5.0 (1rkirkirki}j #####...#.≈≈###..j  ###.......#.≈≈#... #  #....≈≈#.#.#.  ##)...≈≈#####.  ...#.≈≈≈≈≈≈≈≈  #).##.  #.....).#.#..........  #......##.#  #..$@..##.#  #......##.  ###rki  ##....# #  ########    #.#  #.##  . ##rki:rki%6rkiKrki1T^  #####...#.≈≈###..  ###.#.≈≈#...   #.≈≈#.#.#  ##.)...≈≈#####  #.#.  #.).##.  #.....).#.#  #......##.#  #..@...##.#  #......##  #.....###  ##....# #  ########  #  #.#  #.##  . ##rki#brkib%7rkiirki`vrkivg301==8.0 (2rki|rki? _You now have 301 gold pieces (gained 17).rki rkiOrkirkirki,rkirkiKrkirkirkiPrkirki@rkiL2==rkirkirrkirkirki/rkirkirkierkirkirkirkiw:==rkirki!BrkiKrkizrkirkirkiL3==rkirkiBrkiyrkirkirkirkiIrki ~  You encounter an orc. It is wielding a +0 whip.rkioo   orcrkio/31.0 (13.0)rkiMrki22.0 (14 _rki.&rkiK)ski{Y) ###......  #......... ##.......). #.......... #.......).# #.....).# #......# #..@...# #......# #.....## ##....#  ######skiZ@ . skib  ###......  #......... ##.......). #.......... #.......).# #.....).# #......# #..@...# #......# #.....##ski ##....#  ######    . skiskiskiSq _An orc is nearby!ski   #...#.≈≈.ß#.#  #####..o#.≈≈###..j ###o#.≈≈#...  #....≈≈#.#.#. #)...≈≈#####. #...#.≈ #.......).##.≈≈≈≈≈≈≈≈ #.....).#.#. #...@..##.#. #......##.# #.#. #.....###. ##....# #. #######o 2 orcs #... #.#.. #.##..ski( .o.oski0 skiX1 M==3.0)ski<6 ski[9 q _You encounter an orc. It is wielding a +0 dagger.tki #...#.≈≈.##   #...#.≈≈.ß#.#  #####...#.≈≈###..jj ####.≈≈#... ## #.o...≈≈#.#.#.# #)...≈≈#####.. #...#.≈ #.......).##.≈≈≈≈≈≈≈≈≈ #....@).#.#. #......##.#. #......##.# #.#. #.....###. ##....# #. ####### #... #.#..h.o.o.htkih   howler monkeyoo 2 orcstkiҒA4Poisonous VapourstkiԚtki ^ _You encounter a howler monkey.tki[3 #...#.≈≈.##  ludeguy the Toxicologist #...#.≈≈.ß#.#  Octopode of Gozag Gold: 301 #####.h.#.≈≈###..jj Health: 60/60 ======================== tkiC\###.......#.≈≈#... ## Magic: 11/13 ====================---- #.......o...≈≈#.#.#.# AC: 1Str: 8 ##......$)...≈≈#####.. EV: 13Int: 19 #..........#.≈≈≈≈≈≈≈≈≈ SH: 5Dex: 12 #.......).##.≈≈≈≈≈≈≈≈≈ XL:  8 Next: 50% Place: Dungeon:5 #....@).#.#........... Noise: ---------  Time: 4934.0 (0.0) #......##.#........... c) +0 dagger (protect) #......##.#........... Cast: Poisonous Vapours #......##............. Mark  #.....###............. tki\p##....# #............. h   howler monkey ########............. oo 2 orcs #.............. #.#............tki\MConfirm with . or Enter, or press ? or * to list all spells.tkiW]{Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an orc, wielding a +0 whip (chance to weaken: 100%)  The glob of mercury hits the orc! The orc looks weaker. The mercury splashes!  The orc looks weaker.tkiy{   #...#  #####.h.# ###.......#.  ... #... #*...# #.....*.).# # # # # # ##....#  ######   orc (weak)  tki Q.otki! 5Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an orc, wielding a +0 whip (chance to weaken: 100%)  The glob of mercury hits the orc! The orc looks weaker. The mercury splashes!orc looks weaker.  You kill the orc!tki# y oYou encounter a white imp.tkiw' T.htki0 ..5   white impoo 2 orcs (1 polearm, 1 weak)tki4 T301 ==5.0 (1tki< tkiB r _You encounter an orc. It is wielding a +0 trident.ukiO4 #...#.≈≈.##  ludeguy the Toxicologist #.5o#.≈≈.ß#.#  Octopode of Gozag Gold: 301  #####...#.≈≈###..jj Health: 60/60 ======================== ###....h..#.≈≈#... ## Magic: 10/13 ==================------ukiP #...........≈≈#.#.#.# AC: 1Str: 8 ##......$)...≈≈#####.. EV: 13Int: 19 #......o...#.≈≈≈≈≈≈≈≈≈ SH: 5Dex: 12uki #.......).##.≈≈≈≈≈≈≈≈≈ XL:  8 Next: 50% Place: Dungeon:5 #....@).#.#........... Noise: ==-------  Time: 4935.0 (0.0) #......##.#........... c) +0 dagger (protect)uki[ #......##.#........... Cast: Poisonous Vapours #......##............. Mark  #.....###............. ##....# #............. h   howler monkey ########............. 5   white imp #.............. oo 2 orcs (1 polearm, 1 weak) #.#............ _You encounter an orc. It is wielding a +0 trident.Casting: Mercury Arrow (safe; 1% risk of failure)  uki2dConfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +0 dagger and wearing a +0 leather armour (weak)uki[V.5ukigJ.ouki>Q.huki h  Casting: Mercury Arrow (safe; 1% risk of failure)ukiQonfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  ukiPress: ? - help, Dir - move target  Aim: an orc, wielding a +0 dagger and wearing a +0 leather armour (weak)  Poisonous fumes billow around the orc! The orc is poisoned.uki>s   #...#  #####.5o# ###.......# uki- #......h.... ##)... #...# #..#uki #.# #......## #......# #......# #.....## ##....# uki# ######h   hound 5   white imp oo 2 orcs (1 polearm, 1 poisoned, 1 weak)uki&2-6.0 (1uki<ukiV _You encounter a hound.ukii 3 #...#.≈≈.##  ludeguy the Toxicologist #...#.≈≈.ß#.#  Octopode of Gozag Gold: 301  #####.5o#.≈≈###..jj Health: 60/60 ======================== ###.......#h≈≈#... ## Magic: 9/13================--------ukiQj  #......h....≈≈#.#.#.# AC: 1Str: 8 ##......$)...≈≈#####.. EV: 13Int: 19 ukij #......$...#.≈≈≈≈≈≈≈≈≈ SH: 5Dex: 12 #.......).##.≈≈≈≈≈≈≈≈≈ XL:  8 Next: 50% Place: Dungeon:5ukij . #....@).#.#........... Noise: =--------  Time: 4936.0 (0.0) ukij #......##.#........... c) +0 dagger (protect) uki:k #......##.#........... Cast: Poisonous Vapours #......##............. Mark uki[k : #.....###............. uki{k ##....# #............. h   howler monkey ukik ########............. h   hound ukik #.............. 5   white imp ukil C#.#............ oo 2 orcs (1 polearm, 1 poisoned, 1 weak)Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +0 dagger and wearing a +0 leather armour (lightly  wounded, poisoned, weak)  Poisonous fumes billow around the orc!ukio U.huki4t oYou kill the orc!The howler monkey hoots and howls with incredible vigour!ukiVv oYou encounter an orc. It is wielding a +0 club.ukiw [.5uki{ J.oukiL    #.oo#  #####...# ###....5.o# uki  #......h..h. ##)... #...# #..# #.#uki  #......## #......#uki  #......# #.....## ##....# uki, (catching breath) ###### ukiM o   orc priest ukik 5   white imp(…)uki b1========7.0 (1ukiؑ =Poisonous Vapoursukiƛ uki" w _You encounter an orc priest. It is wielding a +0 flail.vkiR vkiT  Your spells (describe)TypeFailure Level  a + Poisonous VapoursvkiT Alchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  vkiT cc - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadiancevkiU Alchemy1%4  vki=U Ee - Sticky FlameFire/Alchemy4%vkimU 4 vkiU Select a spell to describe [?] help [!]/[I] toggle spell headerswkil wki wki wki<  #...#.≈≈.##ludeguy the Toxicologist #.oo#.≈≈.ß#.#Octopode of Gozag Gold: 301  wkiݴ #####...#.≈≈###..jj Health: 60/60 ========================  ###....5.o#.≈≈#... ## Magic: 9/13================--------  #......h..h.≈≈#.#.#.# AC: 1Str: 8wki   ##......$)...≈≈#####.. EV: 13Int: 19  #......$...#.≈≈≈≈≈≈≈≈≈ SH: 5Dex: 12  #.......).##.≈≈≈≈≈≈≈≈≈ XL:  8 Next: 51% Place: Dungeon:5  #....@).#.#........... Noise: ========-  Time: 4937.0 (0.0)  #......##.#........... c) +0 dagger (protect)  #......##.#........... Cast: Poisonous Vapours  #......##............. Mark   #.....###.............  ##....# #............. ki }1mh   howler monkey (catching breath)  ########............. h   hound #.............. o   orc priest #.#............ 5   white imp(…)wounded, poisoned, weak)  Poisonous fumes billow around the orc!  You kill the orc!The howler monkey hoots and howls with incredible vigour!You encounter an orc. It is wielding a +0 club. _You encounter an orc priest. It is wielding a +0 flail.wki 3wki wkiK xki  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.xkiZa .oo######...####....5.o#.#......h..h.##......$)...#......$...##.......).##....@).##......###......##......##.....####....#poisoned, catching bre…)######(poisoned)xkiZu(poisoned)You begin to radiate toxic energy. The hound is poisoned. The orc is poisoned.xki ".oo######...####....5.o#.#......h..h.##......$)...#......$...##.......).##....@).##......###......##......##.....####....#######xki $The orc priest is poisoned. The orc is poisoned. The howler monkey is poisoned.xki  h.  You kill the orc!.h.5 .oThe howler monkey looks even sicker.xki, S.hxki overy poisoned, catchino  unaware, dazed, poisoned)xki# 5-------===-----8.0 (1Poisonous VapoursToxic xki, xki? P _The orc priest is distracted by your dazzling golden aura.yki]  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d + Olgreb's Toxic Radiance Alchemy1% 4 e - Sticky FlameFire/Alchemy4%4 Select a spell to describe [?] help [!]/[I] toggle spell headerszkizkizkiy #...#.≈≈.##ludeguy the Toxicologist #.o$#.≈≈.ß#.#Octopode of Gozag Gold: 301  #####...#.≈≈###..jj Health: 60/60 ========================  ###.......#.≈≈#... ## Magic: 5/13zkiiA=========---------------  #.....5.o...≈≈#.#.#.# AC: 1Str: 8  ##......hh...≈≈#####.. EV: 13Int: 19  #......$...#.≈≈≈≈≈≈≈≈≈ SH: 5Dex: 12  #.......).##.≈≈≈≈≈≈≈≈≈ XL:  8 Next: 51% Place: Dungeon:5  #....@).#.#........... Noise: ===------  Time: 4938.0 (0.0) zki #......##.#........... c) +0 dagger (protect)  #......##.#........... Cast: Poisonous Vapours  #......##............. Mark Toxic   #.....###............. zki` ##....# #............. h   howler monkey (very poisoned, catchin…)  ########............. h   hound (poisoned) #.............. o   orc priest (unaware, dazed, poisoned) #.#............ 5   white imp(…)Confirm with . or Enter, or press ? or * to list all spells.You begin to radiate toxic energy. The hound is poisoned. The orc is poisoned.  The orc priest is poisoned. The orc is poisoned. The howler monkey is poisoned.You kill the orc!The howler monkey looks even sicker. _The orc priest is distracted by your dazzling golden aura.zkizkizki+zkijzkib  $hThe orc looks even sicker. The orc priest snaps out of its daze.)h.5.o.ozkiN Q$hzki C )zki/ h overyzki 4---9.0 (1zkiw zkiM  zki 1_The orc priest looks even sicker.{ki{kiE9---{ki}{kiF _Unknown command.|ki   #...#.≈≈.##  #..$#.≈≈.ß#.#  #####.o.#.≈≈###..  ###.#.≈≈#...   #.≈≈#.#.#.  ##....5.o)...≈≈#####  #......$h..#.  #.....h.).##.  #...@.).#.#  #......##.#  #......##.#  #......##  #.....###  ##....# #  ########  #  #.#|ki q $The hound looks even sicker.|ki# .hYou kill the orc!The orc priest looks even sicker. The howler monkey looks even sicker.|ki D.o|ki ].5|ki   oYour toxic aura wanes.|ki U.h|kiq( , catchin…) very poisoned)You encounter an orc. It is wielding a +0 hand axe.|kia+ S=========40|ki0 |kiA y _The howler monkey hoots and howls with incredible vigour!~ki,  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.~kiY #####.$.#.≈≈###  ###....o$.#.≈≈#.  #.....o.....≈≈#.#  ##....o.$)...≈≈###  #......$...#.≈≈≈≈≈  #...$.$.).##.  #..o..$.#.#.......  #......##.#  #@.....##.#  #......##.  ###  ##....# #  ########    #.#  #.##  . ##.oki>Q.okiB.o.okiIkiI%4kiI;=1kiRkiSkiS  $You hit the orc wizard.  Your weapon exudes an aura of protection.  Your grab misses the orc wizard. You squeeze the orc wizard!.o.oki U.oki }oo 2 orcs (1 polearm)kiP e== 8 7=2ki# ki% N _You kill the orc wizard!ki1  kiCasting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki4kikie _You don't have enough magic to cast this spell.ki  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kikiTkiki  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You don't have enough magic to cast this spell.  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)ki`onfirm with . or Enter, or press ? or * to list all spells. _You don't have enough magic to cast this spell.ki ki **kiR Ionfirm with . or Enter, or press ? or * to list all spells. _You don't have enough magic to cast this spell.  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You don't have enough magic to cast this spell.  The orc priest calls down the wrath of Beogh upon you.kiZ U.oki.\ I$okid 7@kile ^37----kie 3kil kiWo 4 _Pain shoots through your body!ki2|  #..$#.≈≈.ß#. #####.$.#.≈≈### ###.....$.#.≈≈#... #.ki<....≈≈#.#. ##......$)...≈≈#### #....oo$...#.≈ #...$.$.).##.≈≈≈≈≈≈ #..o..$.#.#. #.@....##.#.kiŶ #......##.# #.#. #.....###.ki ##....# #. ####### #...ki l #.#.. #.##..ki-kiK.okiy.ki1okiakih4----=ki  4ki@kiAO _The orc hits you with a +0 trident.  Things that are here:kir _7 gold pieces; a +0 dagger; a +1 robe of willpowerkikiL K.oki 9o$ki  You barely miss the orc. You grab the orc. You constrict the orc.ki 9 1 5ki ki P _The orc barely misses you.ki $You puncture the orc!  Your weapon exudes an aura of protection.kiM .oYou kill the orc!kiIoo(unaware, dazed)   orckiM 8 6kikiP _The orc priest is distracted by your dazzling golden aura.ki! { #...#.≈≈.##   #..$#.≈≈.ß#.# #####.$.#.≈≈### ###.....$.#.≈≈#...  #.....≈≈#.#. #)...≈≈##### #......$...#.≈ #...$.$.).##.≈≈≈≈≈≈≈ #.o@o.$.#.#. #.$....##.#. #......##.# #.#. #.....###. ##....# #. ####### #... #.#..ki ki &7ki!  _The orc closely misses you.Things that are here: _4 gold pieces; a +0 tridentki $You catch the helpless orc priest completely off-guard!  You puncture the orc priest!kit o   orc  You kill the orc priest!ki 5=4==718 _The orc hits you but does no damage.ki"kid%R _Your Dodging skill increases to level 4!ki%ki[   You barely miss the orc. Your grab misses the orc. You squeeze the orc.  The orc is severely wounded.kiV\ &9kia ki2d 1 _You block the orc's attack.kiy%e $You hit the orc.ki0Rki4b60Poisonous Vapourski;kiF _You kill the orc!You now have 305 gold pieces (gained 4).ki|G556kiG>=-1.0 (2kiNkiP0 _You see here a +0 trident.ki<\X  #...#.≈≈.##  #..$#.≈≈.ß#.  #####.$.#.≈≈###  ###.....$.#.≈≈#...  #.≈≈#.#.  ##......$)...≈≈  #......$...#.  #...$.$.).##.  #.@)$.$.#.#kin]  #.$....##.#  #......##.#  #......##  #.....###  ##....# #  ########  #  #.#kigkiphb==-2.0 (1ki/pkiQ  You now have 312 gold pieces (gained 7).  Things that are here:123.0 (2ki!kiQ _a +0 flail; a +0 scale mailki& $#.≈≈.ß#.#####.$.#.≈≈#####.................≈≈#.#kiq#$)###......$...#.≈≈≈≈≈≈$.$.).#))$.$.#.#............##kix.....##.. kiP#.##........ kiki[L7 1 ki4.0 (1ki_kij  You now have 319 gold pieces (gained 7).  Things that are here:ki595ki<==5.0 (2ki kiY _a +0 dagger; a +1 robe of willpowerki@%3ki&ki,ki -ki0ki2ki2ki4ki8kil9v3198=kiC:kim=ki=:==ki?kiB,ki^DkiFkiGK9=kiHkiJkiKki)LkiNkiN>6==kiNkiPki7RkidUj40=kiUkiUkiWki7[kib[ki\ki0_kie_:==ki`kicki>cD1=kidkihkihkiikilkilkinkipki q@27ki/q(=kiWrkiutkitkiukiy,kizkic~ki~N43=ki+kiڃki69=kikimkikiki,kiki4=8==kikiki֩kiīkikickiKkikiM#5kim(=kikiûki:==kiBki<,ki kikiU6=kiki,kiki7kiN9==kiki,ki ki[;7kiFkikikikiki"3==ki0kikiLa8=ki+ki^kitkikikiGkiaki9=10/13==kiXkikikiki0kijkikiki$50ki#E===ki!kizkiki ki ki kikilki#1kiK=1==kiki ki$ki%ki 'ki),ki*ki-/kip/%2kio1ki4ki$5:==kiK6ki 9,ki::ki<ki<ki=kiAkiBD3=kiEkiGkiGE2==kiHkibK,kiLki OkiUO?4=kiwOkiPkio==ki;pkita5=kiwkiswki;ykiR},kikin _You start resting.Magic restored.ki݋ki225026.0 (61.0)kiEb3==7.0 (62 _kibkiki$3kiki#ki&k6=ki+,ki;.ki3,ki5kiAn7==kiADkiJ,kiMkiR,ki UkimYkiY58=kiZkiV\ki`ki aki]ckigkigkiikibnkinki|pkitki*ukiNuN9=kiwki1|ki]|kip~kiFkiki"kiWk _You start resting.HP restored.ki-kiڛ-40.0 (13ki^b60=1.0 (14 _kiӣki0kip9 ki9 ki; ki\@ kiD kiH ,kiiL ?  You see here a +0 trident.kiP kiQ  _kiS kif   You now have 326 gold pieces (gained 7).26 _You see here a +0 flail.=kii kin ki"o &32kit kix M _You now have 332 gold pieces (gained 6).ki Iki} ki ,ki kit kiӟ %7ki ki% M _You now have 337 gold pieces (gained 5).ki ki kiH ki j  You now have 344 gold pieces (gained 7).  Things that are here:ki &44ki ki b _a +0 hand axe; a +0 ring mailki kiz ki ki ki\ ki kif ki j  You now have 351 gold pieces (gained 7).  Things that are here:ki2 &51ki ki e _a +0 dagger; a +0 leather armourki ki7 ki ki  You now have 364 gold pieces (gained 13).  Things that are here:64ki_ kiX $ ki M_a +0 trident; a +0 leather armour; a +0 whipkic ki ki~ ki# ki Bki$ j  You now have 369 gold pieces (gained 5).  Things that are here:ki$ %9ki) kiF. ` _a +0 flail; a +0 scale mailki3 ki74 ki7 kif? j  You now have 375 gold pieces (gained 6).  Things that are here:ki? &75kiC ki]V c _a +0 hand axe; a +0 scale mailki^ 3ki_ kii  You now have 380 gold pieces (gained 5).  Things that are here:80ki#m ki=x _ _a +0 club; a +0 chain mailki} 3ki ki8 kiׇ ki2 ki? ki kig ki ki= ki ki kiE ki kin ki ki ki ki ki. ki ki ki2 kiE ki kiS ki ki Xki] j _You encounter a killer bee.ki# kiu ki kii j _The killer bee buzzes angrily. You hear a croak. You hear a shout! x4ki3 SWater ki ki > _You enter the deep water.ki%  You encounter 2 gnolls.A gnoll is wielding a +0 halberd of pain. A gnoll is carrying a wand ofparalysis.ki( ki+ kiB?  You encounter a gnoll bouda. It is wielding a +0 whip.kil   #.. #...# ##### .  #...# ....#..  #...###.#.....  #.......  #....≈≈≈≈≈≈≈≈≈  #....≈≈≈≈≈≈≈≈≈  #..#.≈@##74.0 (33 #....≈≈#.#  #..#.≈≈# ..  #..#.≈≈## j.j  #..#.≈≈.ß# ### #..#.≈≈.## ⌠ j   gnoll bouda ##.i m m.#.~~.#yj   gnoll (polearm) #...#.≈≈.##. #..)#.≈≈.ß#.# _The gnoll leaves your sight. _Key pressed, stopping explore.ki kiY kiD ki kiz .kij ki : _kiR kil ki ki ki kiIJ ki ki kiL ki 8 .##.. .## #...# ######..# #...# #....#..# #...###.#.....#####.................#....≈≈≈≈..#....≈≈≈≈≈@≈≈≈≈≈..7.0 (ki_ a3.0)#..#.≈≈#####......#....≈≈#.# #.###.©ki #..#.≈≈#..j ## # #..#.≈≈###..j#..#.≈≈.ß#.#### j   gnoll (wand, wandering)ki #..#.≈≈.## # ⌠j###..#.~~.#y .#...#.≈≈.##.ki .ki Mjki} *8.0 (4kiX ki G _Found a transporter. The gnoll leaves your sight.kiL#Iki&ki?39y.ki3.ki4Fj⌠ki6Cj.ki7.jki=  The gnoll shouts! You hear a shout! You hear an angry hiss. The gnoll shouts!  You hear a shout!kiA3kixLA _The gnoll leaves your sight.kiPl  A black bear comes into view.ki}Ze.##..#.## #...# ######..# #...# #....#..# #...###.#.....#######...................#....≈≈≈≈≈≈≈≈≈≈≈...≈#....≈≈≈≈≈≈≈≈≈≈≈...≈#..#.≈≈#####@......hkiZp#....≈≈#.#j#.###.©.##..#.≈≈#...### # ###..#.≈≈###.... #..#.≈≈.ß#j####kiZj#..#.≈≈.##y#j⌠.# h   black bear (wandering)##..#.~~.#..j.. . ki[j   gnoll bouda#...#.≈≈.##.#.⌠ ki6[jj 2 gnolls (1 wand)#..)#.≈≈.ß#.#ki_u 9.0 (1jYou hear a croak.ki`L.hkiaG'jkib3jkiXd3jkit.j   gnoll sergeant (polearm)j   gnoll boudajjjj 4 gnolls (2 wands, 1 polearm)kit680.0 (2kikiz _You encounter a gnoll sergeant. It is wielding a +0 spear.ki̔( #.#  #.##### #....#..# ###.#.....######...............≈≈..≈≈≈≈≈≈≈@≈≈≈...≈#.≈≈#####..........≈≈#.#j#.###.©h#.j.###.# ######.j.j .ß#.###### #..#.≈≈.##y#j⌠.##..#.~~.#..'j. ..#.≈≈.##.#.⌠ki{/j.kimK.jki`;j.ki2h.kikiX1.0 (1Water ki*kit/ _You enter the deep water.ki#.##..#.# ######......##.#.....######................≈≈≈≈≈≈≈≈≈≈≈...≈ki #.≈≈#####@.........≈≈#.#j#.###.h.##.≈≈#..j###.# ##ki. ###.jj. . .ß#.######kiM##y#jj.# ##..#.~~.#..'.. .kip...#.≈≈.##.#.⌠ )#.≈≈.ß#.# jjj 3 gnolls (2 wands)ki61jki/j 4 gnolls (2 wands)2kiwki p _You encounter a gnoll. It is wielding a +0 club.kiJ  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki K #.#######..#ki5 #....#..###.#.....######...............≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈≈...≈#@.......#.###.h.#ki^ t###.# ###hpoisonedki h)You begin to radiate toxic energy.  The black bear growls angrily.kif#.#######..##....#..###.#.....######...............≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈≈...≈#@.......#.###.h.####.# ###kihSh©kijG'jkitHvery poisoned)kitb9/13 --------===kiu63Toxic kikiS _The black bear is poisoned. The black bear looks even sicker.ki /h.ki 8 ki5 V---4Poisonous Vapourski l _Your toxic aura wanes.ki ki EQuiver which action? ([-] to clear) Items ([,] to cycle)Zap: wand of paralysis (1)Zap: wand of mindburst (8) ki ,Spells ([,] to cycle)  a - Cast: Poisonous Vapoursb - Cast: Mercury Arrow  c - Cast: Mephitic Cloud  d - Cast: Olgreb's Toxic Radiance ki,  e - Cast: Sticky Flame (4%) Abilities ([,] to cycle) kiO @Abil: Potion Petition Abil: Call Merchant kin Abil: Bribe Branch ki ][*/%] inventory [&] all spells [^] all abilities[!] focus mode: off|onkiki.#.#ludeguy the Toxicologist#..#.##Octopode of Gozag Gold: 380#...# ######..#Health: 60/60 ========================#...# #....#..#Magic: 9/13================--------#...###.#.....######AC: 1Str: 8#...................EV: 13Int: 19#....≈≈≈≈≈≈≈≈≈≈≈...≈SH: 5ki/Dex: 12#....≈≈≈≈≈≈≈≈≈≈≈...≈XL:  8 Next: 71% Place: Dungeon:5#..#.≈≈#####@..h....Noise: ---------  Time: 5084.0 (0.0)#....≈≈#.#j#.###.©.#c) +0 dagger (protect)#..#.≈≈#..j###.# ###Cast: Poisonous Vapours#..#.≈≈###.jj. .#..#.≈≈.ß#.#######..#.≈≈.##y#jj.#h   black bear (very poisoned)##..#.~~.#..'j. .j   gnoll sergeant (polearm)ki0&#...#.≈≈.##.#.⌠j   gnoll bouda#..)#.≈≈.ß#.#jjjj 4 gnolls (2 wands)Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.You begin to radiate toxic energy.  The black bear growls angrily. _The black bear is poisoned. The black bear looks even sicker. _Your toxic aura wanes.ki#1ki?ki@ki9D  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki f #.# ludeguy the Toxicologist  #.. #.## Octopode of Gozag Gold: 380  #...# ######..# Health: 60/60 ========================  #...# #....#..# Magic: 7/13============------------  #...###.#.....######  AC: 1Str: 8  #...................  EV: 13Int: 19  #....≈≈≈≈≈≈≈≈≈≈≈...≈  SH: 5Dex: 12  #....≈≈≈≈≈≈≈≈≈***..≈  XL:  8 Next: 71% Place: Dungeon:5  #..#.≈≈#####@**h*...  Noise: ---------  Time: 5084.0 (0.0)  #....≈≈#.#j#.###*©.#  c) iif`40m+0 dagger (protect)  #..#.≈≈#..j###.# ###  Cast: Poisonous Vapours  #..#.≈≈###.jj. .  #..#.≈≈.ß#.######  #..#.≈≈.##y#jj.#  h   black bear (very poisoned)  ##..#.~~.#..'j. .  j   gnoll sergeant (polearm) kif #...#.≈≈.##.#.⌠ j   gnoll bouda  #..)#.≈≈.ß#.# jjjj 4 gnolls (2 wands) _Your toxic aura wanes.kif.Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a black bear (moderately wounded, very poisoned, chance to weaken: 76%)ki% v#.#ludeguy the ToxicologistkiT% '#..#.##Octopode of Gozag Gold: 380#...# ######..#ki% WHealth: 60/60 ========================#...# #....#..#Magic: 7/13============------------ki% #...###.#.....######AC: 1Str: 8#...................ki% EV: 13Int: 19#....≈≈≈≈≈≈≈≈≈≈≈...≈kiU& FSH: 5Dex: 12#....≈≈≈≈≈≈≈≈≈≈≈...≈XL:  8 Next: 71% Place: Dungeon:5#..#.≈≈#####@****...Noise: ---------  Time: 5084.0 (0.0)#....≈≈#.#j#.###.©.#c) +0 dagger (protect)ki& #..#.≈≈#..j###.# ###Cast: Poisonous Vapours#..#.≈≈###.jj. .ki& #..#.≈≈.ß#.#######..#.≈≈.##y#jj.#ki& h   black bear (very poisoned)##..#.~~.#..'j. .ki& j   gnoll sergeant (polearm)#...#.≈≈.##.#.⌠ki ' j   gnoll bouda#..)#.≈≈.ß#.#ki5' Ijjjj 4 gnolls (2 wands) _Your toxic aura wanes.Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  ki' Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a black bear (moderately wounded, very poisoned, chance to weaken: 76%)kiJ 1yki 1h.ki .ki .h..y  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a black bear (moderately wounded, very poisoned, chance to weaken: 76%)  The glob of mercury misses the black bear.ki 4==5.0 (1ki> ki 7 _The killer bee leaves your sight.kiCf  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiW #.#ludeguy the Toxicologist#..#.##Octopode of Gozag Gold: 380#...# ######..#Health: 60/60 ========================#...# #....#..#Magic: 4/13=======-----------------#...###.#.....######AC: 1Str: 8#...................EV: 13Int: 19#....≈≈≈≈≈≈≈≈≈≈≈...≈SH: 5ki CDex: 12#....≈≈≈≈≈≈≈≈###...≈XL:  8 Next: 71% Place: Dungeon:5#..#.≈≈#####@###....Noise: ==-------  Time: 5085.0 (0.0)#....≈≈#.#j#.###.©.#c) +0 dagger (protect)#..#.≈≈#..j###.# ###Cast: Poisonous Vapourskif #..#.≈≈###yjj. .#..#.≈≈.ß#.#######..#.≈≈.##y#jj.#h   black bear (very poisoned)##..#.~~.#..'j. .j   gnoll sergeant (polearm)ki 4#...#.≈≈.##.#.⌠j   gnoll bouda#..)#.≈≈.ß#.#jjjj 4 gnolls (2 wands)Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki+ Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a black bear (moderately wounded, very poisoned, chance to affect: 72%)  The flask of dizzying concoctions shatters into a vile cloud!kiki;yh○Press: ? - help, Shift-Dir - straight line  Aim: a black bear (moderately wounded, very poisoned, chance to affect: 72%)  The flask of dizzying concoctions shatters into a vile cloud!  The black bear is moderately wounded.  You hear an angry buzzing noise.black bear is engulfed in noxious fumes.ki" §☼≈§hconfused, very poisoned)The black bear appears confused.=======6.0 (1ki8kiJ _You hear an angry hiss. You hear a loud, deep croak!ki4Sblack bear appears confused. _You hear an angry hiss. You hear a loud, deep croak!it the black bear.  Your weapon exudes an aura of protection.  Your grab misses the black bear. You squeeze the black bear.  The black bear is severely wounded.ki[ §hYou encounter an adder.ki LS⌠kiߤ/yki☼°. y   killer bee (wandering)(…)ki{ 8 =------7kik$ ki4_The black bear is engulfed in noxious fumes.ki;  #.#  #.##### #....#..# ###.#.....######...............≈≈..≈≈≈≈≈≈≈@§☼≈...≈#.≈≈#####.☼°§......≈≈#.#j#h###.©.#..j###.# ######yjj. .ß#.###### #..#.≈≈.##.#jj.##..#.~~.#..yjS ..#.≈≈.##.#.⌠ki< 1'kihD Qh..kiT ○. Syjjjjj 5 gnolls (2 wands, 1 polearm)kiT -------8Water kib kie / _You enter the deep water.ki_  $You hit the black bear. You grab the black bear.  The black bear is almost dead.You constrict the black bear!ki ○j   gnoll sergeant (polearm)j   gnoll boudajjjjj 5 gnolls (2 wands, 1 polearm)kiЕ 380 5==82=9Poisonous Vapourski ki N _You kill the black bear!ki`#.##..#.# ######......##.#.....######................≈≈≈≈≈≈≈≈≈≈≈...≈§○#.≈≈#####@○.§....kiD\..≈≈#.#j#.###.©.##.≈≈#..j###.# #####yjj. . .ß#.########.#jjS# ##..#.~~.#..'j. ....#.≈≈.##y#.⌠ jjjj 4 gnolls (2 wands))#.≈≈.ß#.#ki<°☼ki9-90kiki≈°6-1.0 (2kikiH> _You now have 386 gold pieces (gained 6).ki U#..#.# ######..#....##.#.....######................≈≈≈≈≈≈≈≈≈≈≈...≈§#.≈≈#####.°.☼......≈≈#.#j#@###.©.##.≈≈#..j###.# ###ki> ##yjj. . .ß#.########.#jjS###..#.~~.#..'j. j...#.≈≈.##y#.⌠ #.jjjjj 5 gnolls (2 wands, 1 wandering))#.≈≈.ß#.#### #'ki S   adder ####.).#.≈≈###..jj .ki jYou encounter a gnoll. It is wielding a +0 flail..ki ..○j 2 gnoll sergeants (polearms) 4 gnolls (2 wands) _You now have 386 gold pieces (gained 6).  You encounter a gnoll. It is wielding a +0 flail.You encounter a gnoll sergeant. It is wielding the +6 spear of Immorality  {vamp, ^Drain rF- rCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam  Harm rCorr Int+2}, wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6SInv} and wearing an amulet of chemistry.ki +2.0 (1ki ki 2 _The gnoll leaves your sight.ki) #.#  #.###### #....#..# ###.#.....######...............≈..≈≈≈≈≈≈≈≈§≈≈...≈#.≈≈#####@..○......≈≈#.#j#.###.©.#kit..j###.# ######yjjj .ß#.###### #..#.≈≈.##.#jjS##..#.~~.#..'j. . j   gnoll bouda.#.≈≈.##y#.⌠ #. jjjj 4 gnolls (2 wands)  #..)#.≈≈.ß#.#### #'kie3jki.kiA2j   gnoll sergeant (polearm)j 5 gnolls (2 wands)ki3V== 1 3kiki ki]kikikikiJC I #.#  #.##### #....#..# kiC ###.#.....######...............≈..≈≈≈≈≈≈≈@§≈≈...≈#.≈≈#####...○......≈≈#.#j#.###.©.#..j###j# ######yjj. .kiD Xß#.######j 2 gnoll sergeants (polearms) #..#.≈≈.##.#jjS#kiJD 8#..#.~~.#..'jj . jjjjj 6 gnolls (2 wands, 1 polearm).#.≈≈.##y#.⌠ #.ki^ 9°ki_ S4Water kifs ki?~ / _You enter the deep water.kiL #.# #.. #.## #...# ######..# #...# #....#..# #...###.#.....###### #. #....≈...≈ #....≈§≈≈...≈ #..#.≈≈#####...°....kiM #....≈≈#.#j#.###.©.# #..#.≈≈#..j###j# ### #..#.≈≈###.jj. . #..#.≈≈.ß#.######   gnoll sergeant (polearm) #..#.≈≈.##.#jjS# ##..#.~~.#..'jj .jjj 51 #...#.≈≈.##y#.⌠ #.S   adderkiR1FkikS3jkiSTkiT.kiYe;☼.F   bullfrog (wandering)jj2s, 1 polearm).kif%5kiskizY _You encounter a bullfrog.kiB 3ki|J kiBS 9F.kiU .jkiW ki X 4j.kiZ 8F.kib kiHg kiUi kis kiy ki| kis ki! ki T6==ki kiZ ki ki ki- kiI Bki kiZ ki2 ,ki ki* ki ,ki5 ki ki7 ki> P==kiKF kiT kiL] @386kic kioq kiu ki~ kiچ ki ki kiğ ki ki ,ki ki ki ki$ F7=ki ki W _You start resting.ki 3kiP ki ,ki ki) ,ki. ki> kib? 9=kiC kiP kiQ ki9U kic ,kik ki ,ki ki N8==kiu ki ki} ,ki~ ki ki ki^ ki ki. ki kib ki- ki ki :==ki ki" ,ki( ki< ,kiMB kiN d9==kiR kid ,kiRh kit ,ki+x ki ,ki ki P==kiԘ ki ,ki ki: ki ki$ ki~ ,kiH ki, ~10/13==ki ,ki ki ki ki ki ,ki" ki4 ki4 :==kig; kizL ,kiQ ki] ,kid kifz kiz kiJ ki ki] L1==ki ki? kiƪ ki kiw ,ki kiE ,ki ki ki :==ki ki,kiTki'',kieNki0^b2==kiekiAs,kizki/,kiœkikipkiBkiki:==kiEki,kiki`,kiki ,kikib _The bullfrog gives a loud, deep croak!  Magic restored.ki&+i≈jjjj.j   gnoll sergeant (polearm).jjkiU=1150.0 (55.0)ki=a3==1.0 (56 _kikiX ki;3kiCkiVkiGZkiz[kik,kiqki,kiki'P==ki.ki9,kiki,kiki)kixkiBkikikikih3,ki =kiPkibkij,ki rkiki,kiDkiSkikikiDki ,kikiki8ki ,ki'ki6?ki?kiGkihki_qkiqkiykikix,kidki,kiEki,kiki,ki4kil,ki ki3,kiD6kiF,kipMki_,kigfki4oki~u,kizkiki,kikiyki,kikikiki3kiU?kiO,kihWki2tkiX},kiki'kikiki3ki kiki+ki\ki,ki kiskir,kiki,ki ki,ki&ki]nki5ekiekimkiW _You start waiting.kiki ki@,kiki,ki?ki,kivki,kiki,kikiJ,kiH!ki;ki;ki^FkiTkiZ^,ki#gki {ki~ki,kiHki kikiki,kiqkiVkiki_ki,kiski9z _The bullfrog releases a deep croak.kio"kiv+ki3ki=3kiFkiXkiakii,kiYqkiׅki6,kirki7207.W   phantomj   gnoll sergeant (polearm)Wj   gnoll boudajjjj 4 gnolls (2 wands)(…)ki<ki&ki:0 _The gnoll sergeant shouts!kiki@XGear: 9/52 gear slots (Left/Right to switch category) Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)g - an amulet of guardian spirit Talismans (go to first with %)a - a riddle talismanki` i - a +4 ring of slaying (worn). A ring that increases the wearer's accuracy and damage with ranged weapons and melee attacks. It affects your accuracy and damage with ranged weapons and melee (+4). You found it on level 5 of the Dungeon. Stash search prefixes: {inventory} {Slay+4} {jewellery} Menu/colouring prefixes: identified equipped jewellery _________________ “Life is too short to occupy oneself with the slaying of the slain more than  once.”  -Thomas Huxley (r)emove, (d)rop, (=)adjust, or (i)nscribe.kii Gear: 9/52 gear slots (Left/Right to switch category) Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)  g - an amulet of guardian spirit Talismans (go to first with %)a - a riddle talismankiskis~kiߎludeguy the Toxicologist#.#Octopode of Gozag Gold: 386#..#.##Health: 60/60 ========================#...# ######..#Magic: 13/13 ========================#...# #....#..#AC: 1Str: 8#...###.#.....######EV: 13Int: 19#...................SH: 5kis Dex: 12#....≈≈≈≈≈≈≈≈≈≈≈...≈XL:  8 Next: 82% Place: Dungeon:5#....≈≈≈≈≈≈@≈≈≈≈...≈Noise: ---------  Time: 5207.0 (0.0)#..#.≈≈#####........c) +0 dagger (protect)#....≈≈#.#j#.###.©.#Cast: Poisonous VapourskiH#..#.≈≈#.jj###j# ###Water #..#.≈≈###.jj. .kiǏ#..#.≈≈.ß#.######W   phantomkic#..#.≈≈.##.#jjS#j   gnoll sergeant (polearm)##..#.~~.#..jW. .kitj   gnoll bouda#...#.≈≈.##.#.⌠ #.jjjj 4 gnolls (2 wands)(…)_You start resting. _The bullfrog gives a loud, deep croak! _Magic restored. _You start waiting. _The bullfrog releases a deep croak. _The gnoll sergeant shouts!ki 3kiԳkiܷkiz 3kia kiH kik ..jki ki ki] ki 3ki ki ki kiS ,ki ki kiH- ki4 ki< kiC kigI kiI kiP kig kin kixn kir kiFu kij ki ki ki C  The killer bee buzzes angrily.ki kiN ki C _The phantom leaves your sight.ki kiV ki ki] ki kia ki ki ki ki ki& ki? ki ki_ ki ki ki' kiq ki~ ki0 :Water ki[ kix > _You enter the deep water.ki ki kio ki ki" kiW# ki$ ki ' kif* ki* ki+ ki- ki1 ki32 ki3 kiq5 kib8 ki8 ki9 ki; ki\> ki> ki>? kiA kiJC kiC (kiAD kiE kiG kiDH kiH kiJ ki|L ,kiM kiO kiP kiFQ kiQ ki/S kigU kiU ki5V kiYW kiqY kiY ki6Z ki\ ki^ kiM^ ki^ ki^` kic ,kic kiUf kiZh kih kimi kik kim ,kiyn kiq kibt kit kiu kix kizz kiz ki{ ki} ki kiƀ ki kiF ki ki ki kiK ki9 ki ki[ ki kiF :##...##....# ##....## ##......## #........# ##........##  ##...#. ki ` #............#  ##.....@....... 40.0 (33.0) ##########..#.......!..... #..........#............ .# ........#.##............ .. ki ≈≈≈≈≈≈≈...###........... .## ≈≈≈≈≈≈≈..## #........... ..# ki C#####≈≈.## ##.........[ #h##### #.#.#≈≈.# ###........ #.#....  kit #...#≈≈.# #.. #......kiD ki ,1.0 (34ki ki I _Found a scale mail.kikijkikiki=kiki$,ki&ki&ki(ki*ki-ki3.ki/ki 5ki5ki5ki7ki;ki;kih=kiAu _o - 2 murky coppery potions (gained 1)kihkiki=kiki ki kio ki{ kikiki)ki ki,kiUkikiki[kizki ki5#kiu#ki$ki&kij)ki)ki*ki-ki/,ki2,ki4ki4ki5kia7ki@:ki:ki3;ki<ki@,kiAkiBkiDkiEki0Fki8J,kiJkiMq _c - 8 potions of curing (gained 1)kimPkiPki8Qki SkiU,ki WkiXkiNZkiZki[ki@d#. #.## ..# .# ##.## ##...## #.....## ##...#..### ....##@..# 62.0 (21 ##....###....#  ##......###  #........##.## ##........##..# # ##..........#..# #............#.##  ##...............#####..#.............#kihki9kT _Key pressed, stopping explore.ki~IkikikiʆP _kiJkikikiًkiO,kikiKkikiki6kiɟkiӡki&kikikiѦkikiqkiki#kijkikikiدkikikikiijki8kikikiط,kibkiki%,ki}kikiy,kikiki^,kikiki,kiSkikiki!kikikiykikiki.ki ki,kiki7,kiki kiki*kikikikiki$ki7kikikiCki;kiki%kikiRkikikiokikiki,kiki kikikiki[kiki1kiki ki3ki9XkiPAXki1JXkiJ,kiKkiMkiPki!QkiBRkiSkiWkiFWkiXki\ki _kii_kie`kiobkie,ki3gkijkimkimkiEokiqki^tkitkiukiAzkiZ}ki}ki~kikiEkikikiki̊kiki:ki9ki\kikiki.kikikiژkiki)kirkikikikiPkikikikiԧkikikiլkikikikikikikiki,kikiki˹kikikikikikiki=ki`,kikiki ,kikikikikikikikikiKki^kiYkikikikikiv,kiakiUkikiki}kikiki6kikiki)kikikiki/kikikikikiGkikiO,kikikikiTkikikikikiikickiU$ki)Bki*ki-,ki/kiX1kid4ki4ki5ki"8ki";kia;ki<ki>kiABkiBkiCki^FkiyLBkiqMkiPki"QkixRkiTkiWkiXkiXkiZki],ki^kiG`kibki$ckickieki+hkiyhki4ikijkim,kinki}okiQr,kirkiEtkiv,kiwkiQxkizkiK{ki{ki|kikikikikikiIkiψki9kikikikikikikickiݓki0,kiki ki,ki kiXkiΟkitki-kiԡkiƤkiKkikiPkiةki#kiYkiki,kiۮkiki,kiakiGkiki׷kiki,ki,kikiki,kixkikikikiIkiakikikiski3kiBkiki2Bkikikikimki|kikikikiki<,kiki kiBki4kiW,kikikiki8kiwkikiki&kiwkikikikikikikikikiYki,kiYkikikikickiki,kidkikkikikiQkiki ,ki ki< kiD ,ki kikikikikikikiz,ki4kinkikiki.7 _You open the door.ki3kikiG"@  There is an open door here.ki;%ki% _ki&ki(ki*,ki+ki3  #.... #...#######################.##......................##........##############.#..###.#.#####.## #.#....##..#+###.###'.##.#kiR3]#..#⌠#.@#.###.#397.0 (135.0) #.+###'.#.# ##... ..###.# #....kiq3 #._.#⌠..# ##...#ki3 ###.. ###.# #....# # +## +.#.# ##....#  ki'4# ..#.# ##......  ## ##+ #.......  ##.......  _You open the door.ki6Z _Found a glowing silver altar of Zin.kijkikipkikiSki: _ki@  There is an open door here.kiKki _kiki ki kiS ki kiki!kiki*ki)kiWkiki:ki_7 _You open the door.ki3kivkiG@  There is an open door here.kiki  _ki_ ki!ki#ki9#kiZ#ki}$7 _You open the door.ki%ki*&ki&ki*@  There is an open door here.ki+kiV, _ki,ki^.ki1kiH1ki1ki3There is an open door here. _You open the door. _There is an open door here. _You open the door. _There is an open door here.  ki5ki5 _kif6kiU7ki8,ki9ki:kiw<,ki<ki=ki?ki?ki@kiAYou open the door. _There is an open door here. _You open the door. _There is an open door here. _You open the door.kiCki3Dki\Dki(FThere is an open door here. _You open the door. _There is an open door here. _You open the door.  There is an open door here.kiGkiH _kiHki'JkiK,kiZLkiMYou open the door. _There is an open door here. _You open the door. _There is an open door here. _You open the door.kiO3kiPkiQThere is an open door here. _You open the door. _There is an open door here. _You open the doorki R&.  There is an open door here.kiHTkiT _kiUkiIWkiY,kiYkiZki\,ki2]ki;^kiP`,ki`ki ckiNf,kimgkiikijkijkikkipki[pki3qkiJtYou open the door. _There is an open door here. _You open the door. _There is an open door here. _W - 2 scrolls of brand weapon (gained 1)kiw3kixki3zki|,ki_}kiN~ki,kikiki,kizkiσkiY,kikiki),kiUkiki,kiekiQkiő,kiNkikickiki8ki1ki,kiDkikiki,kiki|kikiEki̠kib,kikiO _a - 2 scrolls of enchant armour (gained 1)ki3kiki%ki,ki0kikikikikiCkikiAkikiWki,kiqkikiƺ&95kikiM _You now have 395 gold pieces (gained 9).kiki:kikikikikikiki`,kikiki ######  ####....##  #........#  #........# ..###.......###########....@................445.0 (48.0)ki[.....##................[... #...#####...###.#. ##..# ##....# #.#. #..# #....+###.# #..###....#..#⌠#. #..##.....#.+###' ##.##....####...#ki#.#.......⌠#._.#kikki,6.0 (49kikiC _Found a robe.ki{kikiKki ki ki:Bkixkikikiki,kigkickiC,kiki(&ki)ki*ki*ki/ki 1,ki1ki4ki8,ki9ki;kiF=kiy=ki=ki>kiA,kiBkiEkiH,ki{IkiLkiO,kiPkiRkiU,kiVkiuXki[,ki\ki]ki_,ki3`kiakid,kifkihkij,ki lki?nkitx@ ######### ####....##  #.......# #........#  ##......# #........#   .. ####...###.......####   #...#####...............  #...........##.........   ##..###.[....##...#####.   #.....#......###..# ##..   ......# #..# #62.0 (16  ........# #..###   ............## #..##...  ...........# ##.##...   .............# #.#.....   .............# #...## kix  ##...........# #..## #.  ###)........# #..# #   ##.# ki~ki~,3.0 (17kiki* _Found a short sword.ki=a3kiVckifkiXjkiWm,kioki6w; ##......# #........#  .. ####...###.......###### #...#####........... #...........##........... ##..###.[....##...##### #.....#......###..# ## .............# #..# #....+kiw .............# #..###....# ..## #..##.....#4.0) ..# ##.##....## ..# #.#... ..# #...###.## ##kiw# #..## #..# ###)kiw^# #..# ##.#kiTx ####.....## ##.# #.'  #...)## #.# #.. #.# ##ki kiMkij$5.0 (2kiki# _Found a whip.ki| kiv| ki~ ki ki2 kix Bki ,kiŽ ki ki5 kit ki% ki ki ,kiy ki# ki ,ki ki ki# kiM kiV ki ki ,kiK kiӮ ki~ ki kil kiӲ ki ki ki ki kiG kip ki kiC ki ,ki kip ki ki ki ki kin ki ki kio kiq ,ki kib ki% ,kii ki kio ki kir ki] ,ki[ ki kii ,ki ki@ ki ki- kiw ki kikikikikiA ,kiV kikikikiki(kiRki}kiki|kiykikiki!ki $,ki$ki.'ki)ki)ki*ki.ki0,ki1ki4ki7Bki:ki$>ki>ki?kiwBki.DkiZDkiDkiCGkiIkiIki,Kki]OkiRkiRkiSkiUkiWkiXkiYki]Bki]ki,`kiBbki c:Water kitckie> _You enter the deep water.kigki hkihkijkilkilkimkiokirkiErkiskiuki@wkiwkixki{ki}ki}ki~kiƀki,kikiki/kiۋkikikiAkikiߔ?Water ki–ki)kiȝkiki=Water kikiki/kikikiki=kikiki4kizkikikikiXkiki*ki[kikimki8kiki kiki%kidkikiki2ki1kiki?kikikikikimki ki$ki4kiHkiYkiki:(ki ki&ki+ki.ki.ki0kiV4ki 9kiG<ki<ki^>kiAkikikiAki kiki,kiki&ki~+ki0kiR1ki 4kik9ki>kiBkiCkiEkiuNki`ki@gkiEvki,kiDki}$ ki'_The gnoll shouts! You hear a shout! x2kikiZkiki3kikiki,kiki,kikiki*kiT,ki`kil,kiGvkiΘkikiSkiki ,ki\kikiPki-ki)ki:Water kiPki> _You enter the deep water.ki kiUkikikikiEkikiq#ki)ki%*(ki,ki: .#.⌠.#..ß#.Wj#.##.≈≈.# .######'######j# ≈≈.# ............jj.###≈≈.# kip:.###©#####.###... ≈≈.## .#.###.©.###.#.# #≈≈..# ##...........#####≈≈..# ki:≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ki;N≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ..........# ##536.0 (71.0) ......#.#kio;Q...# ###.. ........##.$.# ###< ......###.... #...... .....##ki;z.... #...... ................ #...... ki;.....####..............# #.....< ....## ..............# #.... ki<>....# #......ki%<kiI=ki,HkiJ ki-KN_Key pressed, stopping explore.kiZw3kiiykiI}ki ki: _ki҉kiF.........jj.###≈≈.# ##©#####.###...#≈≈.## ###.©.###.#.#.#≈≈..# ..........#####≈≈..# ≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ### ki'y....................# ###>. ....#.#.............## ###....##$.# ###<.....7.0 (1.0)###..#......####....# #........kir# #..####..## #.....<## ki# #..# .# #........kiۘ# .[# #.. .## ki +#..kitkiki=$8.0 (2kikiI _Found a scale mail.kipkikikidkiHkikiu,kikiӪkikikikiki kikiejj.###≈≈.# ####.###...#≈≈.## ## #.©.###.#.#.#≈≈..# #.ki<l#####≈≈..# ##.~≈≈≈..# #..~≈≈≈..# ####.kia...# ###>... .#.#...ki..## ###...##...........@.# ###<... .###...ki}# #... ####...# #...ki# #... ####...## #.....<... # ...# #... ...# #... .[...ki:j# #... #...ki]ki 41.0 (3  You now have enough gold to petition Gozag for potion effects.ki54082.0 (4kiki? _You now have 408 gold pieces (gained 13).ki!kikiki%kikiki ,kihkikikikikikibkiki[kiki}kikikiukiYkiFkiki8ki/kikikikiki3kikikikikikiki ki!ki#ki&kiO'ki(ki_*ki0Xki7 .............# #..............  .[..........# #.............. ........## #............. .........###.............# ..........#.............## .......##..###.........##  ki&8w......##..## ###.<..##...  .....###.### ######### ...## #..@.# ##56.0 (14.0) ### #......#  ki8#...#  #$...> ####.......# #####..## ### ki@ki_A,7.0 (15ki2GkiI; _Found a stone staircase leading down.ki+5 ki5 kiu6 ki8 ki; ki? BkiA ,kiB kiC kiF kiF kiG kicK kiK &22ki>L kiN N _You now have 422 gold pieces (gained 14).kiQ kiKQ kiQ kiV kiY ki}Y kiY ki[ ki] ki:^ ki^ ki'` kiib kib ki6c kik kiRu kiKx kix kix kiy kiz ki} ,ki~ ki kic ki ki ki kiX ki ki1 kiN kiӍ ,ki ki* ki ki ki ki kiÜ ,ki ,kig ,ki ki- ki_ ki ki ki ki ki ki ki$ ki̻ ki! ki ki ki ki kiy kiY kip ki ki kie kiV ki ki ki ki* ,kiA ki( ki ki ki ki ki ki kiI ,ki ki( ki ki ki] ki ki ki ki ki ki ki ki+ Xki0 ,kii3 kiD6 ki: ,ki< ki? kiC kiUD kiE ki1H kizL ,kiM kiFQ kipU ,ki\W kiZ ki^ kiS_ :Water ki` kid > _You enter the deep water.kij ki,m kim kio kiu A _The gnoll leaves your sight.kix 3kiz kip ki ki ki ki ki ,ki kiI ki ki kiܰ kiԵ ki ,ki kiĿ ki ki2 (kiS kiQ kiz ki ki ki ki+ ki ki ,ki ki ki kiW ki ki> ki kib ki kir ki ,ki ki kih! ki! ki" ki"# ki$ ,ki% ki- ki0 ki@1 ki6 ki< ki!@ kiv@ kiA kiD kihH kiH kiI kiL ki*P kiP kiQ ki8Z Xki\ ki_ ki_ ki a kic kiwf kif kig kij ki9o ,kip kir kiv ki@w kix kiL{ ki ki` ki ki; ki؄ ,ki ki\ ki ki kiٍ ki ki ,kih ki kiK ki kiF kif ki ki kic ki< ki ki ki2 kiJ ki ki ki ki ki ki ki3 ki ki ki kia ki ki kiN ki ki$ ki ,ki ki]P ki9Y Bki/Z kig] ki] kiL^ ki_ kib kic ,kie kih ,ki~i ki&t   #.....###.#  ##....# #...  ########..#  #..............#  ##### #.#..#   #....##.##..  ##......####.........##  #.......## ##........#   #......@.## ###.....## 650.0 (93  ..........## ###...# kit  ...........## ###.#  ........##..# ###  ........###.##  ........# ##.##  ........# ##.##  ........# ##.##  .....## ##.#kiu kix{ ki} T _Key pressed, stopping explore.ki _ki2 ki P _ki ki ki ki kil ki˳ kiw ki{ ki ki ki ki ki¾ ki# kiĿ ki kih kiK ki ki% ki ki ki ki ki> ki ki" ki ki ki ki kim ki ki ki~ ki ki ki* ki ki kix ,kix ki kiO ki kie ki ki ki  ki0 ki! kik% ki% kio& ki/ ki1 kiA2 ki2 ki:: ki= ki> ki? ki5G kiJ BkimQ kiT kitU kiV ki\ kiOd Bkij Xkiq ki#t kizt kiu ki} ki ,ki4 ki? ki ,kip ki$ kiޞ kiB ki: ki kia kiέ kix ki ki> ,ki ki? kil ki ki ki ki ,ki ki ki kim kis ki Bki kiykie1`ki3ki4,ki0:kiF>,ki?kiCkiG,kiHkiLkiVXkiZ,ki[ki`ki>dkidkiekiRkkio,kipkivkiykiSzki*|ki^kiykikiސkib  You see here a +0 scale mail.kikki _kijkikikiki̧kikiۯ,ki|kikiBkiki,kiki%ki,kikikikikiki7kiL,kiGkikifkikikikikiEkikiki,kikiki,kikiki,kikiki,ki]kikiBki< kiZ ,ki ki ki ,kiki^ki,kiHkikiki[kiki>kikikiki!ki)Xki+,ki,ki./ki2kii2ki4ki6ki8,ki9ki|;ki>,kix?kiAkiH.## #.....<............# .# #............).....# .# #.................## .# #................## .## #...............## ..###.............### ...#.............## ##..###.........### #..## ###.<..##.@.# 719.0 (69 #.### #########...# ....### ##..... ......### .... ........### ... .........># >. ##.......## .  #####..## ####kiki-20.0 (70kiki; _Found a stone staircase leading down.ki3kikiFkiOkikiv,kikiU,kikikidkikiki,kikiki,kikikikikikiki,ki kiZkiki,kikiz,kikiki[kikiki:ki)ki~kikikikikihki&kiL,kikidkiikikikikiki9ki!kiekihkikibkikiLkikikiki,kiki ki< ,ki ki kiXkikikikiki,kiZkiVkikikifkiA........#  .........#  ...).....#  ........##  .......## ....## ....### ...## # ..### #### 43.0 (23..### ####....##  ###...####.....###   ###.........##   ##.........#   ###..........#  kiB   #......>....##  .......##  #########  kiBkiFkiJ] _Partly explored, unvisited transporter.ki<ki3=3ki7l0.0).........####..............kirs _Partly explored, unvisited transporter.ki IkiZ 4kij ki ] _Partly explored, unvisited transporter.ki Iki> ki. ki& ki' ] _Partly explored, unvisited transporter.ki-kia.ki.kiW;ki$@P _ki8EkiE,kiAI,kiKkiKkiLki7OkiS,kiSki VkiXki7YkiYki?\ki&_kiq_ki-`ki;bki2ekieki>fkiBhkijkikkilkimkipkipkiqkiskivkifvki,wkixki{ki{ki|ki}kibkikiDki=kikiTki#kiʈkikiًkiŒkiki#ki}kikiwkikiki kidkikikikiki1kikikiki$.## ###<...........#∩.♣# # #..............#...# # #..............#♣..# # #..................# ## #.....<............# kiԯ# #............).....# # #.................## # #................## ## #............@..## 61.0 (18.0) .###.............### ..#............. #### #..###.### ####..# ki..## ###.<..##...### ####....## .### #########...####.....### kiBF...### ###.........## .....### ##.........# .......### ###..........#kiYkikiki]IkijkimkiqBkiu,kiwkiVykiXkikikinkipkiPkikiNkiki2kikiki ;≈≈≈..# ####.#### .....# ###>......## .....## ###..........#### ......## ###<..#∩.♣# .......# #..#...# .......# #........#♣..# .......# #.......# ......## #.....<............# ......# #.....).....#7.0 (6.0).....# #...........##....# #................## ......## #...............##.....###.............#ki##.......#.............##..##..###.........### ## ##..## ###.<..##...### ####. ############...####.... kiGkikiM ki ki ki ki;zkizkiUkii ki ki kiҵ kiA kiļ ,kiݽ ki ki- kiP ki ki ki ki kiP ki ki ki ki ki? kiz ki ki ki ,kid kiw kik ki ki3 ki kiW ki ki ki ki ki ki kiE kia ki ki3 ki& ki5 kiu ki ki ki ,ki ki ki ,ki ki ki ,ki ki ki; kin kio ki BkiJ ki kil ki kiz ki ki ki ki ki ki ,ki ki ki6 kix ki ki% 6###'######.#ß.≈≈.# ......###≈≈.# ©#####.###S..#≈≈.## # ##.©.###.#j#.#≈≈..# #ki,& ..#####≈≈..# ## ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# #. ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ####.............# ###>...#.#......## ###......87.0 (20.0)kiz& ##.......## ###<.......###.........# #.......... .####.........# #..........ki& .......# #.......... .####.......## #.....<.... ## #...............# #.......... ki' # #...............# #......... # #....[..........# #......ki' ki, ki^. kiT ki kiW kiǛ kirkiskiStkizki,kikikiSPWater kiki> _You enter the deep water.ki3kiEkikiZ,ki~kiukikiki˸kiӹki7kikiDki kiQki kicki,ki kiki,ki>ki kih _The gnoll shouts! You hear a loud, deep croak! You hear a shout! x2ki3ki7!ki%kib&ki}*kiQ4ki9ki9?ki?kiCkiKki UkirZ,ki_ki)lki:tki&yki}ki~kikikiakiF,kiki[..#.≈≈.ß#.######'######.#ß.≈≈.##.≈≈.##.#.⌠j#.jß#!!.#.##.≈≈.# ..#.~~.#j.'.....©j#:..'..#.~~.# ..#.≈≈.##.#.⌠.#..ß#F.j#.##.≈≈.# )#.≈≈.ß#.######'######.#ß.≈≈.# ).#.≈≈###......j....j.jj###≈≈.# ).#.≈≈#...###©#####.###...#≈≈.## ≈≈#.#.#.###.©.###.#W#.#≈≈..# kil)...≈≈#####.....#####≈≈..# 800.0 (13#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ..................###.#.............##....##.............# W   phantom ....###............jjj 3 gnolls (1 wand, wandering) ....####............... ....................kiSkikiIkiWkiHXki`kidkii; ki< kiJ ki9N ki^#.≈≈.##.#.⌠j#.jß#!!.#.##.≈≈.# #.~~.#j.'.....©j#:..'..#.~~.# #.≈≈.##.#.⌠.#..ß#F..#.##.≈≈.# ki=_)#.≈≈.ß#.######'######.#ß.≈≈.# #.≈≈###......j......jj###≈≈.# .#.≈≈#...###©#####j###...#≈≈.# ...≈≈#.#.#.###.©.###.#W#.#≈≈..# ≈≈#####...........#####≈≈..# ki_.#.≈≈≈≈≈≈≈≈≈≈≈≈~@≈≈≈≈≈≈≈≈≈≈≈..# ##.≈~≈≈≈≈≈≈≈≈≈≈≈≈..# #.............................# #.#.#..# #.ki`r.#. ..###...####..# jj 2 gnolls (1 polearm, 1 wandering).......kik`>#######kie.kif2jkirjjwand, 1 polearm)kis#1kis;.0)Water kiHki"/ _You enter the deep water.kiI U.#.≈≈.##.#.⌠j#.jß#!!.#.##.≈≈.#ludeguy the Toxicologist .#.~~.#j.'.....©j#:..'..#.~~.#Octopode of Gozag Gold: 422 .#.≈≈.##.#.⌠.#..ß#F.j#.##.≈≈.#ki J JHealth: 60/60 ======================== )#.≈≈.ß#.######'######.#ß.≈≈.#Magic: 13/13 ======================== .#.≈≈###.....j.......jj###≈≈.#AC: 1Str: 8 ki7J V.#.≈≈#...###©#####j###...#≈≈.##EV: 13Int: 19 kiaJ ...≈≈#.#.#.###.©.###.#W#.#≈≈..#SH: 5kiJ Dex: 12 ...≈≈#####...........#####≈≈..#XL:  8 Next: 82% Place: Dungeon:5 .#.≈≈≈≈≈≈≈≈≈≈≈≈~@≈≈≈≈≈≈≈≈≈≈≈..#ki;K /Noise: ---------  Time: 5801.0 (0.0) ##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#c) +0 dagger (protect) kiK #.............................#Cast: Poisonous Vapours #.............#.#.............## Water #...............##.............## kiL ..............###...............# W   phantom .............####...............# jj 2 gnolls (1 wand, 1 polearm) ................................# .............####..............## _Partly explored, unvisited transporter. kiL _You enter the deep water. _The gnoll shouts! You hear a loud, deep croak! You hear a shout! x2 _You enter the deep water.  Press: ? - help, v - describe, . - travelSome deep water.ki W.@The floor.kiO6..ki$M#.  A stone wall.ki4 .# _The gnoll shouts! You hear a loud, deep croak! You hear a shout! x2 _You enter the deep water.  Press: ? - help, . - travelYou can't see that place.  [the floor.]kicX#.a stone wall.]kiQ [ß#granite statue.]kiH ijßfountain of clear blue water.]kik5 Qj#stone wall.]kigO #:, g - get itemStash: a manual of Short Blades]  [the floor.]kiF :.the floor.]ki :., g - get itemStash: a manual of Short Blades]  [the floor.]ki ;.#.≈≈.##.#.⌠j#.jß#!!.#.##.≈≈.#ludeguy the Toxicologist .#.~~.#j.'.....©j#:..'..#.~~.#Octopode of Gozag Gold: 422 .#.≈≈.##.#.⌠.#..ß#F.j#.##.≈≈.#Health: 60/60 ======================== )#.≈≈.ß#.######'######.#ß.≈≈.#Magic: 13/13 ======================== .#.≈≈###.....j.......jj###≈≈.#AC: 1Str: 8 ki;.#.≈≈#...###©#####j###...#≈≈.##EV: 13Int: 19 ...≈≈#.#.#.###.©.###.#W#.#≈≈..#SH: 5Dex: 12 ...≈≈#####...........#####≈≈..#XL:  8 Next: 82% Place: Dungeon:5 .#.≈≈≈≈≈≈≈≈≈≈≈≈~@≈≈≈≈≈≈≈≈≈≈≈..#Noise: ---------  Time: 5801.0 (0.0) ##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#c) +0 dagger (protect) #.............................#Cast: Poisonous Vapours #.............#.#.............## Water ki<#...............##.............## ..............###...............# W   phantom .............####...............# jj 2 gnolls (1 wand, 1 polearm) ................................# .............####..............## _The gnoll shouts! You hear a loud, deep croak! You hear a shout! x2 _You enter the deep water.  Press: ? - help, . - travel, g - get itemYou can't see that place.  [Stash: a manual of Short Blades]  [the floor.]ki=kiEJkidM. _ki#.~~.#j.'.....©j#:..'..#.~~.# #.≈≈.##.#.⌠.#..ß#F.j#.##.≈≈.# #.≈≈.ß#.######'######.#ß.≈≈.# #.≈≈###.....j........j###≈≈.# #.≈≈#...###©#####j###...#≈≈.# ..≈≈#.#.#.###.©.###.#W#.#≈≈..# ≈≈#####...........#####≈≈..# #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# #.≈~≈..# .............................# .#.## ..# ....###..#####.ki[40m.# .....# F   bullfrog.####..## j   gnoll (polearm)## #..#ki0jkir⌠j 2 gnolls (1 polearm, 1 wandering)ki.12.0 (1 _kikiki(s.≈≈.##.#.⌠.#.jß#F.j#.##.≈≈.# .≈≈.ß#.######'######.#ß.≈≈.# .≈≈###.....j........j###≈≈.# .≈≈#...###©#####j###...#≈≈.# .≈≈#.#.#.###.©.###.#W#.#≈≈..# ≈≈#####...........#####≈≈..# ≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .≈~≈..# ................@...........# #.##.....#kiO#...###.. #..####..# #........# #..####..## # j   gnoll (polearm).## #...# ## #.# #ki_0jki.j 2 gnolls (1 polearm, 1 wandering)ki,03ki ki ki ≈≈.ß#.######j######.#ß.≈≈.# ≈≈###.....j.........###≈≈.# ≈≈#...###©#####j###...#≈≈.# ≈≈#.#.#.###.©.###.#W#.#≈≈..# ≈≈#####...........#####≈≈..# ≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ≈~≈..# ..........................# ..#.##....######..ki / #.####.# #.....# #.###### #.## #..# #. j   gnoll (polearm)# #.# #.# #....[# #.kit# kiN$ &4ki- ki1 ki8 ?###.....j.........###≈≈.# #...###©#####j###...#≈≈.##.#.#.###.©.###.#W#.#≈≈..# #####...........#####≈≈..# ≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ~≈..# ..........................# .#.### #.#######.. #..####.# #.....# #.###### #.## #..# #.# #.# #.# #....[# #.## #......kiz9 B## #.ki|F kiPG &5kiP kiR kiO6###.....j.###≈≈.# #...###©#####j###...#≈≈.## #.#.#.###.©.###.#W#.#≈≈..# #####.#####≈≈..# ~≈..# ~≈..# # #.#.## ###.## ###<###.# #.####.# #...# #.####.## #.## #.# #.# #.kieN# #.# #....[.# #.## #.## #.kiki&6kiOkiNki( .....j.###≈≈.# ...###©#####j###...#≈≈.## .#.#.###.©.###.#W#.#≈≈..# .#####≈≈..# ~≈..# ~≈..# # ##.#.ki ## ###.## ###<.###.# #.####.# #.# #.####.ki1 ## #.## #.# #.j   gnoll (polearm)# #.# #....ki B# #....[.# #.## #.## #.kiߙ ki~ &7kiv ki ki^ .....j.###≈≈.# ###©#####j###...#≈≈.## #.#.###.©.###.#W#.#≈≈..# .#####≈≈..# ~≈ki x..# ~≈..# # ##.#.## ###.##.## ###<.###.# #.####.# #.ki # #.####.## #.## #.# #.kiF !# #.# #.# #....[.# #.kim p## #.## #.ki kiv &8ki ki kiw .....j.###≈≈.# ###©#####j###...#≈≈.## .#.###.©.###.#W#.#≈≈..# .#####≈≈..# ~≈..# ~≈..# ## kidx ##.#.## ###.##.## ###<.###.# #.####.# #.# #.####.## #.....<## #.# #.# #.# #.kiy # #....[.# #.## #.## #.kiυ kiy &9kid ki^ ki >j.###≈≈.# ###©#####j###...#≈≈.## #.###.©.###.#W#.#≈≈..# .#####≈≈..# ~≈..# ~≈..# ## ###>#.#.## ###.##.## ###<.###.# #.####.# #.# #.####.kih ## #.....<.## #.# #.# #.# #. # #....[.# #. ## #.## #. ki ki> '10ki ki ki Xj.###≈≈.# ©#####j###...#≈≈.## .###.©.###.#W#.#≈≈..# .#####≈≈..# ~≈..# ~≈..# ## kih ###>.#.#.## ###.##.## ###<.###.# #.####.# #.# #.####.## #.....<.## #.# #.# #.# #.# #....[.# #. .## #.## #.ki} kiw &1ki ki@& ki+] j.###≈≈.# ©#####j###...#≈≈.## ###.©.###.#W#.#≈≈..# #####≈≈..# #~≈..# #~≈..# ## ###>.#.#.## ###.##.## ###<.###.kiS^ # #.####.# #.# #.####.## #.....<. .## #.# #. .# #.# #. .# #....[.# #. ## #.## #.kig kiah &2ki0n kiKp ki j.###≈≈.# ©#####j###...#≈≈.## #.©.###.#W#.#≈≈..# ######≈≈..# #~≈..# #.kim K~≈..# ####.# ###>.#.#.## ###.##.## ###<.###.# #. .####.# #.# #. .####.## #.....<. ## #.# #. # #.# #. # #....[.# #. # #.## #.kip 0jki! j   gnoll (wandering)ki &3kig ki kin lj.###≈≈.# # #####j###.j.#≈≈.## # #.©.###.#W#.#≈≈..# #.ki8 #####≈≈..# ##.~≈..# #.~≈..# ####.## ###>. .#.#.## ###.##.## ###<. .###.# #. ki `####.# #.# #. ####.## #.....<. # #.# #.  #.kiř # #.  #....[.# #. ki n #.## #.kiB G.jkim ki &4ki۰ ki3 ki$4ki*ki/ki?##j######.#ß. j.........###≈≈.#  ####j###...#≈≈.## #.©.###.#W#j# ........###### #.. ≈≈~≈≈≈≈≈≈≈≈≈≈≈≈ ####.# .... ###>#.#.## ### ...##ki### ###< .#### ...... #####< #.[ kil_jjki&5kiki' _The gnoll shouts!kiJ4..ß#F.j#.## ##j######.#ß. j.........###≈≈.#  ####j###...#≈≈.## #.©.###.#W#j# ........#####ki# #.. ≈≈~≈≈≈≈≈≈≈≈≈≈≈≈ ####.# .... ###>#.#.## ### ...#### ###< .# #### ...... #ki\####< #.kiLkic&6ki ki kii?...©⌠#:..'..#.~~.# .#..ß#F.j#.##.≈≈.# ###j######.#ß.≈≈.# .j.........###≈≈. ©#####j###...#≈≈.## # ##.©.###.#W#j#≈≈..# # .........#####≈≈..#ki., ##≈~≈..# #. ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈@.# #### .....# ###>#.## ### ....### ###< ..###.# # .####.# # ......# #..... .####.## #.....< ## #.# #kiki&7ki ki̬ki$j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###...#≈≈.# ##.©.###.#W#j# .........###### ki≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈ ####... ###>#.#.## ###..#### ###<.# .##### ....... .#####<kioki%&8ki>kiCki3 ###'######.#ß#### j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###...#≈≈.# ##.©.###.#W#j# .........###### ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈ ####... ###>#.#.## ###..#### ###<.. .##### .......9kiDn~M.j.........#######..## ###'######.#ß#### kinj#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###...#≈≈.# ##.©.###.#W#j# kio.........###### kiMoz≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#####.kioki5pb........... kiyki '20ki*kiMj#####.###...##....... .j.........#######..## ###'######.#ß#### j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###...#≈≈@## ##.©.###.#W#j# .........###### ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..##...........jkiIj   gnoll (wandering)ki &1kiNki78 M##.©.###.#.####. j#####.###...###....... .j.........#######..## ###'######.#ß#### j#.jß#!!.#j##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## kiy###j######.#ß. .j.........###≈≈@#  ©#####j###..F#≈≈.## ##.©.###.#W#j#≈≈..# .........#####≈≈..###F   bullfrog..........kitG.jkiki;&2kikiki`.........#####≈≈.## ##..[ ##.©.###.#.#j###. j#####.###...###....... .j.........#######..## ###'######.#ß#### ki`j#.jß#!!.#.##.≈≈ ...©⌠#:..'.j#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###..F#≈≈.# ##.©.###.#W#j#≈≈..# .........#####≈≈..## W   phantom ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈kibt ####. j   gnoll sergeant (polearm, wandering)........ ###>F   bullfrog#.#.## ###j   gnoll (wandering)kigG.jkih9W.kiTxki &3kikiki ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#.#.###. j#####.###..j###....... .j.........#######..## ###'######.#ß#### j#.jß#!!.#.##.≈≈ .kic..©⌠#:..'.j#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###.WF#≈≈.# ##.©.###.#.#j# .........#####≈≈..### ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈ ####... ###>ki75j.kiki&4kikikiZ.## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#.#.###. j#####.###..j#ki=##....... .j.........#######..## ###'######.#ß#### j#.jß#!!.#j##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........### ki©#####j###.WF#≈≈.# ##.©.###.#.#j# .........####### ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈ ####j 2 gnolls (1 wandering)kiZ.ki.j.ki~"jj   gnollkiQ#&5ki.ki3kiM.................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ kiR##.©.###.#.#.###. j#####.###.j.###....... .j.........#######..## ###'######j#ß#### j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß.≈≈.#j   gnoll sergeant (polearm, wandering).F   bullfrog#ki=j   gnoll..ki@.jkiXj)kiO&6kizki ##########... .................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#.#.###. j#####.###..j###....... .j.........#######..## ki4###'######j#ß#### j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###.WF#≈≈.# ##.©.###.#.#j# .........######ki"0jki2jj 2 gnolls (1 wandering)ki3&7kih?kiCz _The bullfrog snags a nearby mouse with its tongue.kiu ##########..# ##########... .................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#.#.###. j#####.###j.j###....... .j.........#######..## ###'######j#ß#### j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ .#..ß#F.j#.## ###j######.#ß. .j.........###≈≈.#  ©#####j###.WF#≈≈.#   gnoll ( ##.©.###.#.#j .kiݝej8kiƤkikieM ##.. # ##########..# ##########... .................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#j#.###. j#####.###..j###....... .j.........#######..## ###'######j#ß#### j#.jß#!!.#.##.≈≈.##F#≈≈.#ki.fD kil<9ki>qkiv78 M # ##.. ##########..# ##########... .................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#j#.###. j#####.###..j###....... .j.........#######..## kiw-###'######j#ß.≈≈.#####..####≈≈.#ki^}ki}'30kíkiPkihM ##########. #...# ##.. ##########..# ##########... .................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈@## ##..[ ##.©.###.#j#.kih###. j#####.###..j###....... .j.........###≈≈.#####..##.≈≈.#kipkiq&1kiukiz78 M......# #### ###  #########...#.ki{ #....# ##... ##########..# ##########...# .................#.##..## kij{E≈≈...≈≈≈≈≈≈≈≈≈≈≈@.## #.. .........#####≈≈.## ##..ki{1[ ##.©.###.#j#.###. j#####.###..j#≈≈.###.......kij|Z..#####.≈≈.#kiN~1jki=.j   gnoll (wandering)ki&2kikikiň K'###.###'.# ......# #### ##..#  #########..#. #....# ##... ##########..# ##########...# kiw W.................#.##..## ≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.. .........#####≈≈.## ##..[ ##.©.###.#.#.###. j#####.###j.j###....... .j.........#######..## ###'######j#ß#### j#.jß#!!.#.##.≈≈ ...©⌠#:..'..#.~~ki& M.jkiN kiY &3kiۚ ki kib( ^# ##.#..#⌠#..#.# ## # #.'###.###'.# #.## # #......# #### ##.#ki( F######## ##.. ## #... .# ##... .# ##########..###########....# ................@.#.≈...≈...### ki#) J≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## . ..........#####≈≈.## ##. kiO) P###.©.###.#.#.#≈≈.# # #j#####.###..j#≈≈.#ki) ...... j   gnoll sergeant (polearm) j.j.......j.###≈≈.#####..# ####'######.#ß.≈≈.##### ki) k⌠j#.jß#!!.#.##.≈≈.#ki{. 8j.ki+9 ki9 &4kiKC kiF kiK X.## #..#.'###'.#.# ### .# ##.#..#⌠#..#.# ## .# #.'###.###'.# #. .# #......# #### ## .# ######## ##.# #.. ..# ##. ..# ##########..###########....# ...................#.##≈...≈...### ≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## ki ...........#####≈≈.## ##. .###.©.###.#.#j#≈≈.# # ##j#####.###...#≈≈.#..... .j.j.......j.###≈≈.#####.. #####'######.#ß.≈≈.####ki ki. &5ki ki kiL,.## #..#.'###'.#.# ##.... ..# ##.#..#⌠#..#.# ##...... #.# #.'###.###'.# #. #.# #......# #### ##. #.# # ## #.## # #..# ## #..# #..#.##.#.#.##≈...≈...###≈...≈..## # #kiMY.#####≈≈.## ## #.###.©.###.#.#j#≈≈.# ####j#####.###...#≈≈.# ## ..j.j.......j.###≈≈.# #####'######.#ß.≈≈.# kiZkir[&6ki`ki cki#..## #..#.'###'.#.# ##.... #..# ##.#..#⌠#..#.# ##...... ##.# #.'###.###'.# #  #.# #......# #### ##  #.# # ##  #.## # ##..# ## ki@1.#..# #..#.##.#.#.##≈...≈...###≈...≈..## # ##.#####≈≈.## ## .#.###.©.###.#.#j#≈≈.# ### .###j#####.###...#≈≈.# ##...kiH .j.j.......j.###≈≈.# ####  .######'######.#ß.≈≈.#  ki|kiX&7kikiækib #..# ##.#..#⌠#..#.#.  ##.# #.'###.###'.#  #.# #......# #### ## #.# ########  #.##  ###..## ..#..###########..# .ki6b....##########..................#.## ≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...###≈...≈..## # ###...........#####≈≈.## ## #.#.###.©.###.#.#j#≈≈.# ### ..###j#####.###...#≈≈.# ##.. #...j.j.......j.###≈≈.# ### #.######'######.#ß.≈≈.# ki|#.#.⌠j#.jß#!!.#.##.≈≈.#kieki&8kiki q 6 ##.# #.'###.###'.#  #.# #......# #### ## #.# ########  #.##  ####..## ...#..###########..# #.....##########..................#.## ≈≈≈≈≈≈≈≈...≈≈≈≈≈@≈≈≈≈≈...###≈...kiq ≈..## # ####...........#####≈≈.## ## .#.#.###.©.###.#.#j#≈≈.# ### ...###j#####.###...#≈≈.# ## ##...j.j.......j.###≈≈.# ## ß#.######'######.#ß.≈≈.##.#.⌠j#.jß#!!.#.##.≈≈.# #j.'.....©⌠#:..'..#.~~.#ki| ki| S9Water ki ki / _You enter the deep water.kiA  #.# #......# #### ## #.# ########  #.##  #####..## ....#..###########..# .#.....##########........ ................#.## ≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...###≈...≈..## # #####...........#####≈≈.## ## #.#.#.###.©.###.#.#j#≈≈.# ### #...###j#####.###j..#≈≈.# ## ###...j.j.......j.###≈≈.# # .ß#.######'######.#ß.≈≈.# F   bullfrog .##.#.⌠j#.jß#!!.#.##.≈≈.#i K30mj   gnoll (wandering) .#j.'.....©⌠#:..'.F#.~~.# .##.#.⌠.#..ß#F.j#.##.≈≈.#kid 7F.ki$ H.jki# kiԢ &40kiݨ ki' ki  #.# ########  #.##  ######..## #....#..###########..# #.#.....##########........ .................#.## ≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...###≈...≈..## ######..........@#####≈≈.## ## kiq 9≈#.#.#.###.©.###.#.#j#≈≈.# ### ≈#...###j#####.###...#≈≈.# # ≈###...j.j........j###≈≈.# ≈.ß#.######'######.#ß.≈≈.# ≈.##.#.⌠j#.jß#!!.#F##.≈≈.#j   gnoll (wand) ~.#j.'.....©⌠#:..'..#.~~.# ≈.##.#.⌠.#..ß#F.j#.##.≈≈.# ≈.ß#.######j######.#ß.≈≈.#ki1jkiJKj.kiw.jj 2 gnolls (1 wand, 1 wandering)ki01ki"ki$ki>\# #.# # ## # #.## # ki\ ######..# ##  #....#..# ##..# ##.#.....#.#.#.##≈...≈...###≈...≈..## #≈#####.#####≈≈.## ##≈#.#.#.###.©.###.#.#j#≈≈.# ki]≈#...###j#####.###...#≈≈.# ≈###...j.j...j...j.###≈≈.#≈.ß#.######'######.#ß.≈≈.#≈.##.#.⌠j#.jß#!!.#.##.≈≈.#jjj 4 gnolls (1 wand,ki] 2 wandering) ~~.#j.'.....©⌠#:.j'j#.~~.#≈.##.#.⌠.#..ß#...#.##.≈≈.# ≈≈.ß#.######j######.#ß.≈≈.#ki$a2j.kiya>.jkihLj.kih7j.kiwkiw&2ki=kiki3GU.# #.# # ## ## #.## # # ######..# ## # #....#..# ##..##.#.....#.#.#.## .≈...≈...### .≈...ki H9≈..## # .≈≈#####.#####≈≈.## ## .≈≈#.#.#.###.©.###.#.#j#≈≈.# .≈≈#...###j#####.###...#≈≈.# .≈≈###...j......j.j..###≈≈.# .≈≈.ß#.######'######.#ß.≈≈.# .≈≈.##.#.⌠j#.jß#!!j#j##.≈≈.#   gnoll ( .~~.#j.'.....©⌠#:..'..#.~~.# .≈≈.##.#.⌠.#..ß#...#.##.≈≈.# kipHC.≈≈.ß#.######j######.#ß.≈≈.#kiJ1FkiK2j.kiVF   bullfrogj   gnoll (wandering)kiV&3ki]ki`ki}.# #.# # ## .## #.## # .# ######..# ## .# #....#..# ###..# .###.#.....#.#.#.## ..≈...≈...### ..≈...≈..## # #.≈≈#####.#####≈≈.## .≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###j#####.###...#≈≈.# #.≈≈###...j.....j..j..###≈≈.# #.≈≈.ß#.######'######.#ß.≈≈.# #.≈≈.##.#.⌠j#.jß#!!j#j##.≈≈.# #.~~.#j.'.....©⌠#:..'..#.~~.#j   gnoll (wand) #.≈≈.##.#.⌠.#..ß#i1m...#.##.≈≈.# #.≈≈.ß#.######j######.#ß.≈≈.#kiZ<4kiki8ki =.# #.# # ## ..## #.## # ..# ######..# ## ..# #....#..# ###.. ..###.#.....#.#ki l.#.##.≈...≈....≈...≈..## .#.≈≈#####.#####≈≈.## .≈≈#.#.#.###.©.###.#F#j#≈≈.# .#.≈≈#...###j#####.###...#≈≈.# .#.≈≈###...j.....j..j..###≈≈.# .#.≈≈.ß#.######'######.#ß.≈≈.# ki .#.≈≈.##.#.⌠j#..ß#!!j#j##.≈≈.# .#.~~.#j.'.....©⌠#:..'..#.~~.# .#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# )#.≈≈.ß#.######j######.#ß.≈≈.#kiz /jki 1jki j   gnoll bouda (wandering)j   gnoll (wandering)'ki2 ki &5ki ki ki E# #.##  .# ######..##.# #....#..#########.###.#.....##########............................#≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈....≈...≈#.≈≈#####...........#####≈≈ ....≈≈#.#.#.###.@.###.#F#j#≈≈.#.≈≈#...###j#####.###...#≈≈.# ..#.≈≈###...j.....j..j..###≈≈.# ..#.≈≈.ß#.######j######.#ß.≈≈.# ..#.≈≈.##.#.⌠j#..ß#!!j#j#ki 1#.≈≈.# ..#.~~.#j.'.....©S#:..'..#.~~.#j   gnoll bouda (wandering).#.≈≈.##.#.⌠.#.jß#...#.##.≈≈.#j   gnoll (wandering) .)#.≈≈.ß#.######'######.#ß.≈≈.#S   adder ).#.≈≈###.....j.........###≈≈.#ki JS⌠kik Kj'ki @j.kia jjkiڠ &6kiH ki= M _The gnoll shouts! The gnoll bouda shouts! You hear a shout! x2kiF R _There is a transporter here.ki:,.≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..#.≈≈#####...........#####≈≈.## ki .≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###j#####.###...#≈≈.# #.≈≈###...j...j.j..j..###≈≈.# #.≈≈.ß#.######'######.#ß.≈≈.# .##.#.⌠.#.Sß#!!j#j##.≈≈.# #.~~.#j.j.j...@j#:..'..#.~~.##.#.⌠.#..ß#...#.##. .)#.≈≈.ß#.######'######.#ß. ).#.≈≈###.....j.........### ).#.≈≈#...###©#####j###.WF###ki..≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, wandering) )...≈≈#####...........#####≈≈..# j   gnoll bouda.#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# jj 2 gnolls (1 wand, 1 wandering) .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# S   adder (wandering)ki֟ .jYou enter the transporter and appear at another place.  The gnoll sergeant shouts! The adder hisses angrily.  You hear an angry buzzing noise.kiQ.jki jThe adder completely misses you.'jkiҰj ©S)kiMj 3 gnolls (1 wand, 1 polearm)SThe gnoll bouda hits you with a +0 whip.ki y55--===7Poisonous Vapourskiki* _The adder bites you.ki9  Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki ###...######j##.#.⌠.#.Sß#ki{ .'j.j..@j#.#.⌠.#..ß#######'##..###, poisoned)(poisoned), poisoned)(poisoned)You begin to radiate toxic energy. The gnoll is poisoned.  The gnoll sergeant is poisoned. The gnoll is poisoned.ki###...######j##.#.⌠.#.Sß#.'j.j..@j#.#.⌠.#..ß#######'##..###ki .jThe gnoll bouda is poisoned. The gnoll is poisoned. The adder is poisoned.ki|Q'jki j.  The gnoll bouda looks even sicker. The adder barely misses you.ki{J.jki1ykig%c very poisoned)y   killer bee (wandering)jjj 3 gnolls (1 wand, 1 polearm, poison(…)ki7&48-----9/13 --------8Toxic kid0ki3> _The gnoll bouda hits you with a +0 whip!ki kiR  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Airki $1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d + Olgreb's Toxic Radiance Alchemy1% 4 e - Sticky FlameFire/Alchemyki6 4%4 Select a spell to describe [?] help [!]/[I] toggle spell headerski# ki* kiz6 ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.## Health: 48/60 ===================----- ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 9/13================-------- ..#.≈≈#...###j#####.###...#≈≈.#AC: 1Str: 8 ..#.≈≈###...j.....j..j..###≈≈.#EV: 13Int: 19 ..#.≈≈.ß#.######'######.#ß.≈≈.#SH: 5Dex: 12 ..#.≈≈.##.#.⌠.#jSß#!!j#j##.≈≈.#XL:  8 Next: 82% Place: Dungeon:5 ..#.~~.#j.'.j.i7 0mj.@j#:..'..#.~~.#Noise: ===------  Time: 5848.0 (0.0) ..#.≈≈.##y#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) .)#.≈≈.ß#.######j######.#ß.≈≈.#Cast: Poisonous Vapours ).#.≈≈###.....j.........###≈≈.#Toxic ).#.≈≈#...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, poisoned) )...≈≈#####...........#####≈≈..# j   gnoll bouda (very poisoned) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# y   killer bee (wandering) .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# jjjih8 7m 3 gnolls (1 wand, 1 polearm, poison(…)Confirm with . or Enter, or press ? or * to list all spells.You begin to radiate toxic energy. The gnoll is poisoned.  The gnoll sergeant is poisoned. The gnoll is poisoned.  The gnoll bouda is poisoned. The gnoll is poisoned. The adder is poisoned.  The gnoll bouda looks even sicker. The adder barely misses you. _The gnoll bouda hits you with a +0 whip!ki? ki? kiU kiUW ki ki {Drink which item? Potions  c - 8 potions of curing  g - a potion of magicb - a potion of brilliance  e - 4 potions of enlightenment  f - a sedimented cyan potion  j - 2 bubbling grey potions ki c k - 3 golden potions  n - a bubbling amethyst potion  o - 2 murky coppery potions  p - a glowing amethyst potion [!] read|quaff|evoke[?] describe selectedkiVV ki^ kif ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.## Health: 48/60 ===================----- ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 9/13================-------- ..#.≈≈#...###j#####.###...#≈≈.#AC: 1Str: 8 ..#.≈≈###...j.....j..j..###≈≈.#EV: 13kig Int: 19 ..#.≈≈.ß#.######'######.#ß.≈≈.#SH: 5Dex: 12 ..#.≈≈.##.#.⌠.#jSß#!!j#j##.≈≈.#XL:  8 Next: 82% Place: Dungeon:5 ..#.~~.#j.'.j.j.@j#:..'..#.~~.#Noise: ===------  Time: 5848.0 (0.0) ..#.≈≈.##y#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) .)#.≈≈.ß#.######j######.#ß.≈≈.#Cast: Poisonous Vapours ).#.≈≈###.....j.........###≈≈.#Toxic ).#.≈≈#...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..# kig g j   gnoll sergeant (polearm, poisoned) )...≈≈#####...........#####≈≈..# j   gnoll bouda (very poisoned) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# y   killer bee (wandering) .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# jjj 3 gnolls (1 wand, 1 polearm, poison(…)Confirm with . or Enter, or press ? or * to list all spells.You begin to radiate toxic energy. The gnoll is poisoned.  The gnoll sergeant is poisoned. The gnoll is poisoned.  ki]h The gnoll bouda is poisoned. The gnoll is poisoned. The adder is poisoned.  The gnoll bouda looks even sicker. The adder barely misses you. _The gnoll bouda hits you with a +0 whip!kiq y.  Iridescent scales grow over part of your body.  You feel agile.  k -> M - 2 potions of mutationsergeant looks even sicker. The gnoll looks even sicker.killer bee buzzes angrily.  The killer bee is poisoned. The gnoll bouda looks even sicker.kiu k .jYour toxic aura wanes.kiv The adder bites you. The gnoll sergeant misses you. The gnoll misses you.The gnolls pick up the pace!'yki  swift, very …)y  poisoned)swift,ki 56-ki6 ~3786====9.0 (1ki( ki R _The gnoll barely misses you.kiOki? Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d + Olgreb's Toxic Radiance Alchemy1% 4 e - Sticky FlameFire/Alchemy4%4 Select a spell to describe [?] help [!]/[I] toggle spell headerskic ki̚ ki ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ki$ ^....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.## Health: 46/60 ==================------ ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 9/13================-------- ..#.≈≈#...###j#####.###...#≈≈.#AC: 3kiv Str: 7 ..#.≈≈###...j.....j..j..###≈≈.#EV: 13Int: 18 ..#.≈≈.ß#.######'######.#ß.≈≈.#SH: 5Dex: 16 ki p..#.≈≈.##.#.⌠.#jSß#!!j#j##.≈≈.#XL:  8 Next: 82% Place: Dungeon:5 ki ..#.~~.#j.'y.jj.@j#:..'..#.~~.#Noise: ====-----  Time: 5849.0 (0.0) ki( ..#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) kiW .)#.≈≈.ß#.######j######.#ß.≈≈.#Cast: Poisonous Vapours kiy ).#.≈≈###.....j.........###≈≈.# ).#.≈≈#...###©#####j###.WF#≈≈.## ki ....≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, swift, very …)ki̩ )...≈≈#####...........#####≈≈..# j   gnoll bouda (very poisoned) ki ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# y   killer bee (poisoned) ki F.##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# jjj 3 gnolls (1 wand, 1 polearm, swift,(…)The killer bee buzzes angrily.  ki| The killer bee is poisoned. The gnoll bouda looks even sicker.  Your toxic aura wanes.The adder bites you. The gnoll sergeant misses you. The gnoll misses you.The gnolls pick up the pace! _The gnoll barely misses you.ki ki kiT ki ·ki<·ki@>o Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft6% 1  b - Sigil of BindingHexes17% 3 ·ki? c - Curse of AgonyNecromancy82% 5 0 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exit·ki·ki2·ki....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.## Health: 46/60 ==================------ ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 9/13================-------- ·kihA..#.≈≈#...###j#####.###...#≈≈.#AC: 3Str: 7 ..#.≈≈###...j.....j..j..###≈≈.#EV: 13Int: 18 ..#.≈≈.ß#.######'######.#ß.≈≈.#SH: 5Dex: 16 ..#.≈≈.##.#.⌠.#jSß#!!j#j##.≈≈.#XL:  8 Next: 82% Place: Dungeon:5 ..#.~~.#j.'y.jj.@j#:..'..#.~~.#Noise: ====-----  Time: 5849.0 (0.0) ..#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.#·kisc) +0 dagger (protect) .)#.≈≈.ß#.######j######.#ß.≈≈.#Cast: Poisonous Vapours ).#.≈≈###.....j.........###≈≈.# ).#.≈≈#...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, swift, very …))...≈≈#####...........#####≈≈..# j   gnoll bouda (very poisoned) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# y   killer bee (poisoned) ·ki".##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# jjj 3 gnolls (1 wand, 1 polearm, swift,(…)The killer bee buzzes angrily.  The killer bee is poisoned. The gnoll bouda looks even sicker.  Your toxic aura wanes.The adder bites you. The gnoll sergeant misses you. The gnoll misses you.The gnolls pick up the pace! ·kiS_The gnoll barely misses you.·ki P  Okay, then.·ki·kii·ki. _÷ki÷ki Read which item? Scrolls  t - a scroll of teleportation  a - 2 scrolls of enchant armour÷kiW - 2 scrolls of brand weapon  V - 2 scrolls of vulnerability  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedŷkiG ŷki( ŷkip4 ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ŷki5 8....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.## Health: 46/60 ==================------ ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 9/13================-------- ..#.≈≈#...###j#####.###...#≈≈.#AC: 3Str: 7 ..#.≈≈###...j.....j..j..###≈≈.#EV: 13Int: 18 ŷki~5 ..#.≈≈.ß#.######'######.#ß.≈≈.#SH: 5Dex: 16 ..#.≈≈.##.#.⌠.#jSß#!!j#j##.≈≈.#XL:  8 Next: 82% Place: Dungeon:5 ..#.~~.#j.'y.jj.@j#:..'..#.~~.#ŷki5 Noise: ====-----  Time: 5849.0 (0.0) ..#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) .)#.≈≈.ß#.######j######.#ß.≈≈.#Cast: Poisonous Vapours ).#.≈≈###.....j.........###≈≈.# ŷki?6 ).#.≈≈#...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, swift, very …))...≈≈#####...........#####≈≈..# j   gnoll bouda (very poisoned) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# y   killer bee (poisoned) ŷki6 .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# jjj 3 gnolls (1 wand, 1 polearm, swift,(…)The killer bee is poisoned. The gnoll bouda looks even sicker.  Your toxic aura wanes.The adder bites you. The gnoll sergeant misses you. The gnoll misses you.The gnolls pick up the pace! _The gnoll barely misses you. _Okay, then.ŷki9 .yAs you read the scroll of teleportation, it crumbles to dust.ŷki> K.y _Okay, then.  As you read the scroll of teleportation, it crumbles to dust.  You feel strangely unstable. The adder barely misses you.  You block theŷkiA? gnoll sergeant's attack. The gnoll closely misses you.  The gnoll bouda hits you with a +0 whip.  The gnoll hits you from afar with a +0 halberd of pain!ŷkiN 31------==--50.0 (1Tele ŷkiV ŷki7Y S _The adder closely misses you.Ʒkis  Ʒki Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Ʒki. ###...######'##.#.⌠.#jSß#.'..jj.@j#.#.⌠y#..ß#######j##...### Ʒkif You begin to radiate toxic energy. The gnoll sergeant looks even sicker.Ʒkit ###...######'##.#.⌠.#jSß#.'..jj.@j#.#.⌠y#..ß#######j##...###Ʒki| s $The gnoll looks even sicker.Ʒki $You kill the gnoll!The gnoll looks even sicker. The killer bee looks even sicker.Ʒki 0$Ʒki 1$ƷkiY 2$Ʒki -FƷki ' Ʒki .F   bullfrogj   gnoll bouda (very poisoned)  You kill the gnoll! x2; You kill the killer bee! You kill the adder!The gnoll sergeant hits you from afar with a +0 spear.Ʒki :*Ʒki/  The gnoll bouda prays to its god.Ʒki_ K.FƷki) <jƷki 422 26--------5-------9=-1Toxic Ʒki" Ʒki$ 9 _The gnoll bouda is healed somewhat.ɷki5 ##.≈≈#####...........#####≈≈.## ..≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###j#####.###...##...j........j..##.ß#.######F######.#ß.ɷki5 ##.#.⌠.#$$ß#!!j#j##~~.#j.'..$j.©j#:..'..#.~~≈≈.##.#.⌠$#.@ß#...#.##.≈≈ .)#.≈≈.ß#.######$######.#ß ).#.≈≈###.....j.........### )...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈.. )####...........#### ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈ .#ɷki6 8...........................ɷki9 'FThe gnoll bouda looks as sick as possible!ɷkiE ) j(poisoned)j  unaware, dazed, extremel…)The bullfrog is poisoned.  The gnoll bouda is distracted by your dazzling golden aura.ɷkiF .--2ɷki]Y ɷkiX[ \ _The gnoll sergeant closely misses you.˷ki? $You closely miss the gnoll bouda. The gnoll bouda snaps out of its daze.  You grab the gnoll bouda. You squeeze the gnoll bouda.˷ki  very poisoned)  You kill the gnoll bouda!˷ki ^   #..#.≈≈.ß#.  #..#.≈≈.##.#  ##..#.~~.#j.'  #...#.≈≈.##.#  #..)#.≈≈.ß#.#  #####.).#.≈≈###..  ###.....).#.≈≈#...#  #...........≈≈#.#.# ˷ki' ##.@....))...≈≈#####  #......)...#.≈≈≈≈≈≈≈  #.......).##.≈≈≈≈≈≈≈  #.))).).#.#.........  #.)....##.#.........  #......##.#.........  #......##...........  #.....###...........   ##....# #.. The bullfrog looks even sicker.˷kie,˷kii7%  ˷ki7*Your surroundings suddenly seem different.˷ki;-------5---3Poisonous Vapours˷ki1< ˷kiGl _Your toxic aura wanes.̷ki@  #..#.≈≈.ß#.# #..#.≈≈.##.#. ##..#.~~.#j.'. #...#.≈≈.##.#. #..)#.≈≈.ß#.# #####.).#.≈≈###. ###.....).#.≈≈#...# #.≈≈#.#.#. ##..@...))...≈≈#####. #......)...#.≈ #.).##.≈ #.))).).#.#. #.)....##.#. #......##.#. #......##. #.....###. ##....# #.̷kiB j7---4̷kiC ̷ki  #..#.≈≈.ß#.# #..#.≈≈.##.#.⌠̷kib  ##..#.~~.#j.'. #...#.≈≈.##.#.⌠ #..)#.≈≈.ß#.# #####.).#.≈≈###. ###.....).#.≈≈#...# #.≈≈#.#.#.#̷ki  ##...@..))...≈≈#####. #......)...#.≈ #.).##.≈̷kiW  #.))).).#.#. #.)....##.#. #......##.#. #......##. #.....###. ##....# #.̷ki ̷kig =6==̷ki} 5̷ki= ̷kip ͷki=` #..#.≈≈.ß#.# #..#.≈≈.##.#.⌠. ##..#.~~.#j.'..$ #...#.≈≈.##.#.⌠$ #..)#.≈≈.ß#.# #####.).#.≈≈###. ###.....).#.≈≈#...###© #.ͷkiRa≈≈#.#.#.# ##....@.))...≈≈#####. #......)...#.≈ #.).##.≈ #.))).).#.#. #.)....##.#. #......##.#. #......##. #.....###. ##....# #.ͷkiFnͷkiNo&6ͷki3zͷkiM|ͷkiyrC #..#.≈≈.ß#.# #..#.≈≈.##.#.⌠.# ##..#.~~.#j.'..$j #...#.≈≈.##.#.⌠$# #..)#.≈≈.ß#.#ͷki}s6 #####.).#.≈≈###.....j ###.....).#.≈≈#...###©# #.≈≈#.#.#.# ##.....@))...≈≈#####. #......)...#.≈ #.).##.≈ #.))).).#.#. #.)....##.#. #......##.#. #......##.. #.....###..ͷkit|# ##....# #.ͷkiͷkiÁ&7ͷkiͷkiͷki3ͷkilͷki|W  You start resting.ͷki?T8=ͷki&0ͷkiͷkiI #..#.≈≈.ß#.##### ludeguy the Toxicologist #..#.≈≈.##.#.⌠.# Octopode of Gozag Gold: 422  ##..#.~~.#j.'..$j Health: 28/60 ===========------------- #...#.≈≈.##.#.⌠$# Magic: 6/13===========------------- ͷki#..)#.≈≈.ß#.##### AC: 3Str: 7 #####.).#.≈≈###.....j EV: 14Int: 18  ###.....).#.≈≈#...###©# SH: 5Dex: 16  #...........≈≈#.#.#.### XL:  8 Next: 103% Place: Dungeon:5  ##.....@))...≈≈#####.... Noise: ---------  Time: 5858.0 (1.0)  #......)...#.≈≈≈≈≈≈≈≈≈≈≈ c) +0 dagger (protect) ͷkiF #.......).##.≈≈≈≈≈≈≈≈≈≈≈ Cast: Poisonous Vapours  #.))).).#.#.............  #.)....##.#.............  #......##.#.............   #......##...............  ͷki* #.....###..............#   ##....# #............... You grab the gnoll bouda. You squeeze the gnoll bouda.  You kill the gnoll bouda!The bullfrog looks even sicker.  Your surroundings suddenly seem different. ͷki l_Your toxic aura wanes.You start resting.ͷkia _You feel a bit more experienced.  You have reached level 9!ͷki$/  --more--ηki   Your experience leads to an increase in your attributes!Your base attributes are Str 8, Int 19, Dex 12.Increase (S)trength, (I)ntelligence, or (D)exterity? зki8 u30/644-20зki9 9 1% зkiFN зkiP S _You feel clever. x2ѷkig  #..#.≈≈.##.#.⌠. #..#.~~.#j.'..$  #...#.≈≈.##.#.⌠$  #..)#.≈≈.ß#.### #####.).#.≈≈###.....  ###.....).#.≈≈#...###©  #...........≈≈#.#.#.#  ##))...≈≈#####...ѷki9P  )...#.≈≈≈≈≈≈≈≈≈≈  #.......).##.  #.))).).#.#............  #.)....##.#  #......##.#  #......##.  #.....###.  ##....# #..  ########ѷkiѷki-9 _ѷkiaѷkigѷki# ѷki$ ѷkiN( ѷki, ѷki- ѷki1 ѷki7 ѷki18 *422ѷki; ѷki> ѷki? "1ѷki? 97==ѷkiB ѷki4H ,ѷkiJ ѷkiN ѷki ѷki ѷki9 :==ѷki- ѷki ,ѷkig ѷki ,ѷki  ѷki n _You start resting.Magic restored.ѷki" O46=ѷkie) 1911.0 (52.0)ѷki,* b4==2.0 (53 _ѷki/ ѷki1 ҷkik3ҷkinҷkisҷkittҷkixҷki|ҷki}ҷki\ҷkiҷkiW7=ҷkiҷkiPҷkiщ:==ҷkiQҷkiҷki~ҷkihҷkieҷki*K8=ҷkivҷki ҷkiҷkiҷkiҷkiҷkiҷki)ҷkiҷkiNҷkiҷkiU9=ҷki;ҷkiҷkiҷkiҷkiTҷkiҷkiҷki%ҷki&50ҷkiIҷkiҷkifҷkigҷkiҷkiҷkiҷki ҷkiK1=ҷkiҷki)92ҷki!2=ҷki Bҷkiҷki,ҷki!ҷkiC&ҷki&%3ҷkiV)ҷki,,ҷki1BҷkiR3ҷki6ҷki7K4=ҷkip:ҷki=,ҷki?ҷki(JҷkiJҷkiOҷki0TҷkiTҷkiRWҷki[ҷkil\U5=ҷki_ҷkidҷkieҷki`hҷkiflҷkilҷkirnҷki/qҷkiqK6=ҷkisҷkixҷkixҷkizҷkiw~ҷki~ҷkiҷkiDžҷkiLU7=ҷki.ҷkiҷkiҷkiҷkiҷkiҷkiyҷki,ҷkiҷkifҷki%8ҷkirҷki&ҷkiҷki ҷki19=60=ҷki}ҷki ҷkiUҷkiBҷkiҷkiҷkiCҷki%;1ҷkiҷkiҷkiOҷkiҷkiҷkinҷki ҷkia2=ҷkiҷki,ҷki+ҷki,ҷki ҷkiN#k3=ҷkiK%ҷki4(,ҷki*ҷki.ҷkiO/ҷki*2ҷki 7ҷki7ҷki:ҷkiHDk _You start resting.HP restored.ҷkiXҷkiJe-71.0 (59ҷkifa4=2.0 (60 _ҷkioҷkipӷkiHӷkiIӷki MӷkiWZӷkin_ӷkiZd,ӷkifӷkiRkӷkikӷkiSnӷkiArӷki`v,ӷkiyӷkiW}ӷki+ӷki9=ӷki%ӷkibӷkiZӷkiӷkiӷkiѓӷkiJӷki\ӷki͞ӷki]ӷkiӷkiwӷki/ӷki:Water ӷkiӷki> _You enter the deep water.ӷkiOӷkiӷkiӷki-ӷkiӷkiӷkiq(ӷkiӷkiӷkiӷki1ӷki%ӷki3 #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈ #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈ #..#.≈≈#####...........# #....≈≈#.#.#.###.©.###. #..#.≈≈#...###j#####.### #..#.≈≈###...j........j. #..#.≈≈.ß#.######'#### ӷki#..#.≈≈.##.#.⌠.#$Fß#!!j# ##..#.~~@#..'..$j.©$#:..'82.0 (1 #...#.≈≈.##.#.⌠$#..ß#...# #..)#.≈≈.ß#.######$######  #####.).#.≈≈###.....j  ###.....).#.≈≈#...###©#####j###  #...........≈≈#.#.#.###.©.###.# ӷkiO ##......))...≈≈######  #......)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈  #.......).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈ӷki3ӷki?ӷkiԷkiZ-3Էki0Էki=Էki{oFWԷkitSWater Էkiz> _You enter the deep water.Էki~ԷkiԷkiԷkiԷkiԷkiBԷki@Էki<Էki6ԷkiԷkiԷki6ԷkiԷki<ԷkiˮԷkiQԷki\Էki3ԷkiԷki\,ԷkiuԷkiԷkiuԷkiJԷkiԷki!ԷkiԷkiԷkiMԷkiԷkilԷki'XԷkiԷkiԷkiԷkiԷkiԷkiԷki&ԷkiԷki Էki ԷkiNԷki?Էki Էki%BԷki&Էki2,a _The gnoll leaves your sight. The bullfrog leaves your sight.Էki/Էki4Էki7Էki;ԷkiN<Էki}?ԷkiR#...)## #.# #......# #### #....# #.# ######## #...## #.###...# ######..##...# #....#..# ######...###.#.....##########......#..............................#....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈.#....≈≈≈≈≈≈≈≈≈@≈...≈≈≈≈≈≈≈≈≈≈≈.96.0 (14#..#.≈≈#####...........#####≈≈.#....≈≈#.#.#.###.©.###.#F#j#≈≈.#..#.≈≈#..W###.#####.###...#≈≈..#.≈≈###........F...j..###≈≈ԷkiS.#.≈≈.ß#W######'######.#ß.≈≈. W   phantom (wandering) #..#.≈≈.##.#.⌠.#$Fß#!!j#j##.≈≈. F   bullfrog (wandering)#..#.~~.#..'j.$..©$#:..'..#.~~.#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.ԷkivcԷkijշki5#....# #.# ########  #...## #.##  #...# ######..#  #...# #....#..# ##########...###.#.....##########........#........................##....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈#....≈...≈.#..#.≈≈#####...@.......#####≈≈.#շki#....≈≈#.#.#.###.©.###.#F#j#≈≈.##..#.≈≈#..W###.#####.###...#≈≈.##..#.≈≈###........F...j..###≈≈.##..#.≈≈.ß#W######'######.#ß.≈≈.##..#.≈≈.##.#.⌠.#$Fß#!!.#j##.≈≈.# F   bullfrog (wandering) ##..#.~~.#..'j.$..©$#:..'..#.~~.# #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ß.≈≈.#շki(.շki[Fշki;7.0)շkiշkiַkiD#....# #.# # #...## #.## #...# ######..# # ַkiI}#...# #....#..# # #...###.#.....#. #.#. #....≈...≈. #....≈...≈..# #..#.≈≈#####.#####≈≈.# #....≈≈#.#.#.###.©.###.#F#j#≈≈.# #..#.≈≈#..W###.#####.###...#≈≈.# #..#.≈≈###.......... #..#.≈≈.ß#W######F### #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# F   bullfrog (wandering)ַki..#.~~.#..'j.$..©$#:..'..#.~~.# ...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# ..)#.≈≈.ß#.######$######.#ß.≈≈.#ַki1'ַkiCFַki &8ַkiַki5 _The bullfrog leaves your sight.ַki-3 ַki.##  ######..#....#..###########.#.....##########.............................#≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..#ַki.#.≈≈#####...........#####≈≈.#ַki...≈≈#.#.#.###@©.###.#F#j#≈≈.# ַki/#.≈≈#..W###.#####.###...##............j..##ַki/B##.ַki7/'.'#ַkiT/U## .).#.≈≈###.....j.........###≈≈.#ַkiq/ַki21jַkiGj   gnoll (wandering)9ַkitOַkigSַki N...## #.## # ...# ######..# # ...# #....#..# #. ...###.#.....#. .#.# ....≈...≈...# ....≈...≈..# ..#.≈≈#####.#####≈≈.## ....≈≈#.#.#.###.@.###.#F#j#≈≈.# ..#.≈≈#..W###.#####.###...#≈≈.# ַki ;..#.≈≈###............j..###≈≈.# ..#.≈≈.ß#W######'#### ..#.≈≈.##.#.⌠.#$$ß#!!. ..#.~~.#..'j.$..©$#:..'..#.~~.# #.≈≈.##.#.⌠$#..ß#...#)#.≈≈.ß#.###### ַki .$ַki Pjַki )6000ַki5 ַki R _There is a transporter here.׷ki.≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..#.≈≈#####...........#####≈≈.## .≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#..W###.#####.###...#≈≈.# #.≈≈###............j..###≈≈.# #.≈≈.ß#W######'######.#ß.≈≈.# .##.#F⌠.#$$ß#!!.#j##.≈≈.# ׷kiu7#.~~.#..'..$..@$#:..'..#.~~.##.#.⌠j#..ß#...#.##. .)#.≈≈.ß#.######$######.#ß. ).#.≈≈###.....jj.j......### ).#.≈≈#...###©#####j###.WF#׷ki##..≈≈#.#.#.###.©.###.#.#j#≈≈..# F   bullfrog (wandering) )...≈≈#####...........#####≈≈..# jjj 3 gnolls (1 wand, wandering).#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈..# .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈..#׷ki׷ki/j.׷ki.׷kiKj$׷kiQG.F׷kic  2You enter the transporter and appear at another place.׷ki2?1Poisonous Vapours׷ki׷kic2 _The gnoll leaves your sight.طki( ...... .©. ### ... ######'## .#.⌠.#$$ß#!! .'.F$j.@$#: .#.⌠$#..ß# .)######$## ).j. )©#### .©. )... ~  طki e...... .©. ### ... ######'## .#.⌠.#$$ß#!! .'.F$j.@$#: .#.⌠$#..ß# )######$## ).j. )©####.©. )... ~ طkis 4طki طki` d _There are monsters nearby!ٷki6ٷki92 Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudٷkiConjuration/Alchemy/Air 1%3  d + Olgreb's Toxic Radiance Alchemy1% 4 e - Sticky FlameFire/Alchemyٷki/3%4 Select a spell to describe [?] help [!]/[I] toggle spell headersڷki{C ڷkiqM....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.## Health: 64/64 ======================== ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 14/14 ======================== ..#.≈≈#..W###.#####.###...#≈≈.#AC: 3Str: 7 ..#.≈≈###............j..###≈≈.#EV: 14Int: 20 ..#.≈≈.ß#W######'######.#ß.≈≈.#SH: 5Dex: 16 ڷkiM..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.#XL:  9 Next:  1% Place: Dungeon:5 ..#.~~.#..'.F$j.@$#:..'..#.~~.#Noise: ---------  Time: 6001.0 (0.0) ..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#c) +0 dagger (protect) .)#.≈≈.ß#.######$######.#ß.≈≈.#ڷkiNyCast: Poisonous Vapours ).#.≈≈###.....j.j.......###≈≈.# ).#.≈≈#...###©#####j###.WF#≈≈.## ڷkiN....≈≈#.#.#.###.©.###.#.#j#≈≈..# F   bullfrog (wandering) )...≈≈#####...........#####≈≈..# jj 2 gnolls (1 wand, wandering) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# _The gnoll leaves your sight. The bullfrog leaves your sight. _The bullfrog leaves your sight. _There is a transporter here.  You enter the transporter and appear at another place. _The gnoll leaves your sight. _There are monsters nearby!ڷkiOX4ڷkiw_ڷki aڷki7....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.##  Health: 64/64 ======================== ....≈≈#.#.#.###.©.###.#F#j#≈≈.#  Magic: 12/14 ====================---- ..#.≈≈#..W###.#####.###...#≈≈.#  AC: 3Str: 7 ..#.≈≈###............j..###≈≈.#  EV: 14Int: 20 ..#.≈≈.ß#W######'######.#ß.≈≈.#  SH: 5Dex: 16 ..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.#  XL:  9 Next:  1% Place: Dungeon:5 ..#.~~.#..'.F$$.@$#:..'..#.~~.#  Noise: ---------  Time:[ڷki~37m 6001.0 (0.0) ..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#  c) +0 dagger (protect) .)#.≈≈.ß#.######$######.#ß.≈≈.#  Cast: Poisonous Vapours ).#.≈≈###.....j.j.......###≈≈.# ).#.≈≈#...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..#  F   bullfrog (wandering) )...≈≈#####...........#####≈≈..#  jj 2 gnolls (1 wand, wandering) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ڷkiߟConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a gnoll, carrying a wand of polymorph (wandering, hasn't noticed you,  chance to weaken: 100%)  The glob of mercury hits the gnoll!! The gnoll looks weaker.ڷki...... .©.   ## .#.!! .'.F$$*@$#: .#. )ڷki$## ) )©.©. )ڷki... j   gnoll (wandering)~ڷki& ڷki+<.FڷkiV,A.jڷkiG-+jڷki9..Fj 2 gnolls (wandering)ڷki8=]422 2==2.0 (1۷ki۷ki  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a gnoll, carrying a wand of polymorph (wandering, hasn't noticed you,  chance to weaken: 100%)  The glob of mercury hits the gnoll!! The gnoll looks weaker. _You kill the gnoll!۷ki f....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 422 ..#.≈≈#####...........#####≈≈.##  Health: 64/64 ======================== ....≈≈#.#.#.###.©.###.#F#j#≈≈.#  Magic: 11/14 ==================------ ..#.≈≈#..W###.#####.###...#≈≈.#  AC: 3Str: 7 ..#.≈≈###............j..###≈≈.#  EV: 14Int: 20 ..#.≈≈.ß#W######'######.#ß.≈≈.#  SH: 5Dex: 16 ۷ki ..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.#  XL:  9 Next:  2% Place: Dungeon:5 ..#.~~.#..'..F$.@$#:..'..#.~~.#  Noise: ==-------  Time: 6002.0 (0.0) ..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#  c) +0 dagger (protect) .)#.≈≈.ß#.######j######.#ß.≈≈.#  Cast: Poisonous Vapours ).#.≈≈###........j......###≈≈.# ).#.≈≈#...###©#####j###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..#  F   bullfrog )...≈≈#####...........#####≈≈..#  jj 2 gnolls (wandering) ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 club (wandering, hasn't noticed you)  Poisonous fumes billow around the gnoll!  The gnoll is poisoned.  The gnoll shouts!۷ki ,j.۷ki /...... .©. ###  ######'## .#.⌠.#$$ß#!! .'..F$.@$#: .#.⌠$#..ß# )۷ki/ .######j## ) )©####.©. F(unaware, dazed) )... jj۷ki` V1 poisoned)~۷ki ۷ki J====3.0 (1۷ki ۷kid ]  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 club (wandering, hasn't noticed you)  Poisonous fumes billow around the gnoll!  The gnoll is poisoned.shouts! _The bullfrog is distracted by your dazzling golden aura.ܷki#....≈...≈... #....≈...≈.. #..#.≈≈#####...........#####≈≈.## #....≈≈#.#.#.###.©.###.#F#j#≈≈.# #..#.≈≈#..W###.#####.###...#≈≈.# #..#.≈≈###............j..###≈≈.# #..#.≈≈.ß#W######'######.#ß.≈≈.# #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# #..#.~~.#..'..F$@©$#:..'..#.~~.#.#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# ..)#.≈≈.ß#.######j######.#ß.≈≈.# .).#.≈≈###.......j.......###≈≈.# .).#.≈≈#...###©#####j###.WF#≈≈.##.≈≈#.#.#.###.©.###.#.#j#≈≈..# ))...≈≈#####...........#####≈≈..# [1ܷki6d...#.≈~≈..# ).##.≈~≈..#.ܷkiJj$ܷkij   gnoll (ܷkiE----4ܷkiܷkiܷki  #....≈...≈  #....≈...≈..  #..#.≈≈#####...........#####≈≈.  #....≈≈#.#.#.###.©.###.#F#j#≈≈.#  #..#.≈≈#...###.#####.###...#≈≈.#  #..#.≈≈###............j..###≈≈.#  #..#.≈≈.ß#W######'######.#ß.≈≈.#  #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# ##..#.~~.#..'..F@.©$#:..'..#.~~.# #...#.≈≈.##.#.⌠$#j.ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ܷki{ ß.≈≈.# #.).#.≈≈###....W.j........###≈≈.# ..).#.≈≈#...###©#####.###.WF#≈≈..≈≈#.#.#.###.©.###.#.#j#≈≈.. W   phantom (wandering) .))...≈≈#####...........#####≈≈.. F   bullfrog (unaware, dazed) )...#.≈~≈.. j   gnoll (poisoned) .).##.≈~≈..ܷki 3jܷkiV .ܷki5 W.F   bullfrog (unaware, dazed)jj 2 gnolls (1 poisoned)ܷki Q=---5ܷkiU ܷkiV _The gnoll misses you. The phantom leaves your sight.  Things that are here:ܷki \ _4 gold pieces; a wand of polymorph (8)ܷki8 $You catch the helpless bullfrog completely off-guard!  You impale the bullfrog!!  Your weapon exudes an aura of protection.ܷkiOLj$ܷki' jj 2 gnolls (1 poisoned)  You kill the bullfrog!ܷki5- 10 66 _The gnoll closely misses you.ܷki8ܷki:k _Your Fire Magic skill increases to level 1!ݷki? #....≈...≈ #....≈...≈ #..#.≈≈#####.....#####≈≈.ݷkic) #....≈≈#.#.#.###.©.###.#F#j#≈≈. #..#.≈≈#...###.#####.###...#≈≈. #..#.≈≈###............j..###≈≈.ݷki #..#.≈≈.ß#W######'######.#ß.≈≈.ݷki #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. ݷkiՈ* ##..#.~~.#..'..@$.©$#:..'..#.~~. ݷki  #...#.≈≈.##.#.⌠$#jjß#...#.##.≈≈. ݷki:\ #..)#.≈≈.ß#.######$######.#ß.≈≈. ##.).#.≈≈###.....W.........###≈≈..).#.≈≈#...###©#####.###.WF#≈≈.ݷki~.≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom.))...≈≈#####....ݷki-.#####≈≈. jj 2 gnolls (1 poisoned) .)...#.≈~≈ ..).##.≈~≈ݷki;6j.ݷki7j.ݷkiǎ2W.ݷkiݷkiw&7ݷkiݷkiw _The gnoll attacks as it pursues you! The gnoll hits you but does no damage.  Things that are here:ݷki%h _9 gold pieces; a +0 flail; a wand of paralysis (9)޷ki$ l $You puncture the gnoll!޷ki -j.޷ki p   gnoll޷ki ]2===8޷kii _ _You kill the gnoll!߷ki͚ .WYou closely miss the gnoll. You grab the gnoll. You constrict the gnoll.߷kiQ 3--9 _The gnoll hits you with a +0 flail.߷kiw $You hit the gnoll.  The gnoll is severely wounded.You constrict the gnoll.߷kiP.߷ki[TW߷ki)7-10Poisonous Vapours߷ki߷kikI _You kill the gnoll!߷ki<#....≈...≈.#....≈...≈.#..#.≈≈#####.....#####≈≈.##....≈≈#.#.#.###.©.###.#F#j#≈≈.##..#.≈≈#...###.#####.###...#≈≈.##..#.≈≈###............j..###≈≈.##..#.≈≈.ß#W######'######.#ß.≈≈.##..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# ##..#.~~.#..'..$@.©$#:..'..#.~~.# #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ß.≈≈.# #.).#.≈≈###......W........###≈≈.#߷ki).#.≈≈#...###©#####.###.WF#≈≈.#≈≈#.#.#.###.©.###.#.#j#≈≈. .))...≈≈#####.....#####≈≈. )...#.≈~≈. .).##.≈~≈.W߷kil.W   phantom߷ki.-1߷ki߷ki,i _Items here: $ )) /.ki #....≈...≈ #....≈...≈ #..#.≈≈#####.....#####≈≈. #....≈≈#.#.#.###.©.###.#F#j#≈≈. #..#.≈≈#...###.#####.###...#≈≈. #..#.≈≈###............j..###≈≈. #..#.≈≈.ß#W######'######.#ß.≈≈. #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.  ##..#.~~.#..'..@$.©$#:..'..#.~~.  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.  #..)#.≈≈.ß#.#####ki#W######.#ß.≈≈. ##.).#.≈≈###...............###≈≈..).#.≈≈#...###©#####.###.WF#≈≈..≈≈#.#.#.###.©.###.#.#j#≈≈ ..))...≈≈#####.....#####≈≈ .)...#.≈~≈ ..).##.≈~≈W$ki4===-2 _ki  Things that are here: _9 gold pieces; a +0 flail; a wand of paralysis (9)kii2W.kiC3 _ki ki Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy3%4 Select a spell to describe [?] help [!]/[I] toggle spell headerski ki ki Y #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist#....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422 #..#.≈≈#####...........#####≈≈. Health: 64/64 ========================#....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 12/14 ====================----#..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7#..#.≈≈###............j..###≈≈. EV: 14Int: 20ki q#..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5Dex: 16#..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5  ##..#.~~.#..'..@W.©$#:..'..#.~~. Noise: ---------  Time: 6013.0 (0.0)  ki #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (protect)#..)#.≈≈.ß#.######$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ki ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈.ki The gnoll is severely wounded.You constrict the gnoll. _You kill the gnoll! _Items here: $ )) /.  ki NThings that are here: _9 gold pieces; a +0 flail; a wand of paralysis (9)kia ki ki ki  ki  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki} #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist  #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422  #..#.≈≈#####...........#####≈≈. Health: 64/64 ========================  #....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 8/14=============-----------  #..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7  #..#.≈≈###............j..###≈≈. EV: 14Int: 20 ki~ #..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5Dex: 16  #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5  ##..#.~~.#..'..@W.©$#:..'..#.~~. Noise: ---------  Time: 6013.0 (0.0)  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (protect)  #..)#.≈≈.ß#.######$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ki...).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. _9 gold pieces; a +0 flail; a wand of paralysis (9)  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (unstickable)kiPt  #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist#....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422 #..#.≈≈#####...........#####≈≈. Health: 64/64 ========================#....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 8/14=============-----------#..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7#..#.≈≈###............j..###≈≈. EV: 14Int: 20#..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5Dex: 16ki!u #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5  ##..#.~~.#..'..@W.©$#:..'..#.~~. Noise: ---------  Time: 6013.0 (0.0)  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (protect)#..)#.≈≈.ß#.######$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ki`u ..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈.kiu @Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (unstickable)  The sticky flame hits the phantom!ki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (unstickable)  The sticky flame hits the phantom!  The phantom is moderately damaged. 3 ===4.0 (1ki kiS T _The phantom barely misses you.kiThe phantom is moderately damaged. _The phantom barely misses you.  You hit the phantom.  Your weapon exudes an aura of protection.  Your squeeze misses the phantom.  The phantom is heavily damaged.4229==10 --5kiki$> _The phantom hits you but does no damage.ki^ J  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki] 3 #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist  #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422  #..#.≈≈#####...........#####≈≈. Health: 64/64 ========================  #....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 5/14========----------------  #..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7  #..#.≈≈###............j..###≈≈. EV: 14Int: 20  #..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5ki_ Dex: 16  #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5  ##..#.~~.#..'..@W.©$#:..'..#.~~. Noise: =--------  Time: 6015.0 (0.0)  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (protect)  #..)#.≈≈.ß#.######$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. _The phantom hits you but does no damage.  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: ki-` n[ma phantom (heavily damaged, unstickable)ki6? #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist#....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422#..#.≈≈#####...........#####≈≈. Health: 64/64 ========================#....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 5/14========----------------ki<#..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7#..#.≈≈###............j..###≈≈. EV: 14Int: 20#..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5Dex: 16#..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5  ##..#.~~.#..'..@W.©$#:..'..#.~~. Noise: =--------  Time: 6015.0 (0.0)  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (protect)#..)#.≈≈.ß#.##kie[39;49m####$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ki..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈.ki_Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (heavily damaged, unstickable)  The sticky flame hits the phantom!ki*|onfirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (heavily damaged, unstickable)  The sticky flame hits the phantom!  The phantom is almost destroyed.ki*4==6.0 (1ki?ki=BX _The phantom completely misses you.ki   kiU :Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki0= #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist  #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422  #..#.≈≈#####...........#####≈≈. Health: 64/64 ========================  #....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 1/14=----------------------- ki0 #..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7  #..#.≈≈###............j..###≈≈. EV: 14Int: 20  #..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5Dex: 16  #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5 ki1 ##..#.~~.#..'..@W.©$#:..'..#.~~. Noise: ===------  Time: 6016.0 (0.0) kiz1 #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (protect)  #..)#.≈≈.ß#.######$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ..))...≈≈#####...........#####≈≈. ki1.)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. _The phantom completely misses you.ki1Casting: Sticky Flame (dangerous; 3% risk of failure)  ki1MConfirm with . or Enter, or press ? or * to list all spells.ki 2Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (almost destroyed, unstickable)kib #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. ludeguy the Toxicologist  #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈. Octopode of Gozag Gold: 422  #..#.≈≈#####...........#####≈≈. Health: 64/64 ========================  #....≈≈#.#.#.###.©.###.#F#j#≈≈. Magic: 1/14=-----------------------  #..#.≈≈#...###.#####.###...#≈≈. AC: 10  Str: 7  #..#.≈≈###............j..###≈≈. EV: 14Int: 20  #..#.≈≈.ß#W######'######.#ß.≈≈. SH: 5Dex: 16  #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈. XL:  9 Next:  7% Place: Dungeon:5  ##..#.~~.#..'..@$.©$#:..'..#.~~. Noise: ===------  Time: 6016.0 (0.0)  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. c) +0 dagger (kiAcrprotect)  #..)#.≈≈.ß#.######$######.#ß.≈≈. Cast: Poisonous Vapours ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###©#####.###.WF#≈≈. .......≈≈#.#.#.###.©.###.#.#j#≈≈. W   phantom ..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈.Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (almost destroyed, unstickable)  The sticky flame hits the phantom.ki8k   #####....  #.#.#.###.©.###  ..###.#####.  ..........  ######'##  .##.#.⌠.#$$ß#!!  .#..'..@$.©$#:  .##.#.⌠$#..ß#  #..)######$##)..........)..###©#####.#.#.#.###.©.###ki+vZ))...≈≈#####....  .) ) ki422  3 117.0 (1onfirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (almost destroyed, unstickable)  The sticky flame hits the phantom. _You destroy the phantom!kiQ#....≈...≈.#....≈...≈.#..#.≈≈#####.....#####≈≈.#kiR+#....≈≈#.#.#.###.©.###.#F#j#≈≈.##..#.≈≈#...###.#####.###...#≈≈.##..#.≈≈###............j..###≈≈.##..#.≈≈.ß#W######'######.#ß.≈≈.##..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# ##..#.~~.#..'..$@.©$#:..'..#.~~.# #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ß.≈≈.# #kiS;.).#.≈≈###...............###≈≈.#).#.≈≈#...###©#####.###.WF#≈≈.#≈≈#.#.#.###.©.###.#.#j#≈≈. .))...≈≈#####.....#####≈≈. )...#.≈~≈. .).##.≈~≈.ki]kig^0---8kigkiSv  You now have 446 gold pieces (gained 24).  p - a wand of polymorph (8)  Things that are here:46---9.0 (2ki}ki+ _a +0 flail; a +0 clubki0 V #....≈...≈ #....≈...≈ #..#.≈≈#####.....#####≈≈. #....≈≈#.#.#.###.©.###.#F#j#≈≈. #..#.≈≈#...###.#####.###...#≈≈. #..#.≈≈###............j..###≈≈. #..#.≈≈.ß#W######'######.#ß.≈≈.ki9  #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.  ##..#.~~.#..'..@).©$#:..'..#.~~.  #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.  #..)#.≈≈.ß#.######$######.#ß.≈≈. ##.).#.≈≈###...............###≈≈..).#.≈≈#...###©#####.###.WF#≈≈..≈≈#.#.#.###.©.###.#.#j#≈≈ ..))...≈≈#####.....#####≈≈ .)...#.kio d≈~≈ ..).##.≈~≈ki, kiƺ ,20.0 (1ki ki7  You now have 455 gold pieces (gained 9).  e - a wand of paralysis (10) (gained 9 charges)ki H551.0 (2ki ki, . _You see here a +0 flail.ki3kiki,kiT,ki42==kiki#kiki<ki kikiki5ki|kiki?ki)kiq:==kiuki: ki ki"kiT&ki&ki`(ki$+ki+J3==ki4l455ki"7ki{7ki]9kiA==kiCki=FkiFkiHkiJki#Kki|MkiQki~QS4=ki@SkiU,kirWkiYkiYki[kiu^ki^ki`kibki;c9=kiOekiVhkihkijkinkifnki%pki$rkijrT5==kiski/ukiwukiQwki%zkiozkiG|ki$kiwkikikiF3==kieki,kikiB,kiekiӧkixT6==kikigkiki/kikiP==ki߹kiϼkiqki5ki[,kikikiT7==kiki:kivkiki',kiki,kikicki:==kikin,kikikiki+kikiM8=ki-kiki*ki kiOki|kikiPkiki[kiki19=kiki,kiki,ki ki ,kikikiN9==kiki,kikikikiki,kikijki:==ki ki"ki"ki#ki%,ki'ki*h10/14==ki,ki /kiH/kiI1ki4kiI4ki(6ki8,kiQ;ki=ki=:==ki?kiB,kiDkiUGkiGkiIkiO _You start resting.A gnoll sergeant comes into view.kip\1=jj   gnoll sergeant (polearm, wandering)ki]/86.0 (65.0)kiikii37.0 (66 _kitkiuki1 #.≈≈#####...........#####..≈≈#.#.#.###.©.###.#F#j#.≈≈#...###.#####j###...##............j..##.ß#W######'######.#ß..##.#.⌠.#$$ß#!!.#j####..#.~~.#..'..)).©$#:..'..#.~~...#.≈≈.##.#.⌠@#..ß#...#.##.≈≈)#.≈≈.ß#.######$######.#ß ##.).#.≈≈###...............### ...)...###©#####.###.WF....≈≈#.#.#.###.©.###.#.#jki ))...≈≈#####...........#### .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈ ..).# ).#.#...........................ki< ]8.0 (1.0)ki[@ Q _You see here 7 gold pieces.ki?;..≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈#.≈≈#####...........####..≈≈#.#.#.###.©.###.#F#j...###.#####j###...###............j..###.ß#W######'######.#ß #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈#..#.~~.#..'..@).©$#:..'..#.~~.#.≈≈.##.#.⌠$#..ß#...#.##  #..)#.≈≈.ß#.######$######.#ß. ##.)kiH<,##...............##).#.≈≈#...###©#####.###.WF.....≈≈#.#.#.###.©.###.#.#j ..))...≈≈#####...........##### .)... ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈kig>.kiIXjkiJ-9 _kiTkiXN _You see here a +0 flail.kiR #....≈...≈.#....≈...≈.#..#.≈≈#####.....#####≈≈.##....≈≈#.#.#.###.©.###.#F#j#≈≈.##..#.≈≈#...###.#####.###...#≈≈.##..#.≈≈###..........j.j..###≈≈.##..#.≈≈.ß#W######'######.#ß.≈≈.##..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# ##..#.~~.#..'..)@.©$#:..'..#.~~.# #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ß.≈≈.# #.).#.≈≈###...............###≈≈.#).#.≈≈#...##i8 .40m#©#####.###.WF#≈≈.#≈≈#.#.#.###.©.###.#.#j#≈≈. .))...≈≈#####.....#####≈≈. )...#.≈~≈. .).##.≈~≈.j.j   gnoll sergeant (polearm, wandering)ki J=90 _ki! :  Things that are here:ki K _a +0 flail; a +0 clubkid#....≈...≈. #....≈...≈..# #..#.≈≈#####...........#####≈≈.# #....≈≈#.#.#.###.©.###.#F#j#≈≈.# #..#.≈≈#...###.#####.###...#≈≈.# kiBeI#..#.≈≈###.........j..j..###≈≈.# #..#.≈≈.ß#W######'######.#ß.≈≈.# #..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# ..#.~~.#..'..))@©$#:..'..#.~~.# kie[...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# ..)#.≈≈.ß#.######$######.#ß.≈≈.# .).#.≈≈###..........).#.≈≈#...###©#####.###.WF#≈≈.#≈≈#.#.#.###.©.###.#.#j#≈≈..#kif ))...≈≈#####...........#####≈≈..#  ...#.≈~≈..#kiSf  ).##.≈~≈..# kih0jki9t.j   gnoll sergeant (polearm, wandering)kitI1Poisonous Vapours _ki=ki"ki....≈...≈...# ....≈...≈..# ..#.≈≈#####...........#####≈≈.## ....≈≈#.#.#.###.©.###.#F#j#≈≈.# ..#.≈≈#...###.#####.###...#≈≈.# ..#.≈≈###........j...j..###≈≈.# ..#.≈≈.ß#W######'######.#ß.≈≈.# ..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.# ..#.~~.#..'..)).@$#:..'..#.~~.# #.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# ki)#.≈≈.ß#.######$######.#ß.≈≈.# ).#.≈≈###....... ).#.≈≈#...###©#####≈≈#.#.#.###.©.###.#.#j#≈≈..# )...≈≈#####..... ki>.j.kiz ki &2ki$kiu _There is a transporter landing site, spattered with blood here.kim _....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 455 ..#.≈≈#####...........#####≈≈.##  Health: 64/64 ======================== ki ,....≈≈#.#.#.###.©.###.#F#j#≈≈.#  Magic: 10/14 =================------- ..#.≈≈#...###.#####.###...#≈≈.#  AC: 3Str: 7 ..#.≈≈###............j..###≈≈.#  EV: 14Int: 20 ki ..#.≈≈.ß#W######j######.#ß.≈≈.#  SH: 5Dex: 16 ki '..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.#  XL:  9 Next: 11% Place: Dungeon:5 ki7 ..#.~~.#..'..)).@$#:..'..#.~~.#  Noise: ---------  Time: 6092.0 (0.0) kiZ }..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#  c) +0 dagger (protect) .)#.≈≈.ß#.######$######.#ß.≈≈.#  Cast: Poisonous Vapours ki ).#.≈≈###...............###≈≈.# ).#.≈≈#...###©#####.###.WF#≈≈.## ki `....≈≈#.#.#.###.©.###.#.#j#≈≈..#  j   gnoll sergeant (polearm, wandering) )...≈≈#####...........#####≈≈..# ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ki .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# Aim: a gnoll sergeant, wielding the +6 spear of Immorality {vamp, ^Drain rF-  kia ArCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam Harm rCorr Int+2},wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} and wearing an  amulet of chemistry (wandering, hasn't noticed you)  Poisonous fumes billow around the gnoll sergeant!  The gnoll sergeant is poisoned.ki ...... .©. ###  ######j## .#.⌠.#$$ß#!! .'..)).@$#: .#.⌠$#..ß# )######$##kii  ) )©####.©. jpoisoned) )...~ki & kir J====3.0 (1ki ki?  rCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam Harm rCorr Int+2},wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} and wearing an  amulet of chemistry (wandering, hasn't noticed you)  kig }Poisonous fumes billow around the gnoll sergeant!  The gnoll sergeant is poisoned. _shouts!ki  Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy3%4 Select a spell to describe [?] help [!]/[I] toggle spell headerskiMkiki....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 455 ..#.≈≈#####...........#####≈≈.## Health: 64/64 ======================== ....≈≈#.#.#.###.©.###.#F#j#≈≈.#kinMagic: 10/14 =================------- ..#.≈≈#...###.#####.###...#≈≈.#AC: 3Str: 7 ..#.≈≈###............j..###≈≈.#EV: 14Int: 20 ..#.≈≈.ß#W######j######.#ß.≈≈.#kiSH: 5Dex: 16 ..#.≈≈.##.#.⌠.#$$ß#!!.#j##.≈≈.#XL:  9 Next: 11% Place: Dungeon:5 ki #..#.~~.#..'..)).@$#:..'..#.~~.#Noise: ====-----  Time: 6093.0 (0.0) ..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#kiCLc) +0 dagger (protect) .)#.≈≈.ß#.######$######.#ß.≈≈.#Cast: Poisonous Vapours kiw).#.≈≈###...............###≈≈.# ).#.≈≈#...###©#####.###.WF#≈≈.## ki....≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, poisoned) )...≈≈#####...........#####≈≈..# ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# kiP.##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#rCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam Harm rCorr Int+2},wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} and wearing an  amulet of chemistry (wandering, hasn't noticed you)  kixPoisonous fumes billow around the gnoll sergeant!  The gnoll sergeant is poisoned. _The gnoll sergeant shouts!kikiSkikikiR  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ki/....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 455 ..#.≈≈#####...........#####≈≈.##  Health: 64/64 ======================== ....≈≈#.#.#.###.©.###.#F#j#≈≈.#  Magic: 7/14kip============------------ ..#.≈≈#...###.#####.###...#≈≈.#  AC: 3Str: 7 ..#.≈≈###......***...j..###≈≈.#  EV: 14Int: 20 ..#.≈≈.ß#W######j######.#ß.≈≈.#  SH: 5ki,Dex: 16 ki!..#.≈≈.##.#.⌠.#**ß#!!.#j##.≈≈.#  XL:  9 Next: 11% Place: Dungeon:5 ki,..#.~~.#..'..)).@$#:..'..#.~~.#  Noise: ====-----  Time: 6093.0 (0.0) ..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#  c) +0 dagger (protect) ki .)#.≈≈.ß#.######$######.#ß.≈≈.#  Cast: Poisonous Vapours ki2).#.≈≈###...............###≈≈.# ).#.≈≈#...###©#####.###.WF#≈≈.## kic....≈≈#.#.#.###.©.###.#.#j#≈≈..#  j   gnoll sergeant (polearm, poisoned) )...≈≈#####...........#####≈≈..# ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# kiAiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linekiAim: a gnoll sergeant, wielding the +6 spear of Immorality {vamp, ^Drain rF-  rCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam Harm rCorr Int+2},wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} and wearing an  kiMamulet of chemistry (lightly wounded, poisoned, chance to affect: 81%)ki^....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...# ludeguy the Toxicologist ....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 455 ki`..#.≈≈#####...........#####≈≈.## Health: 64/64 ======================== ....≈≈#.#.#.###.©.###.#F#j#≈≈.#Magic: 7/14============------------ ..#.≈≈#...###.#####.###...#≈≈.#AC: 3Str: 7 ..#.≈≈###......###...j..###≈≈.#EV: 14Int: 20 ..#.≈≈.ß#W#############.#ß.≈≈.#SH: 5Dex: 16 ..#.≈≈.##.#.⌠.###ß#!!.#j##.≈≈.#XL:  9 Next: 11% Place: Dungeon:5 ..#.~~.#..'..)).@$#:..'..#.~~.#ki`Noise: ====-----  Time: 6093.0 (0.0) ..#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.#c) +0 dagger (protect) .)#.≈≈.ß#.######$######.#ß.≈≈.#Cast: Poisonous Vapours ).#.≈≈###...............###≈≈.# ).#.≈≈#...###©#####.###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..# j   gnoll sergeant (polearm, poisoned) kiFa)...≈≈#####...........#####≈≈..# ..#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#Press: ? - help, Shift-Dir - straight lineAim: a gnoll sergeant, wielding the +6 spear of Immorality {vamp, ^Drain rF-  rCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam Harm rCorr Int+2},wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} and wearing an  amulet of chemistry (lightly wounded, poisoned, chance to affect: 81%)  The flask of dizzying concoctions shatters into a vile cloud!kiPkidB§jrCorr Dex+7}, wearing the +6 scale mail of Negation {^Contam Harm rCorr Int+2},wearing the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} and wearing an  amulet of chemistry (lightly wounded, poisoned, chance to affect: 81%)  The flask of dizzying concoctions shatters into a vile cloud!  The gnoll sergeant is lightly wounded.gnoll sergeant is engulfed in noxious fumes.kibO§§§$jconfused, po…)kiPs8========4.0 (1ki[kiH^: _The gnoll sergeant appears confused.ki/M§jYou puncture the gnoll sergeant!  Your weapon exudes an aura of protection.  You grab the gnoll sergeant.  The gnoll sergeant is almost dead.  You constrict the gnoll sergeant, but do no damage.ki7 10 -------5ki"CkiEV _The gnoll sergeant appears confused. The gnoll sergeant escapes!kiS p $You hit the gnoll sergeant.kiJ^ D☼kifb 455 =5=------6Poisonous Vapourskil kim K _You kill the gnoll sergeant!kip u _There is a transporter landing site, spattered with blood here.kiZ#....≈...≈... #....≈...≈.. #..#.≈≈#####...........#####≈≈.## #....≈≈#.#.#.###.©.###.#F#j#≈≈.# #..#.≈≈#...###.#####.###...#≈≈.# #..#.≈≈###......§§☼...j..###≈≈.# #..#.≈≈.ß#W######§######.#ß.≈≈.# #..#.≈≈.##.#.⌠.#$§ß#!!.#j##.≈≈.# #..#.~~.#..'..))@©$#:..'..#.~~.#.#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# ..)#.≈≈.ß#.######$######.#ß.≈≈.# .).#.≈≈###...............###≈≈.# .).#.≈≈#...###©#####.###.WF#≈≈.##.≈≈#.#.#.###.©.###.#.#j#≈≈..#  ))...≈≈#####...........#####≈≈..# ki[.#.≈~≈..#  ).##.≈~≈..# ki(ju.☼-7 _kinki~ ○You now have 468 gold pieces (gained 13).  j - an amulet of chemistry  Things that are here:kiHb68-8.0 (2kiki  the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}; the +6 scale mail ofNegation {^Contam Harm rCorr Int+2}; the +2 kite shield "Riow" {Rampage Dex+3 _Slay-6 SInv}ki  ##.≈≈#####...........#####≈≈.#..≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###.#####.###...ki !##.......☼○...j..##.ß#W######§######.#ß.##.#.⌠.#$§ß#!!.#j##~~.#..'..)))©$#:..'..#.~~ ...#.≈≈.##.#.⌠$#@.ß#...#.##.≈≈)#.≈≈.ß#.######$######.#ß .).#.≈≈###...............###.ki5 .##~ #.#.............................# ki @○☼ki +9.0 (1ki ki /M...≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..#.≈≈#####...........#####≈≈.##..≈≈#.#.#.###.©.###.#F#j...###.#####.###...###.......○○...j..###ß#W######☼######.#ß≈≈.##.#.⌠.#$§ß#!!.#j##.≈≈ #..#.~~.#..'..))@©$#:..'..#.~~ki} k.#.≈≈.##.#.⌠$#..ß#...#.## ..)#.≈≈.ß#.######$######.#ß. .).#.≈≈###...............###≈≈.#..## ~ki{ 8°kid ; 3 100ki) ]  Things that are here:MNegation {^Contam Harm rCorr Int+2}; the +2 kite shield "Riow" {Rampage Dex+3 _Slay-6 SInv} _ki]M..........................#...≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..#.≈≈#####...........#####≈≈.##..≈≈#.#.#.###.©.###.#F#j...###.#####.###...###.......○°...j..###ß#W######☼######.#ß≈≈.##.#.⌠.#@§ß#!!.#j##.≈≈ #..#.~~.#..'..)))©$#:..'..#.~~.#.≈≈.##.#.⌠$#..ß#...#.## ..)#.≈≈.ß#.######$######.#ß.≈≈.#..### #.#.#~kia°.○kiP^9==1 _ki9kir~ .☼You now have 477 gold pieces (gained 9).kiH772.0 (2ki_ki7. _You see here a +0 flail.kikikikiN _You see here a +0 flail.kiʹ ≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..##.≈≈#####...........#####≈≈.#..≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###.#####.###...##............j..##.ß#W######○######.#ß.kiJ##.#.⌠.#)☼ß#!!.#j##~~.#..'..))@©$#:..'..#.~~ ...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈)#.≈≈.ß#.######$######.#ß..####.#.ki#~ ).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# kii°3.0 (1 _kiki$  Things that are here:kie  the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}; the +6 scale mail ofNegation {^Contam Harm rCorr Int+2}; the +2 kite shield "Riow" {Rampage Dex+3 _Slay-6 SInv}ki΃ k ##.≈≈#####...........#####≈≈.#..≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###.#####.###...##............j..##.ß#W######°######.#ß.##.#.⌠.#)☼ß#!!.#j##~~.#..'..)))©$#:..'..#.~~ ...#.≈≈.##.#.⌠$#@.ß#...#.##.≈≈)#.≈≈.ß#.######$######.#ß .).#.≈≈###...............###..##~ #.#.............................# '○4774 _ki& ki kiK4kiQkiJRN _There are no items here.kikipkijkiekinM...≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..#.≈≈#####...........#####≈≈.##..≈≈#.#.#.###.©.###.#F#j...###.#####.###...###............j..###ß#W######'######.#ß≈≈.##.#.⌠.#)○ß#!!.#j##.≈≈ ki#..#.~~.#..'..))@©$#:..'..#.~~.#.≈≈.##.#.⌠$#..ß#...#.## ..)#.≈≈.ß#.######$######.#ß. .).#.≈≈###...............###≈≈.#..## ~kiki\'kiF(A==5 kip( _kiy.ki0$  Things that are here:ki2_Slay-6 SInv} _There are no items here. _ki<ki?Pick up what? 10/52 gear slots (_ for help) Hand Weapons (select all with ))  a - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7} Armour (select all with [)  b - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} kiB@ c - the +6 scale mail of Negation {^Contam Harm rCorr Int+2} [Up|Down] selectkic@B[Esc] exit ki@Letters toggle [.|Space] toggle selected[top]ki{  b + the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}[Enter] accept (1 chosen)kip  a + the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}  b + the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}2ki* ki 4 kiG v#....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈... ludeguy the Toxicologist #....≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..# Octopode of Gozag Gold: 477 #..#.≈≈#####...........#####≈≈.## Health: 64/64 ======================== #....≈≈#.#.#.###.©.###.#F#j#≈≈.# Magic: 9/14===============--------- #..#.≈≈#...###.#####.###...#≈≈.# AC: 3Str: 7 kiH #..#.≈≈###............j..###≈≈.# EV: 14Int: 20 #..#.≈≈.ß#W######'######.#ß.≈≈.# SH: 5Dex: 16 #..#.≈≈.##.#.⌠.#)○ß#!!.#j##.≈≈.# XL:  9 Next: 15% Place: Dungeon:5 kiH #..#.~~.#..'..))@©$#:..'..#.~~.# Noise: ---------  Time: 6105.0 (0.0) ...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# c) +0 dagger (protect) ..)#.≈≈.ß#.######$######.#ß.≈≈.# Cast: Poisonous Vapours .).#.≈≈###...............###≈≈.# .).#.≈≈#...###©#####.###.WF#≈≈.## .....≈≈#.#.#.###.©.###.#.#j#≈≈..#kiH &  ))...≈≈#####...........#####≈≈..#  ...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#kiH   ).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#ki I   _Slay-6 SInv} _There are no items here.  ki,I Things that are here:  the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}; the +6 scale mail ofkiSI Negation {^Contam Harm rCorr Int+2}; the +2 kite shield "Riow" {Rampage Dex+3 _Slay-6 SInv}kiSW °k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}kiW +6.0 (1kia ki2c _l - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}ki #....≈...≈  #....≈...≈..  #..#.≈≈#####...........#####≈≈.  #....≈≈#.#.#.###.©.###.#F#j#≈≈.#  #..#.≈≈#...###.#####.###...#≈≈.#  #..#.≈≈###............j..###≈≈.#  #..#.≈≈.ß#W######'######.#ß.≈≈.#  #..#.≈≈.##.#.⌠.#)°ß#!!.#j##.≈≈.# ##..#.~~.#..'..)@[©$#:..'..#.~~.# #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ß.≈≈.# #.).#.≈≈###i^ m...............###≈≈.# ..).#.≈≈#...###©#####.###.WF#≈≈..≈≈#.#.#.###.©.###.#.#j#≈≈.. .))...≈≈#####...........#####≈≈.. )...#.≈~≈.. .).##.≈~≈..ki _$7kiNki$  Things that are here:kiK _a +0 flail; a +0 clubkiW? #....≈...≈ #....≈...≈ #..#.≈≈#####.....#####≈≈.ki9X) #....≈≈#.#.#.###.©.###.#F#j#≈≈. #..#.≈≈#...###.#####.###...#≈≈. #..#.≈≈###............j..###≈≈.kibX #..#.≈≈.ß#W######'######.#ß.≈≈.kiX #..#.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈.  ##..#.~~.#..'..@)[©$#:..'..#.~~. kiX #...#.≈≈.##.#.⌠$#..ß#...#.##.≈≈. kiX #..)#.≈≈.ß#.######$######.#ß.≈≈. #kiX#.).#.≈≈###...............###≈≈.ki.Y.).#.≈≈#...###©#####.###.WF#≈≈.kiAY.≈≈#.#.#.###.©.###.#.#j#≈≈ .kiQY.))...≈≈#####.....#####≈≈ kioY/.)...#.≈~kiYX≈ ..).##.≈~≈kickid<10/14==kid&8 _kinkioN _You see here a +0 flail.ki"S #.≈≈#####...........#####..≈≈#.#.#.###.©.###.#F#j#.≈≈#...###.#####.###...##............j..##.ß#W######'######.#ß.kiS=.##.#.⌠.#)$ß#!!.#j####..#.~~.#..'..))[©$#:..'..#.~~...#.≈≈.##.#.⌠@#..ß#...#.##.≈≈)#.≈≈.ß#.######$######.#ß ##.).#.≈≈###...............###...###©#####..#.kiT#### ).#.#............................ kiO[ki\-9 _kiekikki l&84ki.l10.0 (2kizki|> _You now have 484 gold pieces (gained 7).kiB_M..≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈#.≈≈#####...........####..≈≈#.#.#.###.©.###.#F#j...###.#####.###...###............j..###.ß#W######'######.#ßki, #..#.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈#..#.~~.#..'..@)[©$#:..'..#.~~.#.≈≈.##.#.⌠.#..ß#...#.##  #..)#.≈≈.ß#.######$######.#ß. ##.).#.≈≈###...............###≈≈....###©#####..#.# ###kiki+1.0 (1kiskiN _You see here a +0 flail.kiC 2#....≈...≈.#....≈...≈.#..#.≈≈#####.....#####≈≈.##....≈≈#.#.#.###.©.###.#F#j#≈≈.##..#.≈≈#...###.#####.###...#≈≈.#kidE #..#.≈≈###............j..###≈≈.##..#.≈≈.ß#W######'######.#ß.≈≈.##..#.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈.# ##..#.~~.#..'..)@[©$#:..'..#.~~.# #...#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# #..)#.≈≈.ß#.######$######.#ß.≈≈.# #.).#.≈≈###...............###≈≈.#).#.≈≈#...###©#####.###.WF#≈≈.#≈≈#.#.#.###.©.###.#.#j#≈≈. .))...≈≈#####.....#####≈≈. )...#.≈~≈. .).##.≈~≈.ki\S kiT J==2 _ki_ kia $  Things that are here:kic K _a +0 flail; a +0 clubki[#....≈...≈. #....≈...≈..# #..#.≈≈#####...........#####≈≈.# #....≈≈#.#.#.###.©.###.#F#j#≈≈.# #..#.≈≈#...###.#####.###...#≈≈.# #..#.≈≈###............j..###≈≈.# ki R#..#.≈≈.ß#W######'######.#ß.≈≈.# #..#.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈.# ..#.~~.#..'..))@©$#:..'..#.~~.# ...#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# ..)#.≈≈.ß#.######$######.#ß.≈≈.# ki D.).#.≈≈###..........).#.≈≈#...###©#####.###.WF#≈≈.#≈≈#.#.#.###.©.###.#.#j#≈≈..# ))...≈≈#####...........#####≈≈..# ...#.≈~≈ki C..# ).##.≈~≈..#ki ki,ki--3 _ki7ki< _You see here the +6 scale mail of Negation {^Contam Harm rCorr Int+2}.ki81....≈...≈...# ....≈...≈..# ..#.≈≈#####...........#####≈≈.## ....≈≈#.#.#.###.©.###.#F#j#≈≈.# ..#.≈≈#...###.#####.###...#≈≈.# ..#.≈≈###............j..###≈≈.# ..#.≈≈.ß#W######'######.#ß.≈≈.# kiN9..#.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈.# ..#.~~.#..'..))[@$#:..'..#.~~.# kiz9#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# ki9)#.≈≈.ß#.######$######.#ß.≈≈.# ).#.≈≈###....... ki9).#.≈≈#...###©#####ki::≈≈#.#.#.###.©.###.#.#j#≈≈..# )...≈≈#####...........#####≈≈..##.≈~≈..# .##.≈~≈..#kiEkipF$4 kiF _ki{PkiSu _There is a transporter landing site, spattered with blood here.kiч≈...≈...#≈...≈..## #.≈≈#####...........#####≈≈.## ki≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###.#####.###...#≈≈.# #.≈≈###............j..###≈≈.# #.≈≈.ß#W######'######.#ß.≈≈.# #.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈.# #.~~.#..'..))[©@#:..'..#.~~.# kiΈh#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# )#.≈≈.ß#.######$######.#ß.≈≈.# ki.#.≈≈###......... .#.≈≈#...###©####ki!~≈≈#.#.#.###.©. kiLs...≈≈#####....... kiRkiV[1=5 _ki%ki  You now have 522 gold pieces (gained 38).  There is a fountain of clear blue water here.kiJ55226.0 (2kifkirI _Items here: )) [[[.kia .≈...≈....≈...≈..## ..#.≈≈#####...........#####≈≈.##.≈≈#.#.#.###.©.###.#F#j#≈≈.# ..#.≈≈#...###.#####.###...#≈≈.# .kib .#.≈≈###............j..###≈≈.# ..#.≈≈.ß#W######'######.#ß.≈≈.# ..#.≈≈.##.#.⌠.#)$ß#!!.#j##.≈≈.# .kivb .#.~~.#..'..))[@)#:..'..#.~~.# ..#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# .)#.≈≈.ß#.######$######.#ß.≈≈.# ).#.≈≈###...............###≈≈.# kib ).#.≈≈#...###©#####.###.WF#≈≈.##.≈≈#.#.#.###.©kib .###.#.#j#≈≈..# )...≈≈#####...........#####≈≈..# kib P..#.≈~≈..# .##.≈~kic #≈..#kiNo kio +7.0 (1ki/z ki| u _There is a transporter landing site, spattered with blood here.kiɅ]M..........................#ki...≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..###.≈≈#####...........#####≈≈.##..≈≈#.#.#.###.©.###.#F#jki...###.#####.###...###............j..###ki>ß#W######'######.#ß≈≈.##.#.⌠.#)@ß#!!.#j##.≈≈kin[~~.#..'..))[©)#:..'..#.~~ ..#.≈≈.##.#.⌠.#..ß#...#.## ki.)#.≈≈.ß#.######$######.#ß.≈≈.#..ki1.~kikij-8 _ki#ki,kiʨf30=9.0 (2kirki> _You now have 530 gold pieces (gained 8).ki 7 ≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..##.≈≈#####...........#####≈≈.## ..≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###.#####.###...##............j..##.ß#W######'######.#ß.ki7`##.#.⌠.#).ß#!!.#j##~~.#..'..))[@)#:..'..#.~~≈≈.##.#.⌠.#..ß#...#.##.≈≈ .)#.≈≈.ß#.######$######.#ß...~ .##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#ki@kiA,20.0 (1kiLkiM kiMo_There is a transporter landing site, spattered with blood here.ki] g≈...≈...#≈...≈..## #.≈≈#####...........#####≈≈.## ≈≈#.#.#.###.©.###.#F#j#≈≈.# kiP #.≈≈#...###.#####.###...#≈≈.# #.≈≈###............j..###≈≈.# kiu #.≈≈.ß#W######'######.#ß.≈≈.# ki #.≈≈.##.#.⌠.#).ß#!!.#j##.≈≈.# ki #.~~.#..'..))[©@#:..'..#.~~.# kiҌ #.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# ki )#.≈≈.ß#.######$######.#ß.≈≈.# .#.≈≈###.........ki  .#.≈≈#...###©####ki4 ≈≈#.#.#.###.©. ...≈≈#####.......kiT 4 kix ki@ -1 _kiJ ki <  There is a fountain of clear blue water here.ki: i _Items here: )) [[[.ki|hPick up what? 12/52 gear slots (_ for help) Hand Weapons (select all with ))a - a +0 spear  b - a +0 whip Armour (select all with [)c - a +0 kite shield  d - a +0 robe  e - a +0 scale mail [Up|Down] select[Esc] exit Letters toggle [.|Space] toggle selected[top]kiki. ki:...≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...## ludeguy the Toxicologist ...≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## Octopode of Gozag Gold: 530 .#.≈≈#####...........#####≈≈.##Health: 64/64 ======================== ...≈≈#.#.#.###.©.###.#F#j#≈≈.#kiMagic: 11/14 ==================------ .#.≈≈#...###.#####.###...#≈≈.#AC: 3Str: 7 .#.≈≈###............j..###≈≈.#EV: 14Int: 20 ki.#.≈≈.ß#W######'######.#ß.≈≈.#SH: 5Dex: 16 ki.#.≈≈.##.#.⌠.#).ß#!!.#j##.≈≈.#XL:  9 Next: 15% Place: Dungeon:5 .#.~~.#..'..))[©@#:..'..#.~~.#ki\Noise: ---------  Time: 6121.0 (0.0) .#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) )#.≈≈.ß#.######$######.#ß.≈≈.#kiCast: Poisonous Vapours .#.≈≈###...............###≈≈.# .#.≈≈#...###©#####.###.WF#≈≈.## kiY...≈≈#.#.#.###.©.###.#.#j#≈≈..# ...≈≈#####...........#####≈≈..# .#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ki^_There is a transporter landing site, spattered with blood here. _You now have 530 gold pieces (gained 8). _There is a transporter landing site, spattered with blood here.  There is a fountain of clear blue water here. _Items here: )) [[[.  Okay, then.ki!ki!ki*ki@,. _kikikiR ki#ki&: _ki *kiU*#2kiy*)==kiX-ki/ki^0ki[2kiH5ki5kioBkiJ,kiMkiQki]Q:==kiITkiWkiWkiZki^,kiJaki;dki|dkidE3==kigkil,kinkiqkirkitkixkiWxkiy{ki:~ki|~$==ki~kikiRkiki(kikikikiki"#4ki?)==kiki9You now have 530 gold pieces (gained 8). _transporter landing site, spattered with blood here.  There is a fountain of clear blue water here. _Items here: )) [[[. kiB_Okay, then.Magic restored.kiۣki$kiki.≈...≈#.≈≈#####...........#####≈≈ ....≈≈#.#.#.###.©.###.#F#j#≈≈.#.≈≈#...###.#####.###...#≈≈.# ..#.≈≈###............j..###≈≈.# ..#.≈≈.ß#W######'######.#ß.≈≈.# ..#.≈≈.##.#.⌠.#).ß#!!.#j##.≈≈.# ..#.~~.#..'..))[©)#:..'..#.~~.# ..#.≈≈.##.#.⌠.#.@ß#...#.##.≈≈.# .ki<)#.≈≈.ß#.######$######.#ß.≈≈.# ).#.≈≈###...............###≈≈.# ).#.≈≈#...###©#####.###.WF#≈≈.## ....≈≈#.#.#.###.©.###.#.#j#≈≈..# )...≈≈#####...........#####≈≈..##.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# .##.≈~≈..# .#.............................#kib #.≈≈#####...........#####≈≈.## ..≈≈#.#.#.###.©.###.#F#j#≈≈.# #.≈≈#...###.#####.###...##............j..##ki.ß#W######'######.#ß.##.#.⌠.#).ß#!!.#j##~~.#..'..))[©)#:..'..#.~~≈≈.##.#.⌠.#..ß#...#.##.≈≈ .ki8y)#.≈≈.ß#.######@######.#ß ki\h).#.≈≈###...............### )ki...###©#####.###.WF#≈≈.###ki#ki0.......ki9  .#.............#.#.............##kiE kie038.0 (17.0)ki,9.0 (18kiki|  You now have 535 gold pieces (gained 5).  There is an open translucent door here.kie5540.0 (19kikiX _You see here a +0 halberd of pain.ki kiE ki2 ki ,ki :==ki ,ki ki ki ki¡ ki֣ ki kiۥ kiy kiE ,ki ki kih ki ki0 ki kiy ki/ kiR kiD ki@ kiw ki ki# ki ki ki ki ki7 ki> ki kiW L  There is an open translucent door here.ki 5 _ki ki ki ki ki ki ,kiv ki N _e - 5 potions of enlightenment (gained 1)ki 3ki  ki ki ki  ki" u _j - 3 bubbling grey potions (gained 1)kiU- ki-. ki0 ki:> K≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...###. .≈≈≈≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #. .≈≈#####...........#####≈≈.## ## .≈≈#.#.#.###.©.###.#.#.#≈≈.# # .≈≈#...###.#####.###...#≈≈.# ≈≈###...............###≈≈.# ki> J≈≈.ß#W######'######.#ß.≈≈.# ≈≈.##.#.⌠.#).ß#...#.##.≈≈.# ~~.#..'..))[©)#@..'..#.~~.# .≈≈.##.#.⌠.#..ß#...#.##.≈≈.# kix? {.≈≈.ß#.######)######.#ß.≈≈.# ≈≈###...............###≈≈.# .≈≈#...###©#####.###...#≈≈.##≈≈#.#.#.###.©.###.#.#.#≈≈..#≈≈#####...........#####≈≈..#≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#kikH -55.0 (15kiH ,6.0 (16kiQ kiS N _You pick up a manual of Short Blades and begin studying.ki3kiGki...'0.0).).......kiki] _Partly explored, unvisited transporter.ki ki2 ki ki* ki ki ki ] _Partly explored, unvisited transporter.kiFL≈...≈...###. ≈...≈..## #. ≈≈#####.....#####≈≈.## ##. ≈≈#.#.#.###.©.###.#.#.#≈≈.# # kiL≈≈#...###.#####.###...#≈≈.# ≈≈###.......###≈≈.# ≈≈.ß#W######'######.#ß.≈≈.# ≈≈.##.#.⌠.#).ß#...#.##.≈≈.# ~~.#..'..))[©)#.@.'..#.~~.# ≈≈.##.#.⌠.#..ß#...#.##.≈≈.# ≈≈.ß#.######)######.#ß.≈≈.# ≈≈###.kiLv...... ≈≈#...###©#####.###.. ≈≈#.#.#.###.©.###.#.#.#≈≈..# ≈≈#####.....#####kiM<≈≈..# kiNSkiT27.0 (1 _ki!YkiEZki G...≈...###....≈..## #.#####...........#####≈≈.## ##.#.#.#.###.©.###.#.#.#≈≈.# ##...###.#####.###...#≈≈.# ####........###≈≈.# .ß#W######'######.#ß.≈≈.# .##.#.⌠.#).ß#...#.##.≈≈.# ki= .#..'..))[©)#..@'..#.~~.# .##.#.⌠.#..ß#...#.##.≈≈.# kib '.ß#.######)######.#ß.≈≈.# ###.....ki #...###©#####.###.ki ,#.#.#.###.©.###.#.######...........### ki ki1 &8ki kiv ki&...≈...###....≈..## #. #####...........#####≈≈.## ##. #.#.#.###.©.###.#.#.#≈≈.# ###. ki@'=#...###.#####.###...#≈≈.# # ###........###≈≈.# # .ß#W######'######.#ß.≈≈.# .##.#.⌠.#).ß#...#.##.≈≈.# ki'.#..'..))[©)#...@..#.~~.# .##.#.⌠.#..ß#...#.##.≈≈.# ki'q.ß#.######)######.#ß.≈≈.# ###........#ki' #...###©#####.###.. ki(#.#.#.###.©.###.#.# #####...........###ki/( ki0kiN1&9ki#;ki;] _There is an open translucent door here.ki1n...≈...###....≈..## #.....#####≈≈.## ##. .#.#.###.©.###.#.#.#≈≈.# ###. ...###.#####.###...#≈≈.# ##.........###≈≈.# ki# ß#W######'######.#ß.≈≈.# ##.#.⌠.#).ß#...#.##.≈≈.# #..'..))[©)#...'@.#.~~.# ##.#.⌠.#..ß#...#.##.≈≈.# kid:ß#.######)######.#ß.≈≈.# ........###≈≈.# ...###©#####.### .#.#.###.©.###.#ki\....# kikiz.60 _kikiki5 ki96 ki7 kiE &0kiI kiL kiN ] _Partly explored, unvisited transporter.kiŒ 3kij ki 4kiƸ ki ] _Partly explored, unvisited transporter.kiki1Wield or unwield which item (- for none)?- - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip ki+k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}. A hunting weapon consisting of a wooden shaft with a pointed metal head fastenedon one end. Base accuracy: +4 Base damage: 6 Base attack delay: 1.1 This weapon's minimum attack delay (0.5) is reached at skill level 12.Your skill: 0.0; use (s) to set 12.0 as a target for Polearms.At 100% training you would reach 12.0 in about 2.6 XLs.Current attack delay: 1.1. Damage rating: 20 (Base 6 x 92% (Str) x 112% (Skill) + 14 (Ench + Slay)). Vamp:It occasionally heals you for a portion of the damage dealt when itwounds a living creature. ^Drain: It drains your maximum health when unequipped. rF-:It makes you vulnerable to fire. rCorr: It protects you from acid and corrosion. Dex+7: It affects your dexterity (+7). If you switch to wielding this weapon: Your EV would increase by 1.1 (14.0 -> 15.1). This weapon falls into the 'Polearms' category. It has an extended reach (targe[?7lt[?7hki Wield or unwield which item (- for none)?  - - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7} [?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip kiU ki#h ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...###..... ludeguy the Toxicologist ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #..... Octopode of Gozag Gold: 535 ####...........#####≈≈.## ##.... Health: 64/64 ======================== .#.#.###.©.###.#.#.#≈≈.# ###.. Magic: 14/14 ======================== ...###.#####.###...#≈≈.###. AC: 3Str: 7 ##...............###≈≈.### EV: 14Int: 20 ß#W######'######.#ß.≈≈.#SH: 5Dex: 16 ##.#.⌠.#).ß#...#.##.≈≈.#XL:  9 Next: 15% Place: Dungeon:5 #..'..[39;kih !49m))[©)#...'@.#.~~.#Noise: ---------  Time: 6160.0 (0.0) ##.#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) ß#.######)######.#ß.≈≈.#Cast: Poisonous Vapours ##...............###≈≈.# ...###©#####.###...#≈≈.## .#.#.###.©.###.#.#.#≈≈..# ####...........#####≈≈..# ≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# _You pick up a manual of Short Blades and begin studying. _Partly explored, unvisited transporter. _Partly explored, unvisited transporter. _There is an open translucent door here. _Partly explored, unvisited transporter. _Partly explored, unvisited transporter.kiTo + _Partly explored, unvisited transporter. _There is an open translucent door here _Partly explored, unvisited transporter  Okay, then.kiu kicw . _kiIG kiG kiN kiP F _Unknown command.ki<ki٬  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   h + Spellcasting 3.8   4.8  -1  ki=         b - Polearms   0.0   1.0   0   i + Conjurations 3.7   4.0   0  ki] c - Unarmed Combat   0.0   1.0   0   j - Alchemy  12.1  12.6  +1      kik + Fire Magic1.2   2.0   0  ki d - Short Blades   0.0   0.5   0 +4 l + Air Magickiح2.4   3.0   0      ki{    e + Dodgingki<54.1   5.0   0   m - Evocations   0.0   0.8  +1   f - Shields   0.0   1.0   0   n - Shapeshifting   0.0   1.2  -1  g + Stealthki5.9   3.0  +4                                  kiѮ        ki        ki        kiET    kicThe species aptitude is in white. Bonus from skill manuals is in red.  [?] Helpki|G[=] set a skill target  kiݯ[/] auto|manual mode [*] useful|all skills [!] training|cost|targetskin{ d + Short Blades   0.0 kiXc ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈...###..... ludeguy the Toxicologist ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #..... Octopode of Gozag Gold: 535 ####...........#####≈≈.## ##.... Health: 64/64 ======================== .#.#.###.©.###.#.#.#≈≈.# ###.. Magic: 14/14 ======================== ...###.#####.###...#≈≈.###. AC: 3Str: 7 ##...............###≈≈.### EV: 14Int: 20 ß#W######'######.#ß.≈≈.#SH: 5Dex: 16 ##.#.⌠.#).ß#...#.##.≈≈.#XL:  9 Next: 15% Place: Dungeon:5 #..'.. kie [m))[©)#...'@.#.~~.#Noise: ---------  Time: 6160.0 (0.0) ##.#.⌠.#..ß#...#.##.≈≈.#c) +0 dagger (protect) ß#.######)######.#ß.≈≈.#Cast: Poisonous Vapours ##...............###≈≈.# ...###©#####.###...#≈≈.## .#.#.###.©.###.#.#.#≈≈..# ####...........#####≈≈..# ≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# _Partly explored, unvisited transporter. _There is an open translucent door here. _Partly explored, unvisited transporter. _Partly explored, unvisited transporter. _Okay, then. _Unknown command. kif  kig  kij  kik  ki& M.......................#.##..## ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #.  kiy' a####...........#####≈≈.## ##.. .#.#.###.©.###.#.####. ...###.#####.###...#≈≈.###. ##...............###≈≈.### ß#W######'######.#ß.≈≈.# ##.#.⌠.#).ß#...#@##.≈≈.# # ki' S..'..))[©)#...'..#.~~ ##.#.⌠.#..ß#...#.##. ß#.######)######.#ß.≈≈.#.. ki' ##.#.###. ki( . ki<0  kiB1 21.0 (1 _ ki8  ki:  kiSH ^M#.....##########... .......................#.##..## ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #. ####...........#####≈≈.## ##.. .#.#.###.©.###.#.#.###.  kiH ...###.#####.###...##. ##...............##### ß#W######'######@#ß ##.#.⌠.#).ß#...#.##.≈≈.# #..'..))[©)#...'..#.~~.# ##.#.⌠.#..ß#...#.##.≈≈.### kiH G.#...###.#.....### kiI  kiO  ki]P &2 kia  kib  kia^M...#..# ##########..# #.....##########... .......................#.##....## ≈≈≈≈≈≈≈≈...≈≈≈≈≈≈≈≈≈≈≈..## #. ####...........#####≈≈.## ##.. . kiӺl#.#.###.©.###.#.#.####. ...###.#####.###...###. ##..............@##### ß#W######'######.#ß ##.#.⌠.#).ß#...#.##.≈≈  kiGT#..'..))[©)#...'..#.~~.##...#.####..####.#.# ki ki&3 ki^ kie ki-.#..# #..# .#.....##########..........#......#.##≈...≈...###≈...≈..## ##..#####≈≈.## ## #.#.#.###.©.###.#.#.#≈≈.# ### #...###.#####.###...#≈≈.# ###.###≈≈.# .ß#W######'######.#ß.≈≈.# .##.#.⌠.#).ß#...#.##.≈≈.#  kiU.#..'..))[©)#...'..#.~~.# .##.#.⌠.#..ß#...#.##.≈≈.# .ß#.######)######.#ß.≈≈.##......###≈≈.# #...###©#####.###...#≈≈.## #.#.#.###.©.###.#.#.#≈≈..# ki ki&4 ki ki ki2i#....#..# #..# #.#.....##########...#..............#.##≈...≈...###≈...≈..## # ≈#####...#####≈≈.## ## ≈#.#.#.###.©.###.#.#.#≈≈.# ### ≈#...###.#####.###...#≈≈.# ≈### ki.###≈≈.# ≈.ß#W######'######.#ß.≈≈.# ≈.##.#.⌠.#).ß#...#.##.≈≈.# ~.#..'..))[©)#...'..#.~~.# ≈.##.#.⌠.#..ß#...#.##.≈≈.# ≈.ß#.######)######.#ß.≈≈.# ≈###.......###≈≈.# ≈#...###©#####.###...#≈≈.## ≈#.#.#.###.©.###.#.#.#≈≈..# ki ki&5 kiC ki kiQ #....#..# #..# ##.#.....##########..........#...............#.##≈...≈...###≈...≈..## #≈#####....#####≈≈.## ##≈#.#.#.###.©.###.#.#.#≈≈.#  kiR≈#...###.#####.###...#≈≈.# ≈###.###≈≈.#≈.ß#W######'######.#ß.≈≈.#≈.##.#.⌠.#).ß#...#.##.≈≈.# ~~.#..'..))[©)#...'..#.~~.#≈.##.#.⌠.#..ß#...# ki8R.##.≈≈.#≈.ß#.######)######. kiR#ß.≈≈.#≈###.......###≈≈.#≈#...###©#####.###...#≈≈.## ≈≈#.#.#.###.©.###.#.#.#≈≈..# ki[ ki[&6 kib kic ki\Q ki.  ki  kir  ki  kiC  ki , ki  ki  ki  kiu  ki  kiY  ki  ki9  kil  ki B ki L  There is an open translucent door here. ki]  ki  _ ki  ki  ki  ki  ki  ki d  There is a transporter landing site, spattered with blood here. ki  ki  _ ki  ki  ki  ki?  ki  ki' 6  There is an open translucent door here. kiX g  You see here a +0 halberd of pain. ki  kiJ  _ ki  ki  ki  ki  ki[  ki] ki2, kim ki #..#.≈≈#...###.#####.###...#≈≈  #..#.≈≈###...............###≈≈  #..#.≈≈.ß#.######'######.#ß.≈≈  #..#.≈≈.##.#.⌠.#).ß#...#.##.≈≈  ##..#.~~.#..'..))[©)#...'..#.~~  #...#.≈≈.##.#.⌠.#..ß#...#.##.≈≈  #..)#.≈≈.ß#.######)######.#ß.≈≈. ##.).#.≈≈###...............###≈≈. ...).#.≈≈#...###@#####.###...#≈≈.77.0 (11.0) .......≈≈#.#.#.###.©.###.#.#.#≈≈. ..))...≈≈#####...........#####≈≈. .)...#.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈. ..).##.≈≈≈≈≈≈≈≈≈≈≈≈~≈ ki^≈≈≈≈≈≈≈≈≈≈. ).#.#............................  .##........#.#............  .##.#...............##...........  .##...............###............  ki kibR _There is a transporter here. ki0..#.≈≈###...............###≈≈.# ..#.≈≈.ß#.######'######.#ß.≈≈.# ..#.≈≈.##.#.⌠.#).ß#...#.##.≈≈.# ..#.~~.#..'..))[©)#...'..#.~~.# ..#.≈≈.##.#.⌠.#..ß#...#.##.≈≈.# .)#.≈≈.ß#.######)######.#ß.≈≈.# ).#.≈≈###...............###≈≈.# ).#.≈≈#...###©#####.###...#≈≈.## .≈≈#.#.#.###.@.###.#.#.#≈≈..# )...≈≈#####...........#####≈≈..# #.≈≈≈≈≈≈≈≈≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ##.≈≈≈~≈≈≈..##.............................# .#.............#.#......##.........##..... ki 1# ...............###........####... kiF9 ki:18.0 (1.0) kiA kiDL _You enter the transporter and appear at another place.kiY3kiki....'.©.)..©0kiwkiki ki7_Done exploring.kiWkiyWkiYZkikikijkiE _Done exploring.ki;3kikiwJkiNki g[ _Done exploring.kin ki ki( ki H _No target in view!ki^ki^kiakiokirkiv: _kiezkiki:Water kiki&> _You enter the deep water.kikikiki"kidki̐ kiYki)ki,kikiݘkiki۞,kikiأkikkiki~ki[ki٬ki'kiMki2kikiڴkikikikikikiMki,ki8kiTkiFkikikia'###.©.###.#.#.#≈≈..# ........#####≈≈..# # ≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# # ≈≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ####.................# ###>.. .ki..#.#.............## ###..... .....##.............## ###<...... ...###...............# #.........####..........@....# #.........90.0 (12.0) ...........# #.........ki)###..............## #.....<... #...............# #......... #kiA# #.. #....[..........# #kie.. ## #...## #ki. # ##......### # #ki'........#kixkiki}ki Iki...........###≈≈.# ©#####.###...#≈≈.## ##.©.###.#.#.#≈≈..# .........#####≈≈..#  ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..#  # ≈≈≈~≈≈≈≈≈≈≈≈≈≈≈≈..# ####......# ###>#.#.......## ###..ki~ ....@..## ###<ki 2.0 (ki^ 2.0)ki ###ki Y....# #. .ki.  ####.kiw `.....# #....... .ki  ....ki  #.ki2 ##ki|D## #.....< kiR## #......ki6# #. #kiL, #.ki6# #.ki!....[ki?# #.ki`!## kihkikikikiJkikiki^Bkij ,ki ,ki) kiskikikikikiCkihkikikikikikiki]kikikikikiNkikikikikiVkiM ki ki kiS!ki"ki"ki"ki!#ki$ki&,ki&ki'ki(,kiQ)ki*ki5+kiW+ki+ki,kiP-ki-ki-ki.ki/ki=0ki1ki2ki4kiK4ki5ki;+≈≈≈≈≈≈≈≈..# #..# ≈≈≈≈≈≈≈≈..# ####.#### ..........# ###>......## .## ###..........## ...........## ###<...........#∩.♣ ............# #..............#..ki5<...# #..............#♣..........# #...................## #.@...<.....210.0 (18.0).........# #............)..........# #.........# [..# #.........kil<## ...........## #...............## ki<............###.............### .............#.............## ..........##..###.........### ki<~.........##..## ###.<..##...###ki\=kiBkiCkiv Iki kif kib BkiO ki ki ki ,kiˑ ki ki kiZ ki ki kii BkiS .≈≈.# ##.# .≈≈.# .## #≈≈.#  #.# #≈≈.## ##.# #≈≈..# #.## #≈≈..# ##.# ≈≈≈..# #..# ≈≈≈..# ####.#### # ###@......## 6.0 (6.0)## ###.#### ## ###<....#∩.♣# .# #.......#...## #.......#♣..## #......### #.....<.#[39;ki¥ 49m #............).....# #.................##kiG kin c _There is a stone staircase leading down here.ki2 ki6   Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   h + Spellcasting 3.8   4.8  -1  ki:7 =         b - Polearms   0.0   1.0   0   i + Conjurations 3.7   4.0   0  ki7  c - Unarmed Combat   0.0   1.0   0   j - Alchemy  12.1  12.6  +1      k + Fire Magic1.2   2.0   0   d + Short Blades   0.0   0.5   0 +4 l + Air Magic2.4   3.0   0      ki8     e + Dodging4.1   5.0   0   m - Evocations   0.0   0.8  +1   f - Shields   0.0   1.0   0   n - Shapeshifting   0.0   1.2  -1  g + Stealth5.9   3.0  +4    [39;49m                                     [34kiJ9 m                     The species aptitude is in white. Bonus from skill manuals is in red.  [?] Help[=] set a skill target  [/] auto|manual mode [*] useful|all skills [!] training|cost|targetskik kis kiz Q.≈≈.###.#ludeguy the Toxicologist .≈≈.##.##Octopode of Gozag Gold: 535 #≈≈.##.#Health: 64/64 ======================== #≈≈.####.#Magic: 14/14 ======================== #≈≈..##.##AC: 3Str: 7 #≈≈..###.#EV: 14Int: 20 ≈≈≈..#ki{ #..#SH: 5Dex: 16 ≈≈≈..#####.####XL:  9 Next: 15% Place: Dungeon:5 .....####@......##Noise: ---------  Time: 6216.0 (0.0) .....## ###..........####c) +0 dagger (protect) ki{ ......## ###<...........#∩.♣#Cast: Poisonous Vapours .......# #..............#...# .......# #..............#♣..# .......# #..................# kiH| ......## #.....<............# ......# #............).....# ......# #.................## _Done exploring. ki| _Done exploring. _Done exploring. _No target in view! _You enter the deep water. _There is a stone staircase leading down here.kiu 4ki ki kiki#ki3kiBki27.0 (1 _kiki&6ki') .<.. #.###  ... ..#.  #... ...  ki̓g#... ..#  #...##..  #.....  #.[..#  #..@#  ......###  ..... .... ... .. . ki -8.5 (2.5ki08<ki _You climb downwards.  Found a leather armour. Found a stone staircase leading up.ki=a _There is a stone staircase leading up here.kiUC kiC kiD kiKJ (0.0kiM ki T j _Key pressed, stopping explore.ki[ Iki\ kia #### ## ..<.. #.###.... ..#.. ... ..##...##..#.....##.[ ##..<......###.......kib W.[....#kiAh kiZk +9.5 (1kim kiap M _Found a leather armour.kiki/ki,ki 1H _No target in view!ki3kikikiM#### ## ..<.. #.####.... ..#.(.. ..... #...##..@..#0.[..### ##..<......###...#...#kiki,20.5 (1kiki) _Found 2 boomerangs.ki3"4ki&ki)H _No target in view!kiVSki TkiyVki7Zki]ki dP _kigkihkirikilki okioki+qkiski}nki~kikirkiXkikiEkiki_kiǖ,kikikikikikiՠkigkikikikiاki(kikikiիki-kikizkiHki̲kikiOkiki+kikikiekikibki ki{kikiMkiLkijBkiRkikiki{kiki_ ###  #####.# #####..<..####.######....@...##..#.(.##388.0))......#....#.......#)......#.......##..##....#..#...##..##.##... ..###......#### ..[ #.[..###ki  .... ##..<# ..........### .......kiki,9.5 (19ki7kie _Found a sling, a hand axe and a leather armour.kiljkiki͒kiH _No target in view!ki ki Quiver which action? ([-] to clear) Items ([,] to cycle)Zap: wand of polymorph (8)Zap: wand of paralysis (10)Zap: wand of mindburst (8) Spells ([,] to cycle)  a - Cast: Poisonous Vapours  b - Cast: Mercury Arrow  c - Cast: Mephitic Cloud  d - Cast: Olgreb's Toxic Radiance  e - Cast: Sticky Flame (3%) Abilities ([,] to cycle)Abil: Potion Petition Abil: Call Merchant ki5 uAbil: Bribe Branch [*/%] inventory [&] all spells [^] all abilities[!] focus mode: off|onki`kibludeguy the ToxicologistOctopode of Gozag Gold: 535Health: 64/64 ========================Magic: 14/14 ========================AC: 3Str: 7###EV: 14Int: 20#####.# ###SH: 5Dex: 16###..<..####.#####kiXL:  9 Next: 15% Place: Dungeon:6#....@...##..#.(.##Noise: ---------  Time: 6239.5 (0.0))......#....#.......#c) +0 dagger (protect))......#.......##..##Cast: Poisonous Vapours....#..#...##..##.##... ..###......####.. ..[ #.[..###. .... ##..<#..........###....... _Found a leather armour. _No target in view! _Found 2 boomerangs. _No target in view! _Found a sling, a hand axe and a leather armour. _No target in view!kiki!kiki v########.# ######..<..####.######........##..#.(.)......#@...#.......# )......#.......##..## ....#..#...##..##.## ... ..###......###.. ..[ #.[..###. .... ##..<#..........### .......kiki!340.5 (1 _ki=kiki9l########.# ######..<..####.######........##..#.(.)......#....#.......# )......#.@.....##..## ....#..#...##..##.## ... ..###......#### .. ..[ #.[..###. .... ##..<#.........### .......kiδD .....kiki&1kikiki$ ########.# ######..<..####.######........##..#.(.ki )......#....#.......# )......#.......##..## ....#..#..@##..##.## ... ..###......#### .. ..[ #.[..### . .... ##..<#.........### .......................[.#kiڛ ki &2ki ki ki[kikiki,kiki$kiki kikikikiki&ki########.# ###  ###..<..####.#####  #........##..#.@.## 9.5 (7 ......#....#.......# ......#.......##..## ...#..#...##..##.## .. ..###......#kiA### . ..[ #.[..###  .... ##..<# ..........###.......kikiCki&P _You see here 2 boomerangs.ki ki6 ,50.5 (1ki+ < _m - 2 boomerangski3kiLkiNkiѠki&,ki5kikiRkiUkikikikiܯkikikiдkikiki1kiokiukikiWBkixnki  You encounter an ogre. It is wielding a +0 giant spiked club.kiE###..<..####.######........##..#...##)......#....#.......#)......#.......##..##....#..#...##..##.##ki......###......#### .. ..[ #.[..### . ......##..<#kiQ  .........@## .........#  .........#  .......... ki....[.##... .....# ##..O   ogre (asleep) ..... ... ..O.. .... ki kiP+7.5 (7kiG28.5 (8 _kikiH ki  ###..<  #........##..#...##  #....#.......#  )#.......##..##  ...##..##.##  ......###......####  .. ..[ #.[..###  . ......##..<#  .........@###  .........# .........# .......... ....[.##...  .....# ##..  ..... ...  ..O.. .... ki  ###..<  #........##..#...##  #....#.......#  )#.......##..##  ...##..##.##  kij ......###......####  .. ..[ #.[..###  . ......##..<#  .........@###  .........# .........# .......... ....[.##... .....# ##..  kiÐ ]..... ... ..O.. .... kiژ 4ki4 ki \ _An ogre is nearby!ki}7 ###..<  #........##..#...##  #....#.......#  )#.......##..##  ...##..##.##  ......###......####  .. ..[ #.[..###  . ......##..<#  .........@###  .........# .........# .......... ....[.##...  .....# ##..  ..... ...  kiS..O.. .... ki> ###..<  #........##..#...##  #....#.......#  )#.......##..##  ...##..##.##  ......###......####  .. ..[ #.[..###  . ......##..<#  .........@###  .........# .........# .......... ....[.##... .....# ##..  ..... ... ..O.. .... kikifki^ki\ _An ogre is nearby!kiz Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c + Mephitic CloudConjuration/Alchemy/Air 1% 3 d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy3%4 Select a spell to describe [?] help [!]/[I] toggle spell headerski_kigkipH###..<..####.#####ludeguy the Toxicologist#........##..#...##Octopode of Gozag Gold: 535)......#....#.......#Health: 64/64 ========================)......#.......##..##Magic: 14/14 ========================....#..#...##..##.##AC: 3Str: 7......###......####EV: 14Int: 20kifqK.. ..[ #.[..###SH: 5Dex: 16. ......##..<#XL:  9 Next: 15% Place: Dungeon:6.........@###Noise: ---------  Time: 6258.5 (0.0).........#c) +0 dagger (protect).........#Cast: Poisonous Vapours..............[.##........# ##..O   ogre (asleep)..... .....O.. .... _No target in view! _You see here 2 boomerangs. _m - 2 boomerangs _You encounter an ogre. It is wielding a +0 giant spiked club. _An ogre is nearby! kiqO_An ogre is nearby!kixkiOyki kiki@ ki  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c + Mephitic CloudConjuration/Alchemy/Air 1% 3 d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy3%4 Select a spell to describe [?] help [!]/[I] toggle spell headerskiki ki{*###..<..####.#####ludeguy the Toxicologist#........##..#...##Octopode of Gozag Gold: 535)......#....#.......#Health: 64/64 ========================)......#.......##..##Magic: 14/14 ========================....#..#...##..##.##AC: 3Str: 7......###......####EV: 14Int: 20.. ..[ #.[..###SH: 5Dex: 16. ......##..<#ki+XL:  9 Next: 15% Place: Dungeon:6.........@###Noise: ---------  Time: 6258.5 (0.0).........#c) +0 dagger (protect).........#Cast: Poisonous Vapours..............[.##........# ##..O   ogre (asleep)..... .....O.. .... _No target in view! _You see here 2 boomerangs. _m - 2 boomerangs _You encounter an ogre. It is wielding a +0 giant spiked club. _An ogre is nearby! _An ogre is nearby!ki3kif4ki;ki> ki"F ki-KNGear: 13/52 gear slots (Left/Right to switch category) Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7} Missiles (go to first with ()m - 2 boomerangs  kiKArmour (go to first with [)  l - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)g - an amulet of guardian spirit  j - an amulet of chemistry Talismans (go to first with %)a - a riddle talisman!kiN!kix###..<..####.#####ludeguy the Toxicologist#........##..#...##Octopode of Gozag Gold: 535)......#....#.......#Health: 64/64 ========================)......#.......##..##Magic: 14/14 ========================....#..#...##..##.##AC: 3Str: 7......###......####EV: 14Int: 20.. ..[ #.[..###SH: 5Dex: 16. ......##..<#XL:  9 Next: 15% Place: Dungeon:6.........@###Noise: --------- [!kis40m Time: 6258.5 (0.0).........#c) +0 dagger (protect).........#Cast: Poisonous Vapours..............[.##........# ##..O   ogre (asleep)..... .....O.. .... _No target in view! _You see here 2 boomerangs. _m - 2 boomerangs _You encounter an ogre. It is wielding a +0 giant spiked club. _An ogre is nearby! _An ogre is nearby!!kiD!ki!kiկ !ki Quiver which action? ([-] to clear) Items ([,] to cycle)Throw: 2 boomerangs!kiͲ Zap: wand of polymorph (8)Zap: wand of paralysis (10)Zap: wand of mindburst (8) Spells ([,] to cycle)  a - Cast: Poisonous Vapours  b - Cast: Mercury Arrow  c - Cast: Mephitic Cloudd - Cast: Olgreb's Toxic Radiance  e - Cast: Sticky Flame (3%) Abilities ([,] to cycle)Abil: Potion Petition Abil: Call Merchant Abil: Bribe Branch !ki ][*/%] inventory [&] all spells [^] all abilities[!] focus mode: off|on"ki+ta -  b -  c -  d -efghij -k -  l -off|on#kih#ki_p(###..<..####.#####ludeguy the Toxicologist#........##..#...##Octopode of Gozag Gold: 535)......#....#.......##kip Health: 64/64 ========================)......#.......##..##Magic: 14/14 ========================....#..#...##..##.##AC: 3Str: 7......###......####EV: 14Int: 20#kiq .. ..[ #.[..###SH: 5Dex: 16. ......##..<#XL:  9 Next: 15% Place: Dungeon:6#ki8qW.........@###Noise: ---------  Time: 6258.5 (0.0).........#c) +0 dagger (protect).........##kieqCast: Poisonous Vapours..............[.##........# ##..#kiq&O   ogre (asleep)..... .....O.. .... _No target in view! _You see here 2 boomerangs. _m - 2 boomerangs _You encounter an ogre. It is wielding a +0 giant spiked club. _An ogre is nearby! _An ogre is nearby!#kiy;$kiMe #........##..#...##)......#....#.......# )......#.......##..## ....#..#...##..## ......###......## .....[###.[..###  . ......##..<#  ....### ..#.##....#...$ki@.[.##........# ##..... ....O.. ......#. ..$ki;$ki29.5 (1 _$ki $kiJ $ki,  Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.$ki~$kiM$ki$kiD _You can't see any susceptible monsters within range! (Use Z to cast anyway.)%ki'  Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.%kiZ..#.........#...##..#....###.........[###.[..#......##...........##.......@..#..........##............#....[.##............# ##.......... ....Opoisoned)...O.........#...&ki_|..#.........#...##..#....###.........[###.[..#......##...........##&ki }.......@..#..........##............#....[.##............# ##.......... .......O.........#...&kiO8 O&kiw^.  You begin to radiate toxic energy. The ogre is poisoned.&kiɇ` very poisoned)&ki{0-------===60Toxic &ki(&kir1 _The ogre looks even sicker.'ki)  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.'ki3'ki'kij _You can't see any susceptible monsters within range! (Use Z to cast anyway.)(ki38O.(ki(kio/---1(ki(ki 1 _The ogre looks even sicker.(kiF#........##..#...##ludeguy the Toxicologist)......#....#.......#Octopode of Gozag Gold: 535)......#.......##..##Health: 64/64 ========================....#..#...##..##.##Magic: 8/14=============-----------......###......####AC: 3Str: 7.....[###.[..###EV: 14(kimFInt: 20. ......##..<#SH: 5Dex: 16..........###XL:  9 Next: 15% Place: Dungeon:6.......@..#Noise: ---------  Time: 6261.5 (0.0)......*...#(kiFc) +0 dagger (protect)#....*.......Cast: Poisonous Vapours#...*[.##......Toxic ...O..# ##.......... ....O   ogre (very poisoned, weak)(kiG...... ........#...  (kieGConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an ogre, wielding a +0 giant spiked club (moderately wounded, very  (kiG`poisoned, chance to weaken: 88%)  The glob of mercury hits the ogre! The ogre looks weaker.(kikO.  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an ogre, wielding a +0 giant spiked club (moderately wounded, very  poisoned, chance to weaken: 88%)  The glob of mercury hits the ogre! The ogre looks weaker.  The ogre is almost dead.(kiT...(ki Z==2.5 (1Poisonous Vapours(ki(kiV _Your toxic aura wanes.)ki04 #........##..#...##  ludeguy the Toxicologist )......#....#.......#  Octopode of Gozag Gold: 535 )......#.......##..##  Health: 64/64 ========================)ki4 ....#..#...##..##.##  Magic: 7/14============------------ ......###......####  AC: 3Str: 7 .....[###.[..###  EV: 14)ki4Int: 20 . ......##..<#  SH: 5)kiU5Dex: 16 ..........###  XL:  9 Next: 15% Place: Dungeon:6 .......@..#  Noise: ==-------  Time: 6262.5 (0.0) ..........#  c) +0 dagger (protect) )ki}5#............  Cast: Poisonous Vapours #...$[.##...... )ki5) ......# ##....  )ki5...... ....  O   ogre (very poisoned, weak) ...... .... )ki5{ ....#. .. Confirm with . or Enter, or press ? or * to list all spells.)ki6Aiming: Poisonous Vapours (safe; 1% risk of failure)  )ki6Press: ? - help, Dir - move targetAim: an ogre, wielding a +0 giant spiked club (almost dead, very poisoned,  weak)  Poisonous fumes billow around the ogre!)ki>   ..#.......#  )..)ki!?x.....##..##  .....##..##.##  ......###......####  )kiI?.....[###.[..###  )kio?. ......##..<#  )ki?w..........###  ....)ki?x#  ....# )ki?G #.....  )ki@#...$[.##...... )ki#@|......# ##.... ...... .... )kiG@...... .... ....#. .. )kiE]535 20-3.5 (1)ki$FPoisonous VapoursAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an ogre, wielding a +0 giant spiked club (almost dead, very poisoned,  weak)  Poisonous fumes billow around the ogre! _You kill the ogre!)kiJ)kiKh _Your Stealth skill increases to level 6!)ki )ki= V--4 _)kiX )ki *ki)......#....#.......# )......#.......##..## ....#..#...##..## ......###......## .....[###.[..###  ........##..<#  ....### ..#.##..... #...$[.##.............## ##..... ..... ....#. ..#.*ki*ki@-5*kih*kiQ*ki1u ( #........##..#...## )......#....#.......# )......#.......##.....#..#...##..##.......###......####.....[###.[..###..##..<# .*kiu ###.# ...# .#............. #...$[.##.......## ##....*kiu 9. ....*kiu ....... .........#.*kiu  ..*ki9v .....##.*kit~ *ki 78=*kiG 6*ki_ *ki *ki@3 m###..<..####.#####  #........##..#...## )......#....#.......# )......#.......##.....#..#...##..##.......###......####.....[###.[..###..##..<# .###.# ...# *ki3 r.#.............#...$[.##.......## ##..... ........... .........#. ..*ki= *ki*> &7*ki F *kiGH +kiXn #####.# ### ###..<..####.#####  #........##..#...## )......#....#.......# )......#.......##.+kin....#..#...##..##.......###......####.....[###.[..###........##.@<# .##..# +kin....#.#.............+kio#...$[.##.......+ki=om## ##.....+kijo ........... ....+ki&x+kiy&8+ki:~+ki+ki#####.# ### ###..<..####.##### #........##..#...## )......#....#.......# )......#.......##..## ....#..#...##..##.## ......###......#### .....[###.[..### .##..@# .### ...# ....#.#.............#...$[.##.......#....... +ki+kiF&9+ki+ki +ki=[_There is a stone staircase leading up here.+ki +ki] +kiG +ki, +ki O=+kiw +ki +ki' +kiI @535+ki +ki +ki N9==+ki +ki +ki +kiN +ki +kiD +ki +ki +ki6 +ki +ki +ki :==+ki +ki ,+ki +ki +ki +ki] +ki> +ki R10/14==+ki +ki W _You start resting.+ki wll   iguana (wandering)+ki 080.5 (11.0)+ki' +ki ,1.5 (12+ki& +ki) X _You encounter an iguana.,ki?  ###  ,kin###..<..####.#####  #........##..#...##  #....#.......#  )#.......##..##  #...##..##.##  #......#### ,ki .....[###.[..###  #..@# ....l.....### ...........# ...........# .#.....  #...$[,ki'  .......## ,kiA>   ....  ,ki/7 .... ,ki4U  ###  ###..<..####.#####  #........##..#...##  #....#.......#  ),ki>5G#.......##..##  #...##..##.##  #......####  .....[###.[..###  #..@# ....l.....### ...........#,ki5> ........ .#..... #...$[  .......## ,ki52   ,ki6 ,kix=,ki=,kiD,ki8G ,kibGP_An iguana is nearby!,ki  #####.# ### ###..<..####.##### #........##..#...## )......#....#.......# )......#.......##..##,ki5  ....#..#...##..##.## ......###......#### .....[###.[..### .##.@<# ....l.....### ...# ....# .#.......,ki ...... #...$[.##...... .......## ##.... ....... ....  . ....,ki I.l,kim ,ki2 /2.0) ,kim _,ki ,ki -ki]###..<..####.##### #........##..#...##)......#....#.......# )......#.......##..## ....#..#...##..## ......###......## .....[###.[..###  ........##..<#  .........@### .....l..... ...........# .#...... #...$[.##.............## ##.... . .... . .... .....#. ..-kiA.l-ki-ki<?3Poisonous Vapours-ki'-ki-ki%n###..<..####.#####ludeguy the Toxicologist#........##..#...##Octopode of Gozag Gold: 535)......#....#.......#Health: 64/64 ========================-ki&)......#.......##..##Magic: 8/14=============-----------....#..#...##..##.##AC: 3Str: 7......###......####EV: 14Int: 20.....[###.[..###SH: 5Dex: 16........##..<#-ki&YXL:  9 Next: 20% Place: Dungeon:6........*@###Noise: ---------  Time: 6283.5 (0.0)-ki '......l*...#c) +0 dagger (protect)...........#-kiQ'vCast: Poisonous Vapours.#.............#...$[.##.............## ##....-ki'l   iguana (weak)....... ........... .........#...-ki'MConfirm with . or Enter, or press ? or * to list all spells.-ki'Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line-ki (Aim: an iguana (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks weaker.  The iguana is lightly wounded.-kiȩ8l.-ki&..-kiS4==4.5 (1-kiZ-kim  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an iguana (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks weaker.iguana is lightly wounded. _hisses angrily.-ki*gf ###..<..####.#####  ludeguy the Toxicologist #........##..#...##  Octopode of Gozag Gold: 535 -ki ha)......#....#.......#  Health: 64/64 ======================== )......#.......##..##  Magic: 7/14============------------ ....#..#...##..##.##  AC: 3Str: 7 ......###......####  EV: 14Int: 20 .....[###.[..###  SH: 5Dex: 16 ........##..<#  XL:  9 Next: 20% Place: Dungeon:6 ........l@###  Noise: ==-------  Time: 6284.5 (0.0) ...........# c) +0 dagger (protect)-kiuh ...........# Cast: Poisonous Vapours .#.............  #...$[.##...... -kih .......## ##....  l   iguana (weak) ....... ....  ....... ....  -kii.....#. .. Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.-ki;i%Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an iguana (lightly wounded, weak)  Poisonous fumes billow around the iguana!-kiwq ###..<  #........##..#...##  -kiq#....#.......#  )#.......##..##  ...##..##.##  ......###......#### -kirs .....[###  -kiEr........##..<#  ........l@### -kirB ...........# ...........# .#.... #...$[.##... .......## ##....  -kiscpoisoned, weak) ....... ...-ki3sN ....... .... -kics -ki_t3-5.5 (1-ki{-ki~nonfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an iguana (lightly wounded, weak)  -kiR~QPoisonous fumes billow around the iguana! _The iguana is poisoned..kin###..<..####.#####ludeguy the Toxicologist#........##..#...##Octopode of Gozag Gold: 535)......#....#.......#Health: 64/64 ========================)......#.......##..##Magic: 6/14==========--------------....#..#...##..##.##AC: 3Str: 7......###......####EV: 14Int: 20.....[###.[..###SH: 5Dex: 16........##..<#XL:  9 Next: 20% Place: Dungeon:6........l@###Noise: =--------  Time: 6285.5 (0.0)............ki#c) +0 dagger (protect)...........#Cast: Poisonous Vapours.#.............#...$[.##.............## ##....l   iguana (very poisoned, weak)....... ........... .........#...Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an iguana (moderately wounded, poisoned, weak)  Poisonous fumes billow around the iguana!.kit+6.5 (1.ki.kionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an iguana (moderately wounded, poisoned, weak)  .ki]Poisonous fumes billow around the iguana! _The iguana looks even sicker. The iguana completely misses you..ki/ $ _The iguana looks even sicker. The iguana completely misses you.You hit the iguana.  .ki Your weapon exudes an aura of protection.  You grab the iguana.  The iguana is severely wounded.  You constrict the iguana..ki (.ki 535 7==10 27Poisonous Vapours.ki .kiJ J _You kill the iguana!.ki  ###..<..####.##### #........##..#...## )......#....#.......# )......#.......##..## ....#..#...##..##.## ......###......#### .....[###.[..### .##..<# .@.### .# .ki3.# .#.... #...$[.##...... .## ##.... . .... . ....  .....#. ...ki.ki`.-8.kiN.ki/.ki=8-.ki$9.5 (2.ki.kiG> _You now have 538 gold pieces (gained 3)./kiM ###..<..####.##### #..##..#...## )......#....#.......# )......#.......##..## ....#..#...##..##.##/ki  ......###......#### .....[###.[..### .##..<# .### .# .# .#... #...$[.##...... /ki#.## ##.... . .... . ....  .....#./kiM@ ../kib&/ki'? 3 90.5 (1/ki-/ki./kiD###..<..####.##### #..##..#...## )......#....#.......# )......#.......##..## /kiC....#..#...##..##.## ......###......#### .....[###.[..### .##..<# .### .# .# .#...$[.##.......## ##..... ..../kim. .... /ki@/kiɸ$==/ki1/ki\/ki۾/kiD I/kiF /kiG /kiI B/kiJ /kiL /ki M /ki*N /ki Q /kiVQ M8=/ki)R /ki T /kiT /kiU /kiW /kiW /kiY /ki&\ /ki`\ /ki^ /kiY` /ki` 9=/kia /kij ,/kil /kin /ki#o /ki6p /kiKr /kir [5389==/kis /ki#v /kiyv /kix /kiMz ,/kiB{ /kif~ /ki~ /ki /ki /ki3 :==/ki /kig /ki /ki /ki /kiʈ /ki# /ki /ki R10/14==/ki /kip /kiÒ /kik /kiȖ /ki /ki /ki ,/ki& /ki\ /ki :==/ki /ki /ki /kiY /ki7 /ki /kiQ /kit /ki 51=/kiը /ki /ki /kië /kiC /kiǰ ,/ki /ki ,/ki /kiL /ki 9=/ki /ki /kiT /ki) /kim /ki /ki* /ki /kiS L2==/ki= /kia /ki /kij /ki/ ,/ki /kij /ki /kiT /ki /kiz :==/ki /ki# ,/ki /ki- ,/ki7 /ki] /ki L3==/ki /kij /ki /kio /ki /kiL /kip /ki* /kif /ki3 /ki= /ki :==/ki6 /ki /ki% /ki- /ki& /kip /ki" /kit n _You start resting.Magic restored./ki) /ki/ 1336.5 (45.0)/ki Y4==7.5 (46 /ki _/ki /ki 0ki " #........##..#...##)......#....#.......# )......#.......##..##0ki  ....#..#...##..## ......###......## .....[###.[..###  ........##..<#  ....### ..# .# .#..... #...$[.##.............## ##.... . .... 0kiJ . .... .....#. .. ....##.0kim0ki18.5 (1.0)0ki0ki0ki{[)......#....#.......# )......#.......##..## ....#..#...##..## ......###......## .....[###.[..###  ........##..<#  #....####..#.##.....0ki{ #...$[.##..............## ##.... ..... ....#.. ..#... 0ki0kiw&90ki0ki0ki9  )......#.......##..##.....#..#...##..##...###......##[###.[..### #........##..<# 0ki9  #....####..#.#. ..#..... #...$[.##...............## ##...... ...... ....#.... ..#.....#. ......0kiB 0ki3C '400ki,I 0kiXK 0ki\ $.....###..##.## ..###......#### [###.[..### #........##..<#  #...###.# .0ki] . ..#.... #...@[.##...............## ##..# ..#..... ##.....##. ......#[.0kif 0kig C==10kim 0ki _Found a ring mail.  You now have 553 gold pieces (gained 15).0kih 4532.5 (20ki 0kit Z _You see here a +0 giant spiked club.1kicK1kiK1kiM1ki&S1kiYB1ki\1kiVdn......[###.[..### #...<# #....### ##.....# 1kid#............#. ............#...)[.##...............## ##.... .........@# .... 1kid3.5 (1......... .......#.......... 1ki e......##.....##......#. .......#1kie[...#...........## ..... )........#1kim1ki1n+4.5 (21kiq1kis% _Found a dagger.1kiW 1kieX 1kiZ 1ki_ 1kiod 1kid 1kiRh 1kii 1kin 1kinn 1kiw ,1kiY   You encounter an iguana.#....### ##...........# #............#. ..#.............#...#...)[.##................## ##...............####..... ............ .......#...@......# ......##.....##...# ....#.........# ## [...#...........##....... ..)..#....l   iguana (asleep)...........#.......l1ki &61ki، )7.5 (3 1ki' _1kiӓ 1ki 1kik   ##..... #......  ..#....#.  ..#...)[...  .........## ##.....  ..........####.....  ...................  #...@......#  #.....##...#  ....#.........# ##  [...#...........  ##..............  ..)........#....  ................  ......#.......l 2ki˼   ##..... #......  ..#....2kiw#.  ..#...)[...  .........## ##.....  ..........####.....  ...................  2ki%#...@......#  #.....##...#  ....#.........# ##  [...#...........2kiUD ##.............. 2ki}..)........#....  ................2ki6 ......#.......2kiʾ 2ki2ki2ki2kis^ _An iguana is nearby!3ki~ q##. #............#..####..#...#.#..#...)[.##.......#.........## ##....###............#3ki0 .......#....# ......##....@##...# ....#.... ## [...#.. ##.... ..).#.............##.......l#......>..3ki 3ki6 +8.5 (13kiל 3kiS ; _Found a stone staircase leading down.3ki^ I#..#..####..#...#.# ..#...)[.##.......# .........## ##...... .###...... .........# .......#..........# ......##.....##...# ....#.... ## [...#....# ##.....# ..)#.....#........###l# ......>...##..3ki& 3ki &93ki 3kiM 4ki   Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.4ki<44ki%4ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)4kiL{..#...#.# ..#...)[.##.......##.........## ##......#.###......#.........# .#..........# ......##.....##...# ....#......## 4ki%,[...#....# ##... ..)#.........###.......l#........>..........##..o   orc priest (polearm, asleep)  ...o4ki+4ki'504kis4ki$y _You encounter an orc priest. It is wielding a +0 trident.4ki' ..#.............#.#ludeguy the Toxicologist..#...)[.##.......##Octopode of Gozag Gold: 553.........## ##......#Health: 64/64 ========================..........####......#Magic: 12/14 ====================----...................#AC: 3Str: 7.......#..........#EV: 14Int: 20......##.....##...#SH: 5Dex: 16....#.........#..##XL:  9 Next: 22% Place: Dungeon:6[...#.........@...#Noise: ---------  Time: 6350.5 (0.0)##............*...#c) +0 dagger (protect)..).4ki'[m.......#.*...#Cast: Poisonous Vapours..............*.##......#.......l#............>...l   iguana (weak).........##.....o   orc priest (polearm, asleep)...... ...o.  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an iguana (asleep, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks weaker.  The iguana is moderately wounded.4kie l.  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an iguana (asleep, chance to weaken: 100%)  The glob of mercury hits the iguana. The iguana looks weaker.  The iguana is moderately wounded.  4kibKThe iguana hisses angrily. The orc priest shouts! You hear a shout!4ki٫4o.4kiu oYou hear an angry hiss.4ki..o)o   orc (missile, wandering)4kiM==1.5 (1Poisonous Vapours4ki4kiJ  You encounter an orc. It is wielding a +2 whip of pain and quivering _boomerangs.5kiJ ..#.............#.#  ludeguy the Toxicologist  ..#...)[.##.......##  Octopode of Gozag Gold: 553  .........## ##......#  Health: 64/64 ========================  ..........####......#  Magic: 11/14 ==================------  ...................#  AC: 3Str: 7  .......#..........#  EV: 14Int: 20  ......##.....##...#  SH: 5Dex: 16 5kiK ....#.........#..##  XL:  9 Next: 22% Place: Dungeon:6  [...#.........@...#  Noise: ==-------  Time: 6351.5 (0.0)  ##................#  c) +0 dagger (protect) ..)........#.....#  Cast: Poisonous Vapours ..............l.##  ......#........#  ............>...  l   iguana (weak) .........##..o..  o   orc priest (polearm) ...... ...oo  o   orc (missile, wandering)Confirm with . or Enter, or press ? or * to list all spells.5kiLqAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an iguana (moderately wounded, weak)  Poisonous fumes billow around the iguana!  The iguana is poisoned.5kijM7l.5kiHN4o.5kiO.5kiW`   )[....##  ..## ##......#  ...####......#  ............#  #...#  5kiX9#.....##...#  .......#..##  [....#  .....#  ..)........#.l...#  .........## ......#........# ............>o.. poisoned, weak)5kiX0 .........##.....  ...... ...o. o 5ki>Y3-2.5 (15ki`5kii   Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an iguana (moderately wounded, weak)  Poisonous fumes billow around the iguana!  The iguana is poisoned. _You encounter an orc. It is wielding a +0 flail.5kixF ..#.............#.#  ludeguy the Toxicologist  ..#...)[.##.......##  Octopode of Gozag Gold: 553  .........## ##......#  Health: 64/64 ========================  ..........####......#  Magic: 10/14 =================-------  ...................#  AC: 3Str: 7  .......#..........#  EV: 14Int: 20  ......##.....##...#  SH: 5Dex: 16 5kixG  ....#.........#..##  XL:  9 Next: 22% Place: Dungeon:6  [...#.........@...#  Noise: =--------  Time: 6352.5 (0.0)  ##................#  c) +0 dagger (protect) ..)........#.l...#  Cast: Poisonous Vapours ................##  ......#........#  ............>o..  l   iguana (poisoned, weak) .........##..o..  o   orc priest (polearm) ...... .....  o   orcCasting: Poisonous Vapours (safe; 1% risk of failure)  5kiGConfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an iguana (heavily wounded, poisoned, weak)  Poisonous fumes billow around the iguana!5kiHol.o.5ki#R   )[....##  ..## ##......#  ...####......#  ............#  #...#  #.....##...#  5kiR.......#..##  [....#  .....#  5kiS..)........#.....#  .........## ......#.......o# 5ki...  very poisoned, weak) 5kiS.........##..o..  ...... ..... 5kidT+3.5 (15ki\5ki^MConfirm with . or Enter, or press ? or * to list all spells.Aim  5ki!_$Press: ? - help, Dir - move target: an iguana (heavily wounded, poisoned, weak)  Poisonous fumes billow around the iguana! _The iguana looks even sicker.6ki?#..#..#### ..#.............#.# ..#...)[.##.......## # ##......# ####......# .............# .......#..........# ......###...# ....##..##[...#.##....l ..).#.....#..........##..#.......o#..........>....##..o........ .....6kiiC7l.6kicD7o.6ki?E7o.6kio...##.....6kiY3 o.  The orc priest invokes the aid of Beogh against you.6ki3/l.6kiy=`  Beogh smites you!6ki >k51------56kiN6kiP' _You hear a shout!6ki^ ### ##...........# #..#..#### ..#.............#. ..#...)[.##.......## # ##......# ####......# .........# .......#...@......# ......##.....##...#6kic ....#l#..##[...#.##........ ..)#.....#........o.###.......o#...>6kiy3$6kiWeoo6ki o   orc priest (polearm)o   orc  6ki{4You kill the iguana!6ki"6ki6ki553 36Poisonous Vapours6kiƵ6kiIl _The orc priest looks satisfied for a moment.6kis 3##..<# #.....## ##...........# #............#..#### ..#.............#. ..#...)[.##.......## 6kis # ##......# ####......# .........# .......#..........# ......##.....##...# ....#.$###[...###.......o   orc ..)#.....#.o6ki(t D.###.......o#6kikiC #####.# ### ###..<..####.##### #........##..#...## )......#....#.......# )......#.......##..## .....#..#...##..##.## .###......#### ......[###.[..### #.##.@<# #>kiD.o### ##.$..# #....#..#### ..#...oo........#.# ..#...)[.##.## ...## ##......# ..........####......#  .#>kiLro.o.>kiLZoounaware, dazed, >kiME----5>kiXU>ki XP _The orc priest is distracted by your dazzling golden aura.>kil $You catch the helpless orc priest completely off-guard!  You impale the orc priest!!  Your weapon exudes an aura of protection.>ki :o.>ki 7o.>kin ~oo 2 orcs (1 missile)>ki 10 5----6>ki >kil N _You kill the orc priest!?ki #####.# ###  ludeguy the Toxicologist ###..<..####.#####  Octopode of Gozag Gold: 553  #........##..#...##  Health: 57/64 =====================--- )......#....#.......#  Magic: 6/14==========-------------- ?ki)......#.......##..##  AC: 10  Str: 7  .....#..#...##..##.##  EV: 14Int: 20  .......###......####  SH: 5Dex: 16  ......[###.[..###  XL:  9 Next: 25% Place: Dungeon:6  #........##.@<# Noise: ---------  Time: 6376.5 (0.0) #.........o### c) +0 dagger (protect)  ##.......o$..# Cast: Poisonous Vapours ?kiG #............#..####  ..#.............#.#  ..#...)[.##.......##  oo 2 orcs (1 missile)  .........## ##......#  ..........####......#  ...................# _You kill the orc priest!Casting: Poisonous Vapours (safe; 1% risk of failure)  ?kiZ]Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +2 whip of pain and quivering boomerangs?kif7o.?kiU  ###  ###..<..####.#####  #........##..#...##  #....#.......#  )?kig#.......##..##  #...##..##.##  #  [###.[..###  #.@<# #........oo###  ##........$..#  #........ ..#........ ..#...)[.## ?kio, 1 poisoned)  .........##   .........  ?ki3=7.5 (1?ki ?kiW  Casting: Poisonous Vapours (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an orc, wielding a +2 whip of pain and quivering boomerangs _Poisonous fumes billow around the orc! The orc is poisoned.@ki #####.# ###  ludeguy the Toxicologist ###..<..####.#####  Octopode of Gozag Gold: 553  #........##..#...##  Health: 57/64 =====================--- )......#....#.......#  Magic: 5/14========---------------- )......#.......##..##  AC: 10  Str: 7  .....#..#...##..##.##  EV: 14Int: 20  .......###......####  SH: 5Dex: 16  ......[###.[..###  XL:  9 Next: 25% Place: Dungeon:6  #........##o@<# Noise: =--------  Time: 6377.5 (0.0) #.........o### c) [@ki;0;10;1m+0 dagger (protect)  ##........$..# Cast: Poisonous Vapours  #............#..####  ..#.............#.#  ..#...)[.##.......##  oo 2 orcs (1 missile, 1 poisoned)  .........## ##......#  ..........####......#  ...................# Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +2 whip of pain and quivering boomerangs (lightly  wounded, poisoned)  Poisonous fumes billow around the orc! The orc looks even sicker.  ###  ###..<..####.#####  #........##..#...##  #....#.......#  )#.......##..##  #...##..##.##  #  @kim[###.[..###  #o@<# #.........o###  ##........$..#  #........ ..#........ ..#...)[.##  very poisoned)  .........##   .........  2-- 3 8.5 (1@ki"@kiY@kiz@ki@Aiming: Poisonous Vapours (safe; 1% risk of failure)  @kiLPress: ? - help, Dir - move target  @ki pAim: an orc, wielding a +2 whip of pain and quivering boomerangs (lightly  @kiE wounded, poisoned)  @ki oPoisonous fumes billow around the orc! The orc looks even sicker. _The orc hits you with a +2 whip of pain@ki  .@kig $You hit the orc.  Your weapon exudes an aura of protection.@ki oo   orc (unaware, dazed)You kill the orc!@ki6==10 9@ki@ki[I _The orc is distracted by your dazzling golden aura.@ki0 |oo   _The orc is distracted by your dazzling golden aura.  You hit the orc. The orc snaps out of its daze.  The orc shouts! grab the orc.  The orc is moderately wounded.  You constrict the orc.@ki1 M====80.4 (0.9@ki8 @ki; * _You hear a shout! x2@ki* j $You puncture the orc!@kiv jYou kill the orc!@ki[ j   gnoll@ki 3--6=---1.4 (1.0Poisonous Vapours@ki @ki q _You encounter a gnoll. It is wielding a +0 flail.Aki%e###..<..####.##### #........##..#...##)......#....#.......# )......#.......##..##.....#..#...##..## .......###......## ......[###.[..###  #........##$.<#  #.........@####.. ....#..#### ..#......#Akien.# ..#...)[.##.......##.......## ##......# .....j....####......# .................. #Akich;j.Aki4i2jAkirqj 2 gnolls (1 polearm)AkirQ----2AkiyAkil _You encounter a gnoll. It is wielding a +0 halberd.Aki _Items here: $ ( )).Aki! ###..<..####.##### #........##..#...## )......#....#.......# )......#.......##..## .....#..#...##..##.## .......###......#### ......[###.[..### #.##$.<# #$### ##AkiL.$..# #.#..#### ..#....#.# ..#...)[.##.......## ......j..## ##......# ..####......# ....j..............#  .#.#Aki;j.Aki{:j.AkiAkid==-3 _AkiAkimAkiS........##..#...##)......#....#.......).....##..#.....###..##.## ...###......#### [###.[..### #........##$.<#  #..$####..# .AkijT...#..#### ..#....#.j[.##......##.........## ##......j....####...........##.###....o##AkiHW:j)AkiX:j.Aki:bAkibm4=4Poisonous VapoursAkiTjAkik$  Things that are here:AkimO _5 gold pieces; a +0 flailBki#........##..#...##ludeguy the Toxicologist)......#....#.......#Octopode of Gozag Gold: 553 )......#.......##..##Health: 54/64 ====================----.....#..#...##..##.##BkisMagic: 4/14======------------------.......###......####AC: 10  Str: 7......[###.[..###EV: 14Int: 20#........##$.<#SH: 5Dex: 16#.........$###XL:  9 Next: 26% Place: Dungeon:6##........@..#Noise: ---------  Time: 6384.4 (0.0)#........*...#..####c) +0 dagger (protect)Bki)[..#....j........#.#Cast: Poisonous Vapours..#...)[.##.......##......j..## ##......#..........####......#BkipMjj 2 gnolls (1 polearm, 1 weak)...................#.......#..........#......##....o##...#BkiCasting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a gnoll, wielding a +0 flail (chance to weaken: 100%)  The glob of mercury hits the gnoll. The gnoll looks weaker.Bki^}uj.j.BkiՇBkiG 3 ==5.4 (1BkiBkiǑonfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a gnoll, wielding a +0 flail (chance to weaken: 100%)  The glob of mercury hits the gnoll. The gnoll looks weaker. _The gnoll is heavily wounded.BkiF *#........##..#...##ludeguy the Toxicologist)......#....#.......#Octopode of Gozag Gold: 553 )......#.......##..##Health: 54/64 ====================----.....#..#...##..##.##Magic: 3/14=====-------------------.......###......####AC: 3Str: 7......[###.[..###EV: 14Int: 20#........##$.<#SH: 5Dex: 16#.........$###XL:  9 Next: 26% Place: Dungeon:6##........@..#Bki Noise: ==-------  Time: 6385.4 (0.0)#........j...#..####c) +0 dagger (protect)..#.............#.#Cast: Poisonous Vapours..#...j[.##.......##.........## ##......#..........####......#jj 2 gnolls (1 polearm, 1 unaware, 1 daz…)...................#.......#..........#......##....o##...#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 flail (heavily wounded, weak)  Poisonous fumes billow around the gnoll!  The gnoll is poisoned. The gnoll misses you.Bki i4=-6.4 (1Bki Bki   Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 flail (heavily wounded, weak)  Poisonous fumes billow around the gnoll!  Bki The gnoll is poisoned. The gnoll misses you. _distracted by your dazzling golden aura.Cki $You hit the gnoll.  Your weapon exudes an aura of protection.CkiU j)  You kill the gnoll!Cki ' CkiLMjThe gnoll is no longer dazed.CkilEwandering)Ckio=10 -7CkiCkip _You encounter a gnoll. It is wielding a +0 club.Dki #........##..#...##ludeguy the Toxicologist)......#....#.......#Octopode of Gozag Gold: 553 )......#.......##..##Dki6 {Health: 54/64 ====================----.....#..#...##..##.##Magic: 2/14===---------------------.......###......####AC: 10  Str: 7......[###.[..###EV: 14Int: 20#........##$.<#SH: 5Dex: 16#.........$###XL:  9 Next: 26% Place: Dungeon:6##........@..#Noise: =--------  Time: 6387.4 (0.0)#........*...#..####c) +0 dagger (protect)Dki- 1..#....j........#.#Cast: Poisonous Vapours..#...)[.##.......##.........## ##......#..........####......#jj 2 gnolls (1 polearm, 1 wandering, 1 w…)...................#...j...#..........#......##....o##...#Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineDkiY Aim: a gnoll, wielding a +0 halberd (chance to weaken: 100%)  The glob of mercury hits the gnoll! The gnoll looks weaker.Dki9 Dki! $Dki" unaware, 1 dazDki^# ;Aiming: Mercury ArrowDki.$ !  Dki$ TPress: ? - help, Shift-Dir - straight lineDki\% L: a gnoll, wielding a +0 halberd (chance to Dki& weaken: 100%)  Dki& BThe glob of mercury hits the gnoll! The gnoll looks weaker.  DkiT' The gnoll is severely wounded.noll is distracted by your dazzling golden auraDki"( .Dki) Dkix* 5Dki* =Dki{+ 8.4 (1Dki: Dki> < _The gnoll hits you but does no damage.Eki<#........##..#...##ludeguy the Toxicologist)......#....#.......#Octopode of Gozag Gold: 553 )......#.......##..##Health: 55/64 ====================----.....#..#...##..##.##Eki=>Magic: 1/14=-----------------------.......###......####AC: 10  Str: 7......[###.[..###EV: 14Int: 20#........##$.<#SH: 5Dex: 16#.........$###XL:  9 Next: 26% Place: Dungeon:6##........@..#Noise: ==-------  Time: 6388.4 (0.0)#........$...#..####c) +0 dagger (protect)..#....j........#.#Cast: Poisonous VapoursEki>..#...)[.##.......##.........## ##......#..........####......#jj 2 gnolls (1 polearm, 1 unaware, 1 daz…)...................#...j...#..........#......##....o##...#Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a gnoll, wielding a +0 halberd (severely wounded, weak)  Poisonous fumes billow around the gnoll!Eki?F 3 -9.4 (1Eki[GEki.Ionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 halberd (severely wounded, weak)  Poisonous fumes billow around the gnoll! _The gnoll is poisoned. You block the gnoll's attack.Ekiz ) #........##..#...##  ludeguy the Toxicologist )......#....#.......#  Octopode of Gozag Gold: 553  )......#.......##..##  Health: 55/64 ====================---- .....#..#...##..##.##  Magic: 0/14------------------------ .......###......####  AC: 3Str: 7 ......[###.[..###  EV: 14Int: 20EkiK " #........##$.<#  SH: 5Dex: 16 #.........$###  XL:  9 Next: 26% Place: Dungeon:6 ##........@..#  Noise: =--------  Time: 6389.4 (0.0) #........$...#..####  c) +0 dagger (protect) ..#....$........#.#  Cast: Poisonous Vapours ..#...)[.##.......##  Eki =.........## ##......#  ..........####......#  jj 2 gnolls (1 polearm, 1 unaware, 1 daz…) ...................#  ...j...#..........#  Eki ......##....o##...# Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetEkiK Aim: a gnoll, wielding a +0 halberd (almost dead, poisoned, weak)  Poisonous fumes billow around the gnoll!EkiR    ..#.......#  )..Ekiɿ v.....##..##  ......##..##.##  .......###......####  ......[###.[..###  #........##$.<#  #.........$###  ##.....#  #......#  ..#......#.#  ..#...)[.##...... .........## ##.... ..........####......# j   gnoll (unaware, dazed)Eki  ............ ...j...#...Eki\ " Eki o790.4 (1Poisonous VapoursEki Eki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a gnoll, wielding a +0 halberd (almost dead, poisoned, weak)  Eki oPoisonous fumes billow around the gnoll! _You kill the gnoll!Fkico###..<..####.#####  #........##..#...## )......#....#.......# )......#.......##......#..#...##..##........###......####......[###.[..####..##$.<# .##### #....#..#### Fki#p}..#....$........#.##...)[.##.......##.## ##......#..####...........................j...#..........#FkiazFkiy{\6=-1FkiȂFkiR  You now have 562 gold pieces (gained 9).  m - 4 boomerangs (gained 2)  Things that are here:Fki<b62-2.4 (2Fki^FkiݜU _a +2 whip of pain; a +0 tridentFkix- #####.# ### ###..<..####.#####  #........##..#...## )......#....#.......# )......#.......##.Fki......#..#...##..##........###......####......[###.[..####........##$@<# .)###.# #.....#..####..#....$........#.##...)[.##.......##.## ##......#..####..............Fki7Fki7W1=3.4 (1Fki>Fki@FkiX% .#####.# ### ###..<..####.##### #........##..#...## )......#....#.......# Fki=& )......#.......##..## .....#..#...##..##.## .###......#### ......[###.[..### #.##$.@# #.)### ##.$..# #.$....#....$.....#...)[.##Fki' ...#......... Fki0 Fki1 ^7=4Fki6 Fki: a _There is a stone staircase leading up here.Gki _Gki_GkieGkiOgM _You can't go down here!Gki Gki Gki Gki Gki; -5 _Gki Gki B=5Gki .≈≈.###.# .≈≈.##. #≈≈.##.# #≈≈.## ##.# #≈≈..# #.## #≈≈..# ##.# ≈≈≈..# #..# ≈≈≈..# ####.#### Gki .....# ###@......## .....## ###..........#### ......## ###<...........#∩.♣# .......# #..............#...# .......# #..............#♣..# .......# #..................# ......## #.....<............# ......# #............).....# ......# #.....##Gkiy-6.9 (2.5Gkis$Gki%! _You climb upwards.Gki'c _There is a stone staircase leading down here.HkiJHkiJHkipKHkiLHkiNQ8HkiSOHkiOHki}PHkiPHki+QHkiRHkiHRJ2==HkiRHkiSHki4TK9=HkiTHkiUHkiUHkiYVHkiWHkibWHkiWHkiXHkiX$60HkiYE===HkiYHki,]Hki]Hki ^Hki^Hki_Hki_HkiJaHkia_13==Hki2bHkicHki_c*562HkicHkidHkidHkiLeHkifHkiyfHki gHkigHkih52=HkiVh3==HkihHkiiHkiiHkiIjHki*kHkibkHkikHkilHkimk3=4=HkiCmHkimHkinHkinHki?oHkipHki7pHkipHkier% HkirF_You start resting.HP restored.Hki+vHkiXy0410.0)HkiyX4=7.9 (21 HkiXz _Hki2}Hki~IkiIki#IkiIkiIki {=IkiIkiNIkiIkiIkiIki5=5Iki1==IkiIki}IkiIkiIki>IkiIkiIki,Iki,Iki Ikid:==IkiIkiIkiIkiIki*IkibIkiIkiIkiIkifIki*IkifT6==IkiIkiIki%IkiIkiIkiIkiNIki+IkiIkiIkiIki`:==IkiIkisIkiIkitIkiYIkiIkiIkiIki<T7==IkiIkiIkiIki3IkiIki,IkiIki~IkiIki9Iki;Iki:==IkiIkiIkiIkiIkioIkiIkiIkiIki M8=IkiIkiA,IkiIkiIkiIki Iki,Iki6Iki IkiE9=IkiIki} Iki Iki Iki Iki IkiIkiz9==Ikiz,IkiIkiIki@IkiIkiJ,Iki IkiIki:==IkiIkik,Iki+IkiIki Iki Iki!Iki!R10/14==IkiL"Iki #Ikif#Iki#Iki$Iki$Iki4%Iki&Iki'Iki'IkiR(Iki(:==Iki)Iki)Iki*Iki*Iki+Iki+Iki7,IkiS-Iki-K1=Iki).Iki.Iki4/Iki/Iki0Iki0Iki61Iki2Iki2Iki3Ikiq5Iki59=Iki6Ikiu8Iki8Iki9IkiS;Iki;Iki<Iki`=Iki=Iki=E2==Iki8>Iki?Iki7?Iki?Iki@IkiAIkiAIki{BIkiBIki!CIkiCIki%D$==IkiKDIkiDIkiEIkiFIkiFIkiGIkiHIkiHIkiIIkiIIkiJJIkiKIkiHKIkijKE3==Iki&LIkiMIki NIkiNIkiOIkiOIkiPIkiQIkiQIkidRIki8SIkiwS:==IkiTIkiTIki'UIkiUIkiVIkiVIki9WIkiXn _You start resting.Magic restored.Iki^IkiKb-85.9 (68Ikib64==Ikic,6.9 (69 _IkieIkifIkilIki6IkiyIkiIkiгnIkiMIkiIkiIki۵Iki$==IkiAIkiöIkiIkiIkiFIkiIkiEIkiIkiIkiʺIkiTIkiIkiQIki=IkiIkiAIkiLIkiIkiIkiHIki%IkiWIkiIkiBIkinIkiaIkiIki)IkiIkiIkiIkizIkitIkiIki,IkiTIkiIkiIkiIIkiIki8Iki9IkiiIkiIkiIki.IkiIki\IkiIkiIkiIki1IkiIkikIkiIki'IkiIki&IkiIkixIkiIkiIkiwIkiIkiIIkiIkiIkiIkivIkiIkiIkiIkiLIki IkiIki6IkiIki^IkiIkiIkiQIkiIkiIkiIkiIkiIkiIkiPIki/IkiIki&IkiZIkiIkiIkiIki&IkigIkinIkiIki"IkiIkiIkiIki+IkiIki3IkiIki Iki,Iki,IkiCIkiIkieIkiIki Iki{ Iki Iki IkiC IkiIkiIkiIkiwIkiIki?IkiIkitIkiIkiIkiEIkiIkilIkiIki?IkiDIkiIkiIkiIkiIki Iki IkiC"Iki"Iki|#Iki$IkiB%IkiX&Iki(Ikis(IkiO)Iki+,Iki1,Iki-IkiU.Iki /Iki0Iki0Iki02Iki33Iki3Iki3Iki4Iki25Ikiz5IkiO6Iki6Iki6Iki7Iki,8Ikiu8IkiA9Iki9Iki9Iki:Iki;IkiZ;IkiQ<Iki<Iki<Iki>Ikik>IkiK?Iki@Iki@AIkiBIkiCIkiDIkiwDIkipEIkiEIkiFIkiGIkibGIkiGIki}HIkiHIkiIIkiIIki`JIkiJIkiKIkiKIki9LIkiMIkiNIkiNIkiOIki(PIkilPIkiWQIkiQIkiRIki&SIkiSIkiTIkiVIkiVIkiFWIkiJX,IkiXIkiYIki)ZIkiuZIkiV[Iki[Iki[Iki\IkiU]Iki]Iki^Iki^Iki_Iki`Iki`IkiaIkipcIkicIkidIki9f,IkihBIkijiIki7jIkijIkikIkim,IkimIkinIkinIki@oIki:p,IkipIkiqIki]r,Iki4sIki|sIki tIkit,IkibuIki6wIkiwIkipIkib,IkiIki!,IkiIkiYIkiIkiIkiG,IkiTIkiBIkiIkioIki3W _You start waiting.Iki-585.9 (9Iki-6.9 (100.0)IkiIki՟# _Done waiting.Iki: Iki Iki IkiM Ikie 17.0)Ikiʎ IkiW&6Iki;^X #####.# ###  ###..<..####.### #........##..#...##  )......#....#.......#  )......#.......##..##  .....#..#...##..##.##  .......###......####  ......[###.[..###  #........##$.@#  #.........)### Iki^ ##........$..#  #........$...#..####  ..#....$........#.#  ..#...)[.##.......##  .........## ##......#  ..........####......#  .......#Iki-9.4 (2.5IkiIkiL# _You climb downwards.Ikia _There is a stone staircase leading up here.Jki JkiJkilJkiiJki!JkiL"$ _Jki7&Jki&Jki,Jki-Jki.Jki6M  You now have 570 gold pieces (gained 8).Jki7&70Jki39Jki << _You see here a +0 club.Jkip?Jki?JkiAJkiJEJkiJJki%KJkiOMJkiTr  You now have 575 gold pieces (gained 5).5JkiZXJki\= _You see here a +0 flail.Jkic3JkiKeJki\ms  You now have 582 gold pieces (gained 7).82Jki(pJki~= _You see here a +0 flail.Jki]JkiHJkiiJki M  You now have 588 gold pieces (gained 6).Jkiu%8JkiJki? _You see here a +0 halberd.Jkicg  A gnoll comes into view.Jki'.....#..#...##..##.## .......###......#### ......[###.[..# #........##).<#  #.........)###  ##........)..#  #........)...#..#### ..#....)........#.# ..#...)@.##.......## ...## ##......# ..........####......# ...................# .......#.....Jki.....# ......##.....##...#j   gnoll (wandering) ....#........$#..## [...#.........j...# ##.....#Jki199.4 (10.0).JkiPjJki<.600.4 (11Jki9Jki+ _The gnoll leaves your sight.Jkiw _You see here a +0 leather armour.Kki3KkiHKki;Kki Kki$ _KkiKkiKkig  A gnoll comes into view.Kki......[###.[..### #.##).<# #.........)### #.)..# #..)...#..####..#....)........#.#..#...)[.##................## ##..............@#### ..........# .#..........# ......##.....##j..#....#........$#j.##[...#.............# j   gnoll (wandering)##.......... ..)..#.....# .Kki#KkiY1.4 (1.0)j.Kki&Kki22.4 (2 _KkiKkiKkiC [###.[..###  #........##).<#  #.........)###  ##........)..#  #........)  ..#....)  ..#...)[  .........##   .........@#  ...................#  .......#.......j..#  ......##.....##...#  ....#........$#j.##  [...#.............#  ##................#  ..)........#.....#   Kki [###.[..###  #........##).<#  #.........)###  ##........)..#  #........)  ..#....)  ..#...)[  .........##   .........@#  ...................#  .......#.......j..#  ......##.....##.. Kki....#........$# [...#.............#  ##.............. ..)........#.. KkioKkiKkiTKki\ _A gnoll is nearby!LkiT  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.LkijLkikLkiNtLkiw _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Lkix /#..##).<# ....)### ##........)..# #........)...#..####..#....)........#.# ..#...)[.##.#.........## ##......# ..####......# .........# .#j..# LkiIy ......##.....##...# ....#........$#j.##[...#.......###....l   iguana (wandering) ..).#j   gnoll (wandering)........l.......####Lki| 4l.Lki} 7j.Lki Lki +3.4 (1Lki Lkiҕ X _You encounter an iguana.Lki;  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Mki4MkiMki۟ Mki_You can't see any susceptible monsters within range! (Use Z to cast anyway.)Mki##.##).<# #.........)### ##........)..# #........)...#..#### ..#....).#.# ..#...)[.##.......## .## ##......# .####......# .j...# Mki).#.# ......##.....##...# ....#..$#j.##[...#....###....# ..)....l...#.....# . Mki6l.Mki`6j.MkiMki-4 _Mki MkiMkiA #........##).<#ludeguy the Toxicologist#.........)###Octopode of Gozag Gold: 588##........)..#Health: 64/64 ========================#........)...#..####MkiG kMagic: 12/14 ====================----..#....)........#.#AC: 3Str: 7..#...)[.##.......##EV: 14Int: 20.........## ##......#SH: 5Dex: 16..........####*j....#XL:  9 Next: 27% Place: Dungeon:6...........@**.....#Noise: ---------  Time: 6604.4 (0.0).......#..........#c) +0 dagger (protect)......##.....##...#Cast: Poisonous Vapours....#........$#j.##Mki e[...#.............###........l.......#l   iguana (wandering)..)........#.....#j   gnoll (weak)................##......#........#Mki }Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a gnoll, wielding a +0 club (wandering, hasn't noticed you, chance to  weaken: 100%)  The glob of mercury hits the gnoll! The gnoll looks weaker.  Mki1 HThe gnoll is severely wounded.Mkip} ll.j.MkiY &..Mkiw N===5.4 (1Poisonous VapoursMki Mkia   Press: ? - help, Shift-Dir - straight line  Aim: a gnoll, wielding a +0 club (wandering, hasn't noticed you, chance to  weaken: 100%)  The glob of mercury hits the gnoll! The gnoll looks weaker.  The gnoll is severely wounded. _The gnoll shouts!MkiK #.##).<# #.)### ##........)..# #........)...#..#### ..#....).#.# ..#...)[.##.......## ..## ##......# .####j.....# .# .#.MkiP!#......##.....##...# ....#.[...#.l.....###.....# ..).#.....# .....## Mki#5l.Mki$U.jMki.Mki/0---6Mkip7Mkij9Nki #........##).<# ludeguy the Toxicologist #.........)### Octopode of Gozag Gold: 588  ##........)..# Health: 64/64 ========================  #........)...#..####  Magic: 10/14 =================------- ..#....)........#.#  AC: 3Str: 7 ..#...)[.##.......##  EV: 14Int: 20 NkiԜ .........## ##......#  SH: 5Dex: 16  ..........####......#  XL:  9 Next: 27% Place: Dungeon:6  ............@$.....#  Noise: ---------  Time: 6606.4 (0.0)  .......#..........##  c) +0 dagger (protect)  ......##.....##...#  Cast: Poisonous Vapours  ....#.......l$#j.##  [...#.............#  ##................#  l   iguana (wandering) ..)........#.....#  j   gnoll (weak) ................##  ......#........# Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a gnoll, wielding a +0 club (ki1mseverely wounded, weak, chance to weaken:  100%)  The glob of mercury hits the gnoll! The gnoll looks even weaker.Nki% ).<# )###  )..#  )Nki#  )#.#  ..#...)[..##  .........## ##......# Nki X ...........#  ..........#  .......#.##  Nkiy#.#  ....#...##  [...#....# ##................#  Nki..)........#..... ............ Nki'@.lNki0Nki4U588 ==7.4 (1NkiC=Nki?MAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineNki]@,: a gnoll, wielding a +0 club (severely wounded, weak, chance to weaken:  100%)  The glob of mercury hits the gnoll! The gnoll looks even weaker. _You kill the gnoll!Nkid #........##).<# ludeguy the Toxicologist #.........)###NkiTe Octopode of Gozag Gold: 588  ##........)..# Health: 64/64 ========================  #........)...#..####  Magic: 9/14===============--------- ..#....)........#.#  AC: 3Str: 7 NkieM..#...)[.##.......##  EV: 14Int: 20  .........## ##......#  SH: 5Dex: 16 Nki$f7 ..........####......#  XL:  9 Next: 27% Place: Dungeon:6  ............@$.....#  Noise: ==-------  Time: 6607.4 (0.0)  .......#..........##  c) +0 dagger (protect)  ......##....l##...#  Cast: Poisonous Vapours  ....#........$#j.##  [...#.............#  Nkif##................#  l   iguana (wandering) ..)........#.....#  ................##  ......#........# Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  NkifPress: ? - help, Dir - move targetAim: an iguana (wandering, hasn't noticed you)  Poisonous fumes billow around the iguana!  The iguana is poisoned.Nkiq ).<# )###  )..#  )Nkir#  )#.#  ..#...)[...##  .........## ##......#  ..........####......#  ............#  .......#...##  #....l##...#  ....#.....##  [...#.............# ##................# lNkiKspoisoned) ..)........#..... ............Nkis Nkiv+8.4 (1Nki|Nki~g  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an iguana (wandering, hasn't noticed you)  Poisonous fumes billow around the iguana!  Nki?The iguana is poisoned. _hisses angrily.Nkif #........##).<# ludeguy the Toxicologist #.........)### Octopode of Gozag Gold: 588  ##........)..# Health: 64/64 ========================  #........)...#..####  Magic: 8/14=============-----------Nki* ..#....)........#.#  AC: 3Str: 7 ..#...)[.##.......##  EV: 14Int: 20  .........## ##......#  SH: 5Dex: 16  ..........####......#  XL:  9 Next: 27% Place: Dungeon:6  ............@$.....#  Noise: ==-------  Time: 6608.4 (0.0)  .......#....l.....##  c) +0 dagger (protect) Nkiq ......##.....##...#  Cast: Poisonous Vapours  ....#........$#j.##  [...#.............#  ##................#  l   iguana (poisoned) ..)........#.....#  ................##  ......#........# NkiCasting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetNkiPxAim: an iguana (lightly wounded, poisoned)  Poisonous fumes billow around the iguana!Nki ).<# )###  )..#  )#  )#.#  ..#...)[...##  .........## ##......#  ..........####......#  ............# Nkig .......#...##  #.....##...#  ....#.....##  [...#.............# ##................#  very poisoned) Nki..)........#..... ............ Nki3-9.4 (1NkiCNkironfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an iguana (lightly wounded, poisoned)  NkidZPoisonous fumes billow around the iguana! _The iguana looks even sicker.Oki^K $You puncture the iguana!  Your weapon exudes an aura of protection.  You grab the iguana. You squeeze the iguana.OkiX)Oki\}10 9-10Oki'];Poisonous VapoursOkieOkihJ _You kill the iguana!Oki  #..)###)..# ........)...#..#### ..#....)........#...)[.##.......##.........## ##........####....$.....# Oki..#....@.....##.##.....##...# #........$#j.#....#....#.............#....................>...OkiOkihV9==-Oki 1OkiOki595 3 -2.4 (2OkiOki> _You now have 595 gold pieces (gained 7).Oki #..##).<# .)####.....#### #........)...#..#### ..#....)........#.# #...)[.##.......## ...## ##......# .####.......... .......#..........#......##.....##...# ....#.$#..##[...#Oki: .....###..........#..).#.....#..........##......#.#Oki> Oki +3.4 (1Oki Okir  You now have 601 gold pieces (gained 6).6014.4 (2Oki. Oki - _You see here a +0 club.PkiZb3PkiOePkijPkin:==PkioPkix,PkixPki~Pki~PkiPkiPkiWR10/14==PkiPki,PkiPkiPkiPkiPkiCPkiɠPkiPkiPkie:==PkiȫPkiŰPkiPkiqPki-PkitPkiPkiPkiK1=PkiPkiwPkiPkiPkic,PkiPki,PkiPkiPki9=PkiPki,PkiPki 2==PkiPki,Pkig Pki@ ,Pki Pkiu ,Pkii Pki Pki] :==Pki Pki{ Pki Pkim Pki ,Pki Pki L3==Pki Pki1 Pkih! ,Pki" Pki% Pki% Pki( PkiQ- Pki- Pki/ PkiQ4 Pki4 :==PkiU7 Pki; Pki< PkiU> PkiJ ,Pki!N PkiHS ,PkiV PkiHZ n _You start resting.Magic restored.Pki&g Pkip 046.4 (32.0)Pkiq b4==7.4 (33 _Pkiy Pki;| Pki Pki̓ Pki Pki Pki Pki_ Pkih Pki Pki Pki2 Pkiϭ Pkiٰ Pki$ Pkih Pki PkiQ Pki %8Pkiͻ 3==Pkiܽ Pki0 M _You now have 608 gold pieces (gained 7).Pki Pki Pki PkiZ Pki Pki7 Pki Pki- Pki+ PkiV Pki Pki Pkix Pki PkiX Pki, Pki Pki Pki Pkis Pki ,Pki Pki Pki Pki Pki Pki Pki? Pki Pki Pki PkiD Pkip Pki Pki Pki ,Pki PkiX Pki Pki Pki Pki Pki ,Pki Pki Pki ,Pki Pki Pki Pki Pki Pki Pki Pki* PkiB Pki Pki^ Pki Pki? Pki Pki! ,Pki_" Pki'$ Pki% Pki& Pkip& Pki^' Pki* ,Pki+ Pki?- Pki/ Pki/ Pkif0 Pki91 Pkiz3 Pki3 Pki?4 Pkib6 Pki8 Pki9 Pki9 Pki; Pki> Pki? Pki_? Pki@ Pki_C ,PkiD PkiF PkiI PkiI PkiJ PkiM Pki#P PkiXP PkigQ PkiiS PkiV i  You encounter an ufetubus.Pki[  ............#........# ......................##Pki[  .............###......# .........###..##......#Pki \  .........##..........# PkiA\ #.......#.......##### ##..........######Pkic\  #..........##  Pki\ #..$..@..###  Pki\ u.5#.#  Pki\ .$......###  .......##Pki\ = ...# Pki] 6.. #### PkiF] 5   ufetubus (wandering) . Pki] Pki^ ,70Pki5_ 65.PkiKc Pkic 38.4 (31 _Pki9g Pkih Qki . ........... .............###.  .........###..##.  .........##.....  #.......#....  QkiO##..........######  #..........##  #5.$..@..###  ........#.#  Qkiq>.$......###  .......## Qki0...#... .. #### Qki".QkiϮQkiHD . ........... .............###.  QkiDn.........###..##.  .........##.....  #.......#....  QkiD##..........######  #..........## QkiD #5.$..@..###  QkiE........#.#  .$......###  .......##QkiCEn ...#... .. ####QkiE! . QkiKQkiLQkiRQkiT` _An ufetubus is nearby!QkiRQkifW7  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 3.9   4.8  -1      QkiW     b - Polearms   0.0   1.0   0   k + Conjurations 3.8   4.0   0   c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1  Qki1XW d - Throwing   0.0   1.0   0   m + Fire Magic1.3   2.0   0      n + Air Magic2.6   3.0   0   e + Short Blades   0.8   0.5   0 +4     f - Long Blades   0.3   1.0   0   o - Evocations   0.0   0.8  +1      QkicX# p - Shapeshifting   0.0   1.2  -1  g + Dodging4.2   5.0   0       h - Shields   0.0   1.0   0      QkiXi + Stealth6.0   3.5  +4          QkiX!            QkiX        Qki!Ym                Skills enhanced by cross-training are in green. Bonus from skill manuals is in  red.  [?] HelpQkiCY [=] set a skill target  [/] auto|manual mode [*] useful|all skills [_] enhanced|base level  QkidY[!] training|cost|targetsRkiXRki^Rkie............#........# ludeguy the Toxicologist......................## Octopode of Gozag Gold: 608.............###......# Health: 64/64 ========================.........###..##......# Magic: 14/14 ========================.........##..........# AC: 3Str: 7#.......#.......##### EV: 14Int: 20##..........######SH: 5Dex: 16#..........##XL:  9 Next: 29% Place: Dungeon:6#5.$..@..###Noise: ---------  Time: 6678.4 (0.0)........#.#c) kie10;1m+0 dagger (protect).$......###Cast: Poisonous Vapours.......##...#..... ####5   ufetubus (wandering). _You see here a +0 club. _You start resting. _Magic restored. _You now have 608 gold pieces (gained 7). _You encounter an ufetubus. RkifS_An ufetubus is nearby!RkikRkikRkiwpRkiqRki|  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.RkiRkiLRki Rki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Rkiz Rki Rki7 Rki! F _Unknown command.Rki9  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Rki4RkiRkiV _You can't see any susceptible monsters within range! (Use Z to cast anyway.)SkiT .#.........................###......# .###..##......# .##..........# #.#.......##### ##...###### #....## #5.$.@...###.#.#.$......###.##Skis.#...#.######.#.>SkiF85.SkiһSki5+9.4 (1Ski^Poisonous VapoursSkiSki; _Found a stone staircase leading down.Ski  ............#........ ludeguy the Toxicologist .......................# Octopode of Gozag Gold: 608 ..............###......# Health: 64/64 ======================== .........###..##......# Magic: 12/14 ====================----SkiN p .........##..........# AC: 3Str: 7 #.......#.......##### EV: 14Int: 20 ##..........######  SH: 5Dex: 16 #.$........##  XL:  9 Next: 29% Place: Dungeon:6 #..$.@...###  Noise: ---------  Time: 6679.4 (0.0) .........#.#  c) +0 dagger (protect) Ski ..$......###  Cast: Poisonous Vapours ........## Ski ....#...# ...###### 5   ufetubus (wandering) Ski ...# .>Ski Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Ski+ {Aiming: Mercury Arrow (safe; 1% risk of failure)  SkiR Press: ? - help, Shift-Dir - straight lineAim: an ufetubus (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the ufetubus! The ufetubus looks weaker.Skit  ............ ........... .........###.. ...Skiͧ  ... #..######  #.$*Ski X.##  Ski #..$*  ...Ski7 e  ..$  Skik .... ... SkiҨ ...###### ..# .> SkiU/ !..Skig2 V608 ==80.4 (1Ski2 ;Poisonous VapoursSki8 Ski; onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an ufetubus (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the ufetubus! The ufetubus looks weaker. _You kill the ufetubus!Tki۹ .# .. .....###...... ..###..##...... ..##.Tki;? #.#. ##.###### #.$.##TkiiV #..$@....###.#.#.$......###Tki.##.....#...#....######Tki~...#..>TkiTki&--Tki 1TkiTkiTkid .# .. ......### .Tki\d6.###..## ..## #.#. ##.######Tkird} #.$.##Tkid #..@.....###.#.#Tkido.$......###Tkid~.##......#...#Tkid`.....######....#TkidS...>TkilTkim"--Tki4m2Tki8rTkiyTkiyH223.4 (2Tki~Tki[? _You now have 622 gold pieces (gained 14).Tkis h .## ....# ..............###.##..##..##........Tkis  ##.......## ##..###### #...## #........### .....#.#Tkis  ....$......###.....##Tkis ..#...#..######..#...>Tki{ Tki{ +4.4 (1Tki Tki Tki #7Tki $5.4 (2TkiS TkiM > _You now have 627 gold pieces (gained 5).Uki4UkiZC  Skill  Level Cost  Apt Skill  Level Cost  Apt Uki a - Fighting   7.1   8.0   0   j + Spellcasting 3.9   4.8  -1      UkiS    Uki b - Polearms   0.0   1.0   0   k + Conjurations 3.8   4.0   0  Uki+ c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1  Uki] d - Throwing   0.0   1.0   0   m + Fire Magic1.3   2.0   0  Uki    n + Air Magic2.6   3.0   0   e + Short Blades   0.8   0.5   0 +4    Uki" f - Long Blades   0.3   1.0   0   o - Evocations   0.0   0.8  +1      UkiU p - Shapeshifting   0.0   1.2  -1  g + Dodging4.2   5.0   0  Uki.     h - Shields   0.0   1.0   0  Uki+    i + Stealth6.0   3.5  +4  Ukia    Uki        Uki%_    UkiX        Ukia    Uki        Ukil    Uki     Skills enhanced by cross-training are in green. Bonus from skill manuals is in  UkiVred.  [?] Help[=] set a skill target  Uki}[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetsqkiFqkiMqkiT.........##.... ludeguy the Toxicologist..............#..... Octopode of Gozag Gold: 627 ..................... Health: 64/64 ========================..............###.... Magic: 12/14 ====================----qki8U).........###..##.... AC: 3Str: 7.........##........ EV: 14Int: 20#.......#.......## SH: 5Dex: 16qkiU##..........###### XL:  9 Next: 29% Place: Dungeon:6#.@........##Noise: ---------  Time: 6685.4 (0.0)#........###c) +0 dagger (protect)...........#.#Cast: Poisonous VapoursqkiU;....$......###...........##.......#...#......######qkiU_.....#...>qki.VPress: ? - help, Shift-Dir - straight lineAim: an ufetubus (wandering, hasn't noticed you, chance to weaken: 100%)  qki`VThe glob of mercury hits the ufetubus! The ufetubus looks weaker. _You kill the ufetubus! _You now have 622 gold pieces (gained 14). _You now have 627 gold pieces (gained 5).qki \qki\qkiaqkicqki`qki6d"  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 3.9   4.8  -1           b - Polearms   0.0   1.0   0   k + Conjurations 3.8   4.0   0  qkie c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1   d - Throwing   0.0   1.0   0   m + Fire Magic1.3   2.0   0      n + Air Magic2.6   3.0   0   e + Short Blades   0.8   0.5   0 +4     f - Long Blades   0.3   1.0   0   o - Evocations   0.0   0.8  +1       p - Shapqkifeshifting   0.0   1.2  -1  g + Dodging4.2   5.0   0       h - Shields   0.0   1.0   0      i + Stealth6.0   3.5  +4                                              kiQg19;2HSkills enhanced by cross-training are in green. Bonus from skill manuals is in  red.  [?] Help[=] set a skill target  [/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetsrkirkirki.........##.... ludeguy the Toxicologist..............#..... Octopode of Gozag Gold: 627 ..................... Health: 64/64 ========================..............###.... Magic: 12/14 ====================----.........###..##.... AC: 3Str: 7.........##........ EV: 14Int: 20#.......#.......## SH: 5Dex: 16##..........###### XL:  9 Next: 29% Place: Dungeon:6#.@........##Noise: ---------  Time: 6685.4 (0.0)#........###c) +0 dagger (protect)...........#.#Cast: Poisonous Vapoursrki+[15X....$......###...........##.......#...#......######.....#...>Press: ? - help, Shift-Dir - straight lineAim: an ufetubus (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the ufetubus! The ufetubus looks weaker. _You kill the ufetubus! _You now have 622 gold pieces (gained 14). _You now have 627 gold pieces (gained 5).rkirkirkirki.rki* rkir-  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b + Mercury ArrowConjuration/Alchemy 1% 2 c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemyrki- 3%4 Select a spell to describe [?] help [!]/[I] toggle spell headerstki tkih .........##.... ludeguy the Toxicologist..............#..... Octopode of Gozag Gold: 627 ..................... Health: 64/64 ========================..............###.... Magic: 12/14 ====================----.........###..##.... AC: 3Str: 7.........##........ EV: 14Int: 20#.......#.......## SH: 5Dex: 16##..........###### XL:  9 Next: 29% Place: Dungeon:6#.@........##Noise: ---------  Time: 6685.4 (0.0)#........###c) +0 dagger (protect)...........#.#Cast: Poisonous Vapourstki +[15X....$......###...........##.......#...#......######.....#...>Press: ? - help, Shift-Dir - straight lineAim: an ufetubus (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the ufetubus! The ufetubus looks weaker. _You kill the ufetubus! _You now have 622 gold pieces (gained 14). _You now have 627 gold pieces (gained 5).tkik tki tki tki ukihukixj~ Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft5% 1  b - Sigil of BindingHexes16% 3  c - Curse of AgonyNecromancyukij78% 5 1 spell level left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitvkiC vkiJ vkiR .........##.... ludeguy the Toxicologist..............#..... Octopode of Gozag Gold: 627 ..................... Health: 64/64 ========================..............###.... Magic: 12/14 ====================----.........###..##.... AC: 3Str: 7.........##........ EV: 14Int: 20#.......#.......## SH: 5Dex: 16##..........###### XL:  9 Next: 29% Place: Dungeon:6#.@........##Noise: ---------  Time: 6685.4 (0.0)#........###c) +0 dagger (protect)...........#.#Cast: Poisonous VapoursvkiFS +[15X....$......###...........##.......#...#......######.....#...>Press: ? - help, Shift-Dir - straight lineAim: an ufetubus (wandering, hasn't noticed you, chance to weaken: 100%)  The glob of mercury hits the ufetubus! The ufetubus looks weaker. _You kill the ufetubus! _You now have 622 gold pieces (gained 14). _You now have 627 gold pieces (gained 5).vki\X  vkiX J Okay, then.vkiCY vki^ vkiF` . _vki4vki$vki'F _Unknown command.wkiiwkiwki,wkiwkii3== _wkiRwkiwkiwkiEwkixwkizwkiwkiwkiwkiwkiG:==wkiwkiwki*627wkiwkiwkiwkiwkib4==wkiwkiwkiS,wki<wkiwkiwkiwki$wkiwkiwkiwki5wkio46==wkiwkiN _You now have 646 gold pieces (gained 19).wkii3wkiWwki6wkiwkiBwkiwkiwkibwkiwkiwkiwki wki wki wkip wki wkiwkitwkiwkiwkiwkiwkiwkivwkiwki wki]"wki%,wki%wki'wki+,wki/XwkiY2wkiY4wki6wki7wki7wkiM9wki;,wkif<wki>wki@  You encounter a centaur. It is carrying a +0 orcbow.wkieG ..)... ### .... .c ...  #. ..# #.....##.##.# ###.....#.....###...wkiGE#..#..#.#....#..#..#....... #@................#.....###.............#.......##.....##......wkiH.##.#....#.....###...... # #.##...##..##....... #. #....#...#....... c   centaur (launcher, asleep) #..................#wkiH #..##..............# #..............##wki\Q1709.4 (24.0)wkiR410.4 (25 _wkiNXwki_wki ..) ... ###  .c ...  #. ..#  ##.##.#  #.....# #..#..#.#.. #..#..#.... #@....... #.....###.... #.......##..... ##.#....#..... # #.##...##..##.. #. #....#...#. #............. #..##........wki ..) ... ###  .c ...  #. ..#  ##.##.#  #.....# #..#..#.#.. #..#..#.... #@....... #.....###.... #.......##..... ##.#....#..... # #.##...##..##.. #. #....#...#. #............. #..##........wkicwkiϊwkiwkiΓ^ _A centaur is nearby!wki5$  ..) ... ###  .c ...  #. ..#  ##.##.#  #.....# #..#..#.#.. #..#..#.... #@....... #.....###.... #.......##..... ##.#....#..... # #.##...##..##.. #. #....#...#. #............. #..##........wki * ..) ... ###  .c ...  #. ..#  ##.##.#  #.....# #..#..#.#.. #..#..#.... #@....... #.....###.... wkiw #.......##..... ##.#....#..... # #.##...##..##.. #. #....#...#. #............. #..##........wki: 4wki wki ^ _A centaur is nearby!xki\ 7##.. ... ..)....###  .c....  #.#..# # ##.##.# ### #.....###. #..#..#.#.#.@#..#..........#.........##.....###...... #.......##.....##xki<] ##.#....#.....####.#.##...##..### #. #....#...#...... #.....#..##..xkiye xkiQf 81.4 (1.0) _xkik xkim yki[...##.:..##... ... ..)ykiKs....###.c....  #.#..# #.##.# ###...### #..#..#..........#.......ykio..##.....#.........##.....##.#....#.....###.#.##...##..##.#. #....#...#..yki/ cc)Found a parchment of Launch Clockwork Bee.yki )))))The centaur wields a +0 orcbow. The centaur shoots an arrow.yki_...@.yki/==2yki .a _The arrow misses you.ykiU.4yki 5yki8 _You can't see any susceptible monsters within range! (Use Z to cast anyway.)zkizkiazkizkit _You can't see any susceptible monsters within range! (Use Z to cast anyway.){ki[...#.... ludeguy the Toxicologist#.:..##...... Octopode of Gozag Gold: 646...{ki[..)... Health: 64/64 ========================....### ........ Magic: 12/14 ====================----.*.... ........ AC: 3Str: 7{ki~#*#..# #........ EV: 14Int: 20##*##.# ###........ SH: 5Dex: 16#.*...###.......... XL:  9 Next: 29% Place: Dungeon:6#.@#..#.#.......... Noise: ==-------  Time: 6712.4 (0.0)#..#..#............ c) +0 dagger (protect).......#................ Cast: Poisonous Vapours..##.....###............#.......##.....##.....##.#....#.....###..... c   centaur (launcher)#.#.##...##..##......#.#. {kix#....#...#......#.................. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failure)  {kiэVConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a centaur, wielding a +0 orcbow (chance to weaken: 100%){ki"G.c{ki"#&..{ki())  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells.{ki")Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  {kiI)Aim: a centaur, wielding a +0 orcbow (chance to weaken: 100%)  The glob of mercury misses the centaur. The centaur shoots an arrow.{kiA,..{kiw51-----3.4 (1Poisonous Vapours{ki{ki) _The arrow hits you!{ki[...#.... ludeguy the Toxicologist#.:..##...... Octopode of Gozag Gold: 646.....)... Health: 51/64 ===================-----....### ........ Magic: 11/14 ==================------...... ........ AC: 3Str: 7#c#..# #........ EV: 14Int: 20##.##.# ###........ SH: 5Dex: 16#.....###.......... XL:  9 Next: 29% Place: Dungeon:6{ki,#.@#..#.#.......... Noise: ==-------  Time: 6713.4 (0.0)#..#..#............ c) +0 dagger (protect).......#................ Cast: Poisonous Vapours..##.....###............#.......##.....##.....##.#....#.....###..... c   centaur (launcher, poisoned)#.#.##...##..##......#.#. #....#...#......#..................{kicCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target{kikAim: a centaur, wielding a +0 orcbow  Poisonous fumes billow around the centaur!{ki>)){kin..44---4.4 (1{ki{ki!onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  {kiAim: a centaur, wielding a +0 orcbow  Poisonous fumes billow around the centaur! _The centaur is poisoned. The centaur shoots an arrow. The arrow hits you!|kiS[...#.... ludeguy the Toxicologist#.:..##...... Octopode of Gozag Gold: 646.....)... Health: 44/64 ================--------....### ........ Magic: 10/14 =================-------...... ........ AC: 3Str: 7#c#..# #........ EV: 14Int: 20|ki:T(##.##.# ###........ SH: 5Dex: 16#.....###.......... XL:  9 Next: 29% Place: Dungeon:6#.@#..#.#.......... Noise: ==-------  Time: 6714.4 (0.0)#..#..#............ c) +0 dagger (protect).......#................ Cast: Poisonous Vapours..##.....###............#.......##.....##.....|kiTb##.#....#.....###..... c   centaur (launcher, very poisoned)#.#.##...##..##......#.#. #....#...#......#..................|kiUCasting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a centaur, wielding a +0 orcbow (lightly wounded, poisoned)  Poisonous fumes billow around the centaur!|kiC\))))onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a centaur, wielding a +0 orcbow (lightly wounded, poisoned)  Poisonous fumes billow around the centaur!  |ki\;The centaur looks even sicker. The centaur shoots an arrow.|ki FThe arrow barely misses you.|ki ..@.F   marrowcudac   centaur (launcher, very poisoned)You encounter a marrowcuda.|kiK))))|ki†Y..@.|kiӇ+5.4 (1|ki|kio _The centaur shoots an arrow. The arrow barely misses you.}ki Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy3%4 Select a spell to describe [?] help [!]/[I] toggle spell headers~ki~ki~ki[...#.... ludeguy the Toxicologist#.:..##...... Octopode of Gozag Gold: 646.....)... Health: 44/64 ================--------....### ........ Magic: 10/14 =================-------F..... ........ AC: 3Str: 7#c#..# #........ EV: 14Int: 20~ki֘C##.##.# ###........ SH: 5Dex: 16#.....###.......... XL:  9 Next: 29% Place: Dungeon:6#.@#..#.#.......... Noise: ==-------  Time: 6715.4 (0.0)#..#..#............ c) +0 dagger (protect).......#................ Cast: Poisonous Vapours..##.....###............#.......##.....##.....##.#....#.....###..... F   marrowcuda~ki#.#.##...##..##...... c   centaur (launcher, very poisoned)#.#. #....#...#......~ki&#..................Aim: a centaur, wielding a +0 orcbow (lightly wounded, poisoned)  ~kiH1Poisonous fumes billow around the centaur!  ~kikoThe centaur looks even sicker. The centaur shoots an arrow.  The arrow barely misses you.~kiYou encounter a marrowcuda. _The centaur shoots an arrow. The arrow barely misses you.~ki~ki-~ki~ki~ki/P  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.~ki0 [...#.... ludeguy the Toxicologist #.:.. ##...... Octopode of Gozag Gold: 646 ... ..)... Health: 44/64 ================-------- ....### ........ Magic: 7/14============------------ F**... ........ AC: 3Str: 7 #c#..# #........ EV: 14Int: 20 ##*##.# ###........ SH: 5Dex: 16 #.*...###.......... XL:  9 Next: 29% Place: Dungeon:6 #.@#..#.#.......... Noise: ==-------  Time: 6715.4 (0.0) #..#..#............ c) +0 dagger (prote~ki0ct) .......#................ Cast: Poisonous Vapours ..##.....###............ #.......##.....##..... ##.#....#.....###..... F   marrowcuda #.#.##...##..##...... c   centaur (launcher, very poisoned) #.#. #....#...#...... #..................Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a centaur, wielding a +0 orcbow (lightly wounded, very poisoned, chance toaffect: 81%)ki[...#.... ludeguy the Toxicologist#.:..##...... Octopode of Gozag Gold: 646.....)... Health: 44/64 ================--------....### ........ Magic: 7/14============------------###... ........ AC: 3Str: 7###..# #........ EV: 14kiInt: 20#####.# ###........ SH: 5Dex: 16#.*...###.......... XL:  9 Next: 29% Place: Dungeon:6#.@#..#.#.......... Noise: ==-------  Time: 6715.4 (0.0)#..#..#............ c) +0 dagger (protect).......#................ Cast: Poisonous Vapours..##.....###............#.......##.....##.....##.#....#.....###..... F   marrowcuda#.#.##...##..##...... c   centaur (launcher, very poisoned)#.#.kia #....#...#......#..................Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linekiAim: a centaur, wielding a +0 orcbow (lightly wounded, very poisoned, chance toaffect: 81%)  The flask of dizzying concoctions shatters into a vile cloud!ki,ki6§FAiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a centaur, wielding a +0 orcbow (lightly wounded, very poisoned, chance toaffect: 81%)  The flask of dizzying concoctions shatters into a vile cloud!centaur is lightly wounded.ki§c..c  confused, very poi…)The flask of dizzying concoctions shatters into a vile cloud!  The centaur is lightly wounded.  You hear a shout! x2; You hear a croak. You hear a shout!  The centaur is engulfed in noxious fumes.centaur appears confused. The centaur unwields a +0 orcbow.hits the marrowcuda but does no damage.kiNK=======6.4 (1kiwv _The centaur closely misses the marrowcuda.ki   ki Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kid #.:........#c#..###.##.##.....##.@##..#...#.#.....##.......##.#....##.#.##..#.#. #...ki###.#T...#..#..###.#.##...###...).#.##......#...#....ki....5.[.@.##....#..##ki#.......#......... #..#.ki-~#.#....... ..kiJy###.....###. #kij #...... ..### ####kio#...... .... #.####... ##. ##. # kiG.5kiE5ki/'===kiM 9ki3ki' _The drude shouts!ki#P##.$...#.....#..##.....####.##.....###.#T...#..#...###.#.##...###...)......##.#.##....#......#.........#.........ki&$.....5[...##....#..###.......#@........ #..#.......#.# ..###.....###. # #...... ..### #####...... .... #.ki\$####... ## #. ##.  # ki%J.5ki.kis.'---ki. 40ki64ki6kiI 1 .##.....###.##...........###.#T...#.#....###.#.##...## ##...)......##.#......#.........#..............5...##....#..###.......#......... #.#....... .####....... # . ..### ####... ### ##kiL 05kit 5   drude9=3=---1ki   ki Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki6 #............##.....###... ludeguy the Toxicologist #...........##.......##... Octopode of Gozag Gold: 646 ............###.#T...#.... Health: 59/64 ======================-- #...........###.#.##...##. Magic: 1/15=----------------------- kiq##...)......##.#.##....#. AC: 3Str: 7Doom: 10% ki.....#***......#......... EV: 14Int: 20 ki......5.5*##....#..##..... SH: 5Dex: 16ki ki #.......#*........ #...... XL:  9 Next: 39% Place: Dungeon:6 ki#.......#@#....... ....... Noise: ---------  Time: 6741.2 (0.0) ki###.....###....... #...... c) +0 dagger (protect) ki7n#...... ..### ####... Cast: Poisonous Vapours kiRD#...... .... #... ####... ## #...kil ##.ki##.. 5   drudeki ki/_The drude shouts!  kiCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineki BAim: a drude (chance to weaken: 100%)ki6H#............##.....###... ludeguy the Toxicologist#...........##.......##... Octopode of Gozag Gold: 646............###.#T...#.... Health: 59/64 ======================--#...........###.#.##...##. Magic: 1/15=-----------------------##...)......##.#.##....#. AC: 3kiHStr: 7Doom: 10%.....#.........#......... EV: 14Int: 20......5.5.##....#..##..... SH: 5Dex: 16#.......#*........ #...... XL:  9 Next: 39% Place: Dungeon:6#.......#@#....... ....... Noise: ---------  Time: 6741.2 (0.0)###.....###....... #...... c) +0 dagger (protect)kiI#...... ..### ####... Cast: Poisonous Vapours#...... ....#...ki7IJ####...## #...##.kirI##.. 5   drude (weak)  Casting: Mercury Arrow (safe; 1% risk of failure)  kiIConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  kiI}Press: ? - help, Shift-Dir - straight lineAim: a drude (chance to weaken: 100%)  kiI;The glob of mercury hits the drude. The drude looks weaker.kiQ.5kiki#4==2.2 (1kiki onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a drude (chance to weaken: 100%)  The glob of mercury hits the drude. The drude looks weaker. _The drude is moderately wounded.ki  The glob of mercury hits the drude. The drude looks weaker. _The drude is moderately wounded.  You puncture the drude!  Your weapon exudes an aura of protection.  Your grab misses the drude.  The drude is severely wounded.ki M10 3ki ki y _The drude barely misses you. The drude hits you but does no damage.ki $You hit the drude. You grab the drude.  The drude is almost dead.You constrict the drude.ki+(ki_646 41-4.1 (0.9ki̲kiWI _You kill the drude!kikM#.$...#......##.....##...kiY##.......##.....###.#T...#...#...........###.####...)......##.#.##....#ki+ .....#.........#..........[...##....#..##ki ........ #...#....... .ki-r#####....... #...kiR#...... ..### ####.....kis)##ki0ki_60--5.1 (1.0kikiC ki b51-6.1 (2ki ki5 > _You now have 651 gold pieces (gained 5).kiko##.$...#.#....##.....###.#...##.##....###.#T...#.#...........###.#.##...##.##...)......##.#.##....#......#.........#.......[...##....#..##.#.kip#. #.#.#.#. .###.....###....... #.#...... ...#### ####.#...... ..... #.####... ....## #.##. .#...##....###ki-zki{+7.1 (1kiikikiD#..##.....####.....##.........###.#T...#.....##...###.#.##...##..##...)......##.#.##....#.ki.....#.........#...............[...##....#..###.......#..........#..#.#.#..###.....###.ki# #...... #...#########ki}#...... #..... #....>kis####... .....## #....#ki ##. ..#... ##...ki%h ....####.#ki5 kikirkiB12==ki8kikiki #.##.......#......###.#T...#.....###....###.#.##...##..#ki #...)......##.#.##....#......#.........#...............[...##....#..###kiq .#..........#..#.#.#.###.....###.#ki  #...... #...#########.....#ki #...... #..... #....>#####... .....## #....##ki  ##. #..#... ##...ki .....#####.#.ki Q#. ..ki ki 9 3 9ki ki kiU [ .#.#T...#.....##...........###.#.##...## ##...)......##.#.##....#........#.........#..................[...##....#..###.......#..........#..#.ki #### . #.@.#########.....#...... #....>###.........#######ki }.### /..ki; ki ki& 50ki ki 4 _Found a wand of paralysis (6).ki #.###.#.##...##.. ##...)......##.#.##....#... .....#.........#............[...##....#..## #.......#.......... #.#.#. ###.....###..# #...... #...######### #...... #@........ #....> ####.........##### #.... ##.##..#...... ##...  .....#####ki5K##.#... #. .... ## #/... #....kicki]T2=1kikiki]Y ##...)......##.#.##....#.. .....#.........#..........[...##....#..## #.......#.......... #.......#.#. ###.....###........# #.......#...######### #.......#......... # ####....@....##### #....kiY ##.##..#...... ##... .....##### ##.#.... #.#......kiYF ####/....kiY #kiZ0.... ##ki#Z#.ki*dkiNeC==2kilkinkitkikikiTkiӬ ki* ki kiٶ kiD  .....#...#..............[...##....#..###.......#..........#..#.#...##.....##...# ..#...#########ki]#......... ###.........##### ##.##@.#...... ## #.....##### ##.#.....# #kiki&3ki#ki%ki;.[...##....#..## #.......#.......... #.......#.#.. ###.....####ki& #.......#...######### #.......#......... # ####.........##### # ##.##..#...... ##kiɄ #@....##### ki ##.#..... #.#......ki  ####/.... ki/=#.... ###.kiY( kix" kiD kiki&4kikikikiokikiki 0#.#..........#..#.#.#..........###.....###........# #.......#...##########.......#......... #.####.........##### #. ##.##..#...... # #.....##### ##@#.....# .#...... kiC ####/....  #....##.kiy 3=3=5ki  #.##.....###........# ..#...#########..#......... ###.........#####ki  ##.##..#...... ## #.....##### ##.#.....#  .###/ki4 [ #  kiR D ki kis &6kiP ki ki?ki?ki@kiJEki$I@651kieIk _You start resting.HP restored.kiMkiT&7ki0UW4=8.1 (2 kiU _kiqYki[kiJkiKki!LkiOQO=kiTBki+UkiXkiXkiYki/]|=4==ki]ki_,ki`kic,kidkigkigkiEhkikkik:==kinki%r,kirkiv,kivkizkiz>5==kizki{kiEki}ki,kiWkiki'ki kiBkikiki$==kiȍkiki,kiki,ki+kiBkikirS6=kiki,kiߴkiW,kiki!,kikiO=kikikikiki,kiki3T7==kihkikikiMkiki,kiKkikikikiki 3==kikiC,kikiTkiki kiki78=kikiikiEkizkikikikiwki?kinkikiki9=ki[kikikixki ki> ki ki_ ki N9==ki? ki ki ki ki kiQ ki ki ki- ki ki" ki :==ki kix ki ki0 kic ki ki ki{ ki R10/15==kiN ki# ki# kiL$ ki ( ,ki( kis+ ki+ ki-, ki0 kiW0 :==ki0 ki4 kiB4 ki5 kiY8 ki8 ki9 ki'< kiZ< 71=ki|< ki = ki@ ki@ kiB kiaD kiD ki'E kiG kiH kiH kiL ki;L 9=kiL kiO kiP kiP kiR ki S kiS ki_V kiV #2kiV )==kihW kiZ ki [ ki[ kiX^ ki^ ki _ kiwa kia kiFb kid ki>e :==kie kih kih kigi kil kil kidm kiQp ,kip kit kit K3=kiu kiw kix kix kim{ ,ki{ ki"~ kiT~ ki~ kiS ki #=ki ki; ki ki΄ kiT ki ki ki ki kik #4ki )==ki kiR ,ki ki ki ki ki ki kis ki kiԙ $==ki ki ki< kik ki ki ki kis ki n _You start resting.Magic restored.kiM ki< 1840.1 (82.0)ki: b5==1.1 (83 _kiv ki kikikikikikiki ki\kiki+$ki\$ki$ki(kib)3==ki)ki4-ki-ki(.kiI1ki1ki1ki:4ki4ki5kib8ki8kiS9ki;ki<ki<ki@,kiAki_CkiCkiDkiFki!GkiGki+KkiUKkiKkiO,ki~PkiSki8TkiTki XkiAXkiXki[ki(\ki\ki>_,ki_kib,kikcki;fkigfkigkiikijkijkimkimkiUnkiWqkiqki?rkinvkivkiLwki zkiDzkizkit}ki}ki=~kikikikikińkikiki7ki׈ki΋ki kiki#kitkikiIkiki"kikiݕkiki,ki(ki{,ki$ki}kikikikikiki,kiѧkiki۪kibkilkiki'ki5ki|ki<kikikiBkikikiki,ki{ki4,kiki,kiki,ki~kiu,ki ki,ki6ki4ki_kikiki+kikiki"kikikikibkiLkipki ki]kiki#ki,kipkikiki|ki,kikiki)kikikikikikikikilkiki<kiki kix kiZ ki ki kikikikin,kikifkiki;kikikikikikioki!ki!ki!ki&$kiL$ki$ki'ki'kie(ki9+kia+ki+ki@/kii/ki/kin2ki2kiF3kim>,ki?kiki+kiki ,ki kiJ ,ki ki;,kiki,kiki,kiki,kikir!,ki"ki~%,ki&kid*Bkiq-,ki2.ki`2ki2ki3ki6,kiS7ki:ki:kiz;ki?,ki@kiC,kiwDkiH,kiHkiKkiLkiLkiPP,ki&QkiT,ki;UkiX,kiYki^,ki^kibW _You start waiting.ki@kKK   kobold brigand (missile, wandering)kivl-939.1 (98kigtkit-40.1 (99ki;ykì  You encounter a kobold brigand. It is wielding a +0 short sword and quivering _poisoned darts.ki62u ###.... .#... #...  ki2....  ##.##..#  #...  ##.#  #@#ki35  ####/....  ki43#....  kiF3###. kiY3!ki ###.... .#... #...  ki%x....  ##.##..# ki=. #...kiS  kikc##.# ki #@#  ####/....  ki;#....  ki8###. ki kiki0kiRkie _A kobold brigand is nearby!kiK  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiSkitSkiYki ] _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiQ.#.......#.#.........#####........#.....#...########......K#.........####.........##### #.kiQe##.##..#...... ##...#.....#######.#..####/#...kiR*###. ki[O.Kki'dFK)kidT===1.1 (1.0)Poisonous Vapourski:kkinE _The kobold brigand shouts! You hear a shout! x2ki A#.......#..........#....... ludeguy the Toxicologist#.......#.#................ Octopode of Gozag Gold: 651###.....###........#....... Health: 64/64 ========================#.......#...#########.... Magic: 13/15 ====================----#.......#......... #.... AC: 3ki Str: 7Doom: 10%####...K.....##### #.... EV: 14Int: 20##.##*.#...... ##... SH: 5Dex: 16#.*...#####XL:  9 Next: 41% Place: Dungeon:6##@#.....#Noise: ===------  Time: 6941.1 (0.0)#.#......c) +0 dagger (protect)ki ####/....Cast: Poisonous Vapours#....###.K   kobold brigand (missile, weak)Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (chance to weaken: 88%)  The glob of mercury hits the kobold brigand!  The kobold brigand looks weaker.ki Q.Kki( .ki) 3-2.1 (1ki/0 ki2 [  Press: ? - help, Shift-Dir - straight line  ki2 Aim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (chance to weaken: 88%)  ki2 XThe glob of mercury hits the kobold brigand!kobold brigand looks weaker. ki2 X_The kobold brigand is heavily wounded.ki#.......#..........#....... ludeguy the Toxicologist#.......#.#................ Octopode of Gozag Gold: 651###.....###........#....... Health: 64/64 ========================#.......#...#########.... Magic: 12/15 ===================-----#.......#......... #.... AC: 3Str: 7Doom: 10%ki_####.........##### #.... EV: 14Int: 20##.##K.#...... ##... SH: 5Dex: 16#.....#####XL:  9 Next: 41% Place: Dungeon:6##@#.....#Noise: ==-------  Time: 6942.1 (0.0)kiA#.#......c) +0 dagger (protect)####/....Cast: Poisonous Vapours#....###.K   kobold brigand (missile, poisoned, we…)Confirm with . or Enter, or press ? or * to list all spells.ki'dAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (heavily wounded, weak)  kiW1Poisonous fumes billow around the kobold brigand!kiH(((Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (heavily wounded, weak)  Poisonous fumes billow around the kobold brigand!  kiAThe kobold brigand is poisoned. The kobold brigand throws a dart.kiMrS.@.kir%-kis3.1 (1kiXyki|J _The dart misses you.kiG3A#.......#..........#....... ludeguy the Toxicologist#.......#.#................ Octopode of Gozag Gold: 651###.....###........#....... Health: 64/64 ========================#.......#...#########.... Magic: 11/15 =================-------#.......#......... #.... AC: 3ki3Str: 7Doom: 10%####.........##### #.... EV: 14Int: 20##.##K.#...... ##... SH: 5Dex: 16#.....#####ki 4XL:  9 Next: 41% Place: Dungeon:6##@#.....#Noise: =--------  Time: 6943.1 (0.0)#.#......c) +0 dagger (protect)####/....Cast: Poisonous Vapours#....###.ki44K   kobold brigand (missile, very poisone…)ki[4Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetki4Aim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (heavily wounded, poisoned, weak)  Poisonous fumes billow around the kobold brigand!ki:(Press: ? - help, Dir - move target: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (heavily wounded, poisoned, weak)  Poisonous fumes billow around the kobold brigand!  The kobold brigand looks even sicker. The kobold brigand throws a dart.  The dart hits youki:!ki&.ki#=====4.1 (1Pois ki.ki҉Q _You are poisoned.ki]......[...##....#..##....#..........#.....K.#.#.........###....K###........#...K..#...########.......#.........####.........##### #.ki`##.##K.#...... ##...#.@...#######.#.....#.#......####/....#....###.kiKKK 3 kobolds (1 missile, wandering) ki .KYou encounter 3 kobolds.A kobold is quivering stones.kid0You feel very sick.kij KThe kobold shouts! x2ki .KYou encounter a kobold. It is wielding a +2 whip of venom and quiveringpoisoned darts.kiBD.Kki9 KThe kobold brigand hits you with a +0 short sword.kivKKKK 5 kobolds (2 missiles)ki2|59===--=5kiki/#q _You encounter a kobold. It is wielding a +0 club.ki^ = .KYou closely miss the kobold brigand. Your grab misses the kobold brigand.Your squeeze misses the kobold brigand.The kobold brigand is heavily wounded.ki{ G.Kki .ki $Kki{ 1.Kki ki ..Kki= ki1 ki o7-----6.0 (0.9ki> ki| k _You feel sick. The kobold brigand closely misses you.ki\  .  You completely miss the kobold brigand. Your grab misses the kobold brigand.The kobold brigand is heavily wounded.ki^ /.Kki^ ki` 9 .Kki` +You feel sick.kiTa /.Kkisa kia .kib %Kki9k xK 4 kobolds (1 missile)kil c6---7.0 (1.0ki#t kiv E _The kobold brigand hits you but does no damage.kin#.......#..........#.....#.#.........##.....###........# #....K..#...#########K.K#......... ###...KK....##### ##.##K.#...... ## #.....##### ##@#.....#  #.#......###/.... #.... ###. K 3 koboldskiRkibG(((kiLD.KkiL;.Kki N/KkiND.KkiVW..@.K 4 kobolds (1 missile)kiZXT2==8ki"_kia _You feel sick. The kobold brigand throws a dart. The dart closely misses you.ki3 @#.##.....###........# K.#...#########K..#......... ###...KK....##### ##.##KK#...... ##kiF4  #.....##### ##.#.....#  .###/ # ### ki`4 0 kiv4 P 3 koboldski8 .Kki9 K.Kki9 2KKki(: ki: kiB .poisoned, wK 4 kobolds (1 missile)ki]C 55-kiC &-9kiJ kiVM $ _You feel sick.ki  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki2[ #.......#.#................ ludeguy the Toxicologist ###.....###........#....... Octopode of Gozag Gold: 651ki3 #.......#...#########.... Health: 55/64 ====================---- #....K.K#......... #.... Magic: 9/15==============---------- kiI3####...KK....##### #.... AC: 3Str: 7Doom: 10%ki|3] ##.##K*#...... ##... EV: 14Int: 20 #*K*..#####  SH: 5ki3Dex: 16 ##*#.....#  XL:  9 Next: 41% Place: Dungeon:6ki3 #@#......  Noise: ---------  Time: 6949.0 (0.0) kin4####/....  c) +0 dagger (protect) #....  Cast: Poisonous Vapours ###.  Pois   K   kobold brigand (missile, poisoned, we…)  KKKK 4 kobolds (1 missile)ki5uCasting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  (heavily wounded, poisoned, weak, chance to affect: 77%)kiF0#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 651#.......#...#########.... Health: 55/64 ====================----#....K.K#......... #.... Magic: 9/15ki}==============----------####...KK....##### #.... AC: 3Str: 7Doom: 10%##.#####...... ##... EV: 14Int: 20####..#####SH: 5Dex: 16####.....#XL:  9 Next: 41% Place: Dungeon:6ki#@#......Noise: ---------  Time: 6949.0 (0.0)####/....ki'c) +0 dagger (protect)#....Cast: Poisonous Vapours###.kiCPois K   kobold brigand (missile, poisoned, we…)kiV kijs KKKK 4 kobolds (1 missile)kiConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  kiPress: ? - help, Shift-Dir - straight lineAim: a kobold brigand, wielding a +0 short sword and quivering poisoned darts  ki(heavily wounded, poisoned, weak, chance to affect: 77%)  The flask of dizzying concoctions shatters into a vile cloud!kiTV ki ○KThe flask of dizzying concoctions shatters into a vile cloud!  The kobold brigand is heavily wounded.You feel sick.  The kobold is engulfed in noxious fumes.  The kobold appears confused.kobold hits the kobold brigand with a +0 short sword.kic K☼.○. K, 1 confused)ki =4=======ki $50.0 (1ki ki F _The kobold brigand is engulfed in noxious fumes.kiN[☼KkiPOYou hit the kobold brigand.  Your weapon exudes an aura of protection.  Your grab misses the kobold brigand.The kobold brigand is severely wounded.kiU0○○kiVR3=-kiVx10 =------9 (0.9kic]ki!`2 _The kobold appears confused.kiZ+  ☼You hit the kobold brigand. You grab the kobold brigand.  The kobold brigand is almost dead.You constrict the kobold brigand.ki0w °KYou kill the kobold brigand!kiw0ZYou feel sick.  The kobold is engulfed in noxious fumes.ki7l ki;W651 -9kiA;O%5------1.9 (1.0ki@kiB2 _The kobold appears confused.ki ☼You hit the kobold. You grab the kobold.  The kobold is heavily wounded.You constrict the kobold!ki °°.○KKK 3 kobolds (1 missile)You kill the kobold!You feel sick.ki 2=2Poisonous Vapourski ki [ _You are no longer poisoned.ki@ kiB  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%kiC 2  c + Mephitic CloudConjuration/Alchemy/Air 1% 3 d - Olgreb's Toxic RadianceAlchemy1%kiLC i4  e - Sticky FlameFire/Alchemy3%4 kiqC Select a spell to describe [?] help [!]/[I] toggle spell headerski?U kiS\ ki&a #.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 651 #.......#...#########.... Health: 52/64 ===================-----ki^a %#....K.K#......... #.... Magic: 9/15==============----------####...KK....##### #.... AC: 10  Str: 7Doom: 9%kia ##.##°°#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16##○#.....#XL:  9 Next: 45% Place: Dungeon:6#@#......ki[b Noise: =--------  Time: 6952.9 (0.0)####/....c) +0 dagger (protect)#....Cast: Poisonous Vapours###.KKK 3 kobolds (1 missile)You hit the kobold. You grab the kobold.  The kobold is heavily wounded.You constrict the kobold!  You kill the kobold!You feel sick. ki{b F_You are no longer poisoned.kig kih kixm ki>o ki%  Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki|w $You begin to radiate toxic energy.ki.$kip ###.....#...$#...$K..##°°#...#○##@####   kobold (poisoned)You kill the kobold! x2ki( ###.....#...$#...$K..##°°#...#○##@####ki`1 l $The kobold is poisoned.ki2 +Kki8 U missile)kib< 5------==3.9 (1Toxic ki@ kidC J _You kill the kobold!ki7 $The kobold is poisoned.  Your toxic aura wanes.ki?x..°kiC36=--------4kiIkinKJ _You kill the kobold!kiJ ki B---5ki kip ki ki^kiVki!\ 3 ki#a4=ki}-kiq/ki/9=ki0ki4,ki5ki8ki8ki9ki=ki=ki>{5=7==ki?kiTAkiA*651kiMCkiE,kiGki#Iki}IK6=kiJkiLP==kiyMki$OkiTOkiOPkiRkiRU7=kiTkiUkiVkiWkiBYkiYM8=kiZki>],ki=^kir`ki`%8kiakickickidkifkif9=kiLgkihkihK9=kiikikkikkilkinkioN9==kipki%rkiNrV60=kiaskiukiukivkiy,ki{ki|ki-}:==ki9~ki'ki[%1kinkiN,kidkikiR10/15==kikia2=kikikiOki.ki<kimki]ki9kih3===kikiA,ki~ki,kikikieM1=kiZkik _You start resting.HP restored.ki8$ki@090.9 (35.0)ki"a4=1.9 (36 _kikikiB'ki'ki(ki+ki ,kic/ki0ki0ki1ki4ki`49=ki5kiM8ki89=ki9kiA;kiu;ki<ki>ki?L2==ki@kiC,kiCki9FkiFkidGkiFJki~JkiUKkiNkiO:==ki PkiRkiRkiSkiW _You start resting.A troll comes into view.ki:\TT   troll (wandering)ki\.7002.9 (11kiUbkib33.9 (12 _ki}gkiiki^! *.#.......#.#.........#####...T....#......#...########....K.$#.........####...$$....##### #.##.##..#...... ##...#.....#######ki1" .#..####/#...###. ki# K.Tki) kiK* Q3=4kiu* .0)ki0 ki3 _Items here: $ ( )).kiU  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki# 4ki" kis% _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiئkiGkiki   Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kii ki2k ) Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d + Olgreb's Toxic Radiance Alchemy1% 4 e - Sticky FlameFire/Alchemy3%4 kiek Select a spell to describe [?] help [!]/[I] toggle spell headerskikiʺkik#.......#..........#....... ludeguy the Toxicologist#.......#.#................ Octopode of Gozag Gold: 651###.....###........#....... Health: 64/64 ========================#.......#..T#########.... Magic: 13/15 ====================----ki#....K.$#......... #.... AC: 3Str: 7Doom: 9%####...$$....##### #.... EV: 14Int: 20##.##..#...... ##... SH: 5Dex: 16#.....#####XL:  9 Next: 45% Place: Dungeon:6##@#.....#Noise: ---------  Time: 7004.9 (0.0)#.#......c) +0 dagger (protect)####/....Cast: Poisonous Vapours#....###.T   troll (wandering)kiCasting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  kiDCasting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  kiaConfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kickikiki.ki : _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki .....###......#..T####$#......$$....#####..#.....#.....##@##.####Tpoisoned)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Olgreb's Toxic Radiance (safe; 1% risk of failure) kiC Confirm with . or Enter, or press ? or * to list all spells.  You begin to radiate toxic energy.  The troll shouts!kiw.....###......#..T####$#......$$....#####..#.....#.....##@##.####kiWG.Tkiki9/15 ------===5.9 (1Toxic ki ki , _The troll is poisoned.ki  #.......#..........#....... ludeguy the Toxicologist#.......#.#................ Octopode of Gozag Gold: 651###.....###........#....... Health: 64/64 ========================#.......#...#########.... Magic: 7/15===========-------------#....K.$#..T...... #.... AC: 3Str: 7Doom: 9%####...$$.*..##### #.... EV: 14Int: 20##.##.*#...... ##... SH: 5Dex: 16#..*..#####XL:  9 Next: 45% Place: Dungeon:6##@#.....#ki [9;38HNoise: ===------  Time: 7005.9 (0.0)#.#......c) +0 dagger (protect)####/....Cast: Poisonous Vapours#....Toxic ###.T   troll (poisoned)Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a troll (lightly wounded, poisoned, chance to weaken: 64%)  The glob of mercury hits the troll!kilj : .TConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a troll (lightly wounded, poisoned, chance to weaken: 64%)  The glob of mercury hits the troll!  The troll is heavily wounded.ki *....ki Y-6.9 (1Poisonous Vapourskiϖ kiƙ V _Your toxic aura wanes.ki #.##.....###........# ..#...#########K.$#......... ###...$$.T..##### ##.##..#...... ## #.....##### ##$#.....#  .###/ # ### kiVK.TkikiP---7kikiPki #.......#.#................ ludeguy the Toxicologist ki###.....###........#....... Octopode of Gozag Gold: 651 #.......#...#########.... Health: 64/64 ======================== #....K.$#......... #.... Magic: 6/15kiL=========--------------- ####...$$....##### #.... AC: 3Str: 7Doom: 9%ki ##.##..#...... ##... EV: 14Int: 20 #.T...#####  SH: 5Dex: 16ki  ##$#.....#  XL:  9 Next: 45% Place: Dungeon:6 #@#......  Noise: ---------  Time: 7007.9 (0.0) ki####/....  c) +0 dagger (protect) #....  Cast: Poisonous Vapours ###.  ki T   troll (poisoned)Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiPAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a troll (heavily wounded, poisoned)  Poisonous fumes billow around the troll!ki ###.... .#... $#...  $$.. kir ##.##..#  ki  ki1\##$#  kiNR#@#  kiko####/....  kih#....  ###. kiA very poisoned)kiki3=8.9 (1kilkionfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a troll (heavily wounded, poisoned)  Poisonous fumes billow around the troll! _The troll looks even sicker.ki^ @.Tki|% ki% .-9ki+ kiw- ki  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki- #.......#.#................ ludeguy the Toxicologist ###.....###........#....... Octopode of Gozag Gold: 651 #.......#...#########.... Health: 64/64 ======================== #....K.$#......... #.... Magic: 2/15===--------------------- ####...$$....##### #.... AC: 3Str: 7Doom: 9% ##.##..#...... ##... EV: 14Int: 20ki\ #.....#####  SH: 5Dex: 16 ##T#.....#  XL:  9 Next: 45% Place: Dungeon:6 #@#......  Noise: ---------  Time: 7009.9 (0.0) ####/....  c) +0 dagger (protect)ki #....  Cast: Poisonous Vapours ###.   T   troll (very poisoned) _The troll looks even sicker.  kiCasting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki:Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineki{tAim: a troll (heavily wounded, very poisoned)kiZ(#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 651#.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 2/15===---------------------####...$$....##### #.... AC: 3kiStr: 7Doom: 9%##.##..#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16ki##T#.....#XL:  9 Next: 45% Place: Dungeon:6ki#@#......Noise: ---------  Time: 7009.9 (0.0)ki#####/....c) +0 dagger (protect)#....ki?UCast: Poisonous Vapours###.kiT   troll (burning, very poisoned)Confirm with . or Enter, or press ? or * to list all spells.kiAiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight linekitAim: a troll (heavily wounded, very poisoned)  kijThe sticky flame hits the troll!  The troll is almost dead.kid$Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a troll (heavily wounded, very poisoned)  The sticky flame hits the troll!  The troll is almost dead.  The troll is covered in liquid fire! The troll burns!ki]f 651 659===10.9 (1Poisonous Vapours kifR_You kill the troll!kilkiom _Your Conjurations skill increases to level 4!kiM.#.......#.#.........#####........#......#...########....K.$#.........####...$$....##### #.##.##..#...... ##...#.....#######.#..####/#....kikic3=---1 _kikik  You now have 672 gold pieces (gained 21).  Things that are here:kid72---2.9 (2kikiJ _a +0 short sword; a +0 short sword; 4 poisoned dartskiI #.##.....###........# ..#...#########K.$#......... ###...$$....##### ##.##..#...... ## #.....##### ##)#.....#  .###/ #   kiki ki+3.9 (1ki3ki%kikig  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 4.1   5.9  -1          ki b - Polearms   0.0   1.0   0   k + Conjurations 4.0   5.0   0  ki c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1   d - Throwing   0.0   1.0   0   m + Fire Magicki/1.8   2.0   0      n + Air Magicki)2.8   3.0   0   e + Short Blades   1.7   1.0   0 +4kig     f - Long Blades   1.0   1.0   0   o - Evocations   0.0   0.8  +1      ki [ p - Shapeshifting   0.0   1.2  -1  g + Dodging4.4   5.0   0       h - Shields   0.0   1.0   0      i + Stealth6.3   3.5  +4      kiQ            ki        ki        ki        ki     Skills enhanced by cross-training are in green. Bonus from skill manuals is in  ki.ored.  [?] HelpkiLG[=] set a skill target  ki}[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetski@ kiF ki[R #.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 672 #.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 3/15====--------------------####...$$....##### #.... AC: 3Str: 7Doom: 6%##.##..#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16##)#.....#XL:  9 Next: 59% Place: Dungeon:6#@#......Noise: ---------  Time: 7013.9 (0.0)####/kiU [40m....c) +0 dagger (protect)#....Cast: Poisonous Vapours###.      The troll is covered in liquid fire! The troll burns! _You kill the troll! _Your Conjurations skill increases to level 4!You now have 672 gold pieces (gained 21).  Things that are here: _a +0 short sword; a +0 short sword; 4 poisoned dartskiZ ki!\ ki1 Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft5% 1  b - Sigil of BindingHexes16% 3  c - Curse of AgonyNecromancy77% 5 2 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitkiְki8kiս#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 672 #.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 3/15====--------------------####...$$....##### #.... AC: 3Str: 7Doom: 6%##.##..#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16##)#.....#XL:  9 Next: 59% Place: Dungeon:6#@#......Noise: ---------  Time: 7013.9 (0.0)####/ki[40m....c) +0 dagger (protect)#....Cast: Poisonous Vapours###.      The troll is covered in liquid fire! The troll burns! _You kill the troll! _Your Conjurations skill increases to level 4!You now have 672 gold pieces (gained 21).  Things that are here: _a +0 short sword; a +0 short sword; 4 poisoned dartskiQP  Okay, then.kikiki=. _kikii Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e + Sticky FlameFire/Alchemyki-3% 4 Select a spell to describe [?] help [!]/[I] toggle spell headerski:kinki#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 672 #.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 3/15====--------------------####...$$....##### #.... AC: 3Str: 7Doom: 6%##.##..#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16##)#.....#XL:  9 Next: 59% Place: Dungeon:6#@#......Noise: ---------  Time: 7013.9 (0.0)####/ki[40m....c) +0 dagger (protect)#....Cast: Poisonous Vapours###.       _You kill the troll! _Your Conjurations skill increases to level 4!You now have 672 gold pieces (gained 21).  Things that are here: _a +0 short sword; a +0 short sword; 4 poisoned darts _Okay, then.kikimkikiki\>kiB  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 4.1   5.9  -1          kiMC, b - Polearms   0.0   1.0   0   k + Conjurations 4.0   5.0   0   c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1  kiC d - Throwing   0.0   1.0   0   m + Fire Magic1.8   2.0   0      n + Air Magic2.8   3.0   0  kiD e + Short Blades   1.7   1.0   0 +4    kiBD f - Long Blades   1.0   1.0   0   o - Evocations   0.0   0.8  +1      kiD p - Shapeshifting   0.0   1.2  -1  g + Dodging4.4   5.0   0  kiDY     h - Shields   0.0   1.0   0      i + Stealth6.3   3.5  +4  ki*E                ki}E                kiE            Skills enhanced by cross-training are in green. Bonus from skill manuals is in  kiFred.  [?] Help[=] set a skill target  kiLF}[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetski k * Conjurations   4.0ki p k - Conjurations   4.0ki=kiki7#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 672 #.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 3/15====--------------------####...$$....##### #.... AC: 3Str: 7Doom: 6%##.##..#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16##)#.....#kiT6XL:  9 Next: 59% Place: Dungeon:6#@#......Noise: ---------  Time: 7013.9 (0.0)####/....c) +0 dagger (protect)#....Cast: Poisonous Vapours###.       _You kill the troll! _Your Conjurations skill increases to level 4!You now have 672 gold pieces (gained 21).  Things that are here: _a +0 short sword; a +0 short sword; 4 poisoned darts _Okay, then.kiDkikikiFki4`kia2 Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic Cloudki2bXConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemyki_bL1%4  e + Sticky FlameFire/Alchemykic<3% 4 kicSelect a spell to describe [?] help [!]/[I] toggle spell headerskilRkiYki`#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 672 #.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 3/15====--------------------####...$$....##### #.... AC: 3Str: 7Doom: 6%##.##..#...... ##... EV: 14Int: 20kiua:#.....#####SH: 5Dex: 16##)#.....#XL:  9 Next: 59% Place: Dungeon:6#@#......Noise: ---------  Time: 7013.9 (0.0)####/....c) +0 dagger (protect)#....Cast: Poisonous Vapours###. ki3b      _You kill the troll! _Your Conjurations skill increases to level 4!You now have 672 gold pieces (gained 21).  Things that are here: _a +0 short sword; a +0 short sword; 4 poisoned darts _Okay, then.kihkiikinkiSpki6 ki; ,  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 4.1   5.9  -1           b - Polearms   0.0   1.0   0   k - Conjurations   4.0   5.0   0  ki;  c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1   d - Throwing   0.0   1.0   0   m + Fire Magic1.8   2.0   0      n + Air Magic2.8   3.0   0   e + Short Blades   1.7   1.0   0 +4    ki=  f - Long Blades   1.0   1.0   0   o - Evocations   0.0   0.8  +1       p - Shapeshifting   0.0   1.2  -1  g + Dodging4.4   5.0   0       h - Shields   0.0   1.0   0      i + Stealth6.3   3.5  +4                      ki=                         Skills enhanced by cross-training are in green. Bonus from skill manuals is in  red.  [?] Help[=] set a skill target  [/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targets¸ki-¸kiH¸kiU#.......#.#................ ludeguy the Toxicologist###.....###........#....... Octopode of Gozag Gold: 672 #.......#...#########.... Health: 64/64 ========================#....K.$#......... #.... Magic: 3/15====--------------------####...$$....##### #.... AC: 3Str: 7Doom: 6%¸kio##.##..#...... ##... EV: 14Int: 20#.....#####SH: 5Dex: 16##)#.....#XL:  9 Next: 59% Place: Dungeon:6#@#......Noise: ---------  Time: 7013.9 (0.0)####/....¸kic) +0 dagger (protect)#....Cast: Poisonous Vapours###. ¸ki       ¸ki@ _You kill the troll! _Your Conjurations skill increases to level 4!¸ki You now have 672 gold pieces (gained 21).  Things that are here: _a +0 short sword; a +0 short sword; 4 poisoned darts _Okay, then.¸ki4¸ki¸ki¸ki ¸ki9 ¸ki ¸ki( ¸ki< : _¸ki$ ¸kiv ¸ki} ¸ki ,¸ki ¸ki! ¸kie! ¸kir" ¸kiD% ,¸kii& ¸ki) ¸ki&* #4¸kiG* 1==¸ki, ¸ki- ¸ki- ¸ki. ¸ki1 ¸ki1 ¸ki2 ¸ki5 ,¸kiL7 ¸kih; s672==¸ki; ¸ki> ,¸ki? ¸ki ¸kig ,¸ki ¸ki ,¸ki$ ¸ki ,¸ki ¸ki ¸ki 9=¸ki ¸ki ¸ki ¸kiG ¸ki ,¸ki ¸kiE b2==¸ki ¸ki ,¸ki ¸ki ,¸kiR ¸ki] ,¸ki ¸ki P==¸ki ¸ki" ,¸ki ¸ki^ ¸ki ¸ki ¸ki ¸ki) K3=¸ki ¸ki ,¸kit ¸ki ,¸ki` ¸ki ,¸ki; ¸ki O=¸kiP ¸ki ,¸kim ¸kie! ¸ki! ¸ki" ¸ki$ b4==¸ki& ¸ki2( ,¸ki( ¸ki* ,¸ki+ ¸ki#- ¸kik- ¸kiB. ¸ki/ ¸ki 0 :==¸ki2 ¸ki3 ¸ki3 ¸kii5 ¸ki7 ,¸ki9 ¸ki; ¸ki< E5==¸ki3= ¸kiLA 4 _Magic restored.¸kiC 3¸kiE ¸kiH $  Things that are here:¸kiJ Y  a +0 short sword; a +0 short sword; 4 poisoned darts¸kiM ¸kiN  _¸ki&P ¸kigR ¸kiU ¸kiU ¸kiW ¸ki\ ,¸ki] :==¸ki{_ ¸kid M  You now have 678 gold pieces (gained 6).¸kie %8¸kif ¸kiJj > _You see here a +0 dagger.¸kim ¸kim ¸ki|o ¸kiw  You now have 688 gold pieces (gained 10).  Things that are here:8¸kiy ¸ki < ##...)......##.#.##....# .....#.........#........[...##....#..##.#.......#..........#..#.......#.#...........###.....###........#...#.......#...#########...#......$#......... #...####...@)....##### #...##.##..#...... ##..# #.....#######)#.....##.#......####/.... ¸ki} #.... ###. ¸ki5 # M#...........####...)##.#.##....# .....#.........#..........[...##....#..##.#..........#.......#.#.........#####........#....#...#########......@#.........####...))....##### #.##.##..#...... ##..###.....#####¸ki h..#### _a +0 short sword; a stone; a +0 club¸kiǔ 1104.9 (91.0)¸kiD ,5.9 (92¸kiީ ¸ki j  You now have 693 gold pieces (gained 5).  Things that are here:¸ki& 5936.9 (93¸ki ¸ki Z _a +2 whip of venom; 7 poisoned darts¸ki3¸ki;.  You see here a +0 dagger. _¸ki5,¸ki5¸ki=:,¸ki:¸kis>,¸kid?økic BøkiB T _e - a wand of paralysis (16) (gained 6 charges)øki3økiøki*øki6økiøkiøki Bøki!økiD#øki%øki%øki&øki,0øki2øki3økir5øki9økiG,øki4IøkiNøkiR,økiUøki[øki_økiXaøkiDgøkiShøkikøkiFløkioøkitøkiAx,økizøki]øki5,økiøki3øki,økiEøkiøkiøkiYøkiøki\økieøkiøkiøki.økiøkiCøkiøkihøkiøkiøkiøkiøki,økiøkiuøkiøkiøki?økiøki økitøkiBøkiøki^økiøkiøkiøkiøkiøkiDøkiIøkiøkiøkiOøki:økiqøkiøkiøkiøki'700økiøkiM _You now have 700 gold pieces (gained 7).økiøkiøkiøki$økiøki^økihøki'øki@,økiøkiCøkiøkiøki1w _f - 2 sedimented cyan potions (gained 1)økiS øki økio"øki$øki1(økio(øki@*økiS3 . ......... . #....... ..... [ ......###.:.. # #.....#.#...#  ?# ...........### øki3 ..$. .....# ...... ....###...## #.#..# #.....#.@...###.##.# ####.$#........###.$$..####..#.......## #..#..#.#.øki3+#...........####..#..#.....##................#.........#............##.....###..... øki4#...........##.......##..... ............###.#....#.....# økiD4u#...........###.#.##...##..# øki|6 W43.9 (37  k - a sapphire potionøki=W   phantom (wandering)øki>,4.9 (38økiEøkiJGX _You encounter a phantom.ĸki[[?25h[?0c  Search for what [Enter for "."]? ĸki B[?25l[?1c26 matches: travel [toggle: !], by dist [/], hide useless & duplicates [=]  a - [D:6] 16 gold pieces  b - [D:6] a scroll labelled JODEIS FAARIKHc - [D:6] 6 gold pieces  d - [D:6] 8 gold pieces  e - [D:6] a parchment of Launch Clockwork Bee  f - [D:6] 23 gold pieces  g - [D:6] a +0 orcbow  h - [D:6] a long sword  i - [D:6] 7 poisoned darts (4 further duplicates in 1 pile)  j - [D:6] a +2 whip of venomk - [D:6] a parchment of Hailstorm  l - [D:6] a stone staircase leading down  m - [D:6] a +0 club (2 further duplicates)  n - [D:6] a +0 dagger  o - [D:6] a +0 short sword (2 further duplicates)  p - [D:6] a stone  q - [D:6] a dagger  r - [D:6] a hand axe  s - [D:6] a +0 halberd  t - [D:6] a sling  u - [D:6] a +0 flail (1 further duplicate)  v - [D:6] a stone staircase leading up [Up|Down] select [PgDn|>] page down [PgUp|<] page up [Esc] exit[top]Ÿki   c - [D:6] 6 gold pieces  d - [D:6] 8 gold pieces  ea parchment of Launch Clockwork Bee  f - [D:6] 23 gold piecesg+0 orcbow  ha long sword  i7 poisoned darts (4 further duplicates in 1 pile)  j - [D:6] a +2 whip of venomka parchment of Hailstorm  l - [D:6] a stone staircase leading down  m+0 club (2 further duplicates)  n+0 dagger  oshort sword (2 further duplicates)  pstone  qdagger  rhandŸki ) axe  s+0 halberd  tsling  uflail (1 further duplicate)  vtone staircase leading up  wtrident  x - [D:6] a +2 whip of pain50%Ƹkiq3a - [D:6] 16 gold pieces  b - [D:6] a scroll labelled JODEIS FAARIKH  d - [D:6] 8 gold pieces  f - [D:6] 23 gold piecestopƸki d - [D:6] 8 gold pieces  f - [D:6] 23 gold piecesw - [D:6] a +0 trident  x - [D:6] a +2 whip of pain50%Ƹki f - [D:6] 23 gold pieces  n - [D:6] a +0 daggery - [D:6] a stone staircase leading up  Ƹkihz - [D:6] a stone staircase leading downbotǸki&r b - [D:6] a scroll labelled JODEIS FAARIKHc - [D:6] 6 gold pieces  d - [D:6] 8 gold pieces  e - [D:6] a parchment of Launch Clockwork Bee  n - [D:6] a +0 dagger25%Ǹki{ǸkiǸkiuD.. ludeguy the Toxicologist........... Octopode of Gozag Gold: 700#....... ..... [. Health: 64/64 ========================......###.:..# Magic: 15/15 ========================#.....#.#W..#AC: 3Str: 7Doom: 6%?# ...........### . EV: 14Int: 20..$. .....# ...... . SH: 5Dex: 16Ǹkib....###...## #.#..# #. XL:  9 Next: 59% Place: Dungeon:6.....#.@...###.##.# ###. Noise: ---------  Time: 7144.9 (0.0)#.$#........###.$$..###... c) +0 dagger (protect)##..#.......## #..#..#.#... Cast: Poisonous Vapours#...........####..#..#.....##................#.........#............##.....###..... W   phantom (wandering)#...........##.......##.................###.#....#.....##...........###.#.##...##..# ǸkiÍ_e - a wand of paralysis (16) (gained 6 charges) _You now have 700 gold pieces (gained 7). _f - 2 sedimented cyan potions (gained 1)  k - a sapphire potion _You encounter a phantom.Search for what [Enter for "."]? .ǸkiǸkiZǸki Ǹki{. _ǸkiBJ  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ȸkiX _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ȸkiܭ ... .... ..#. ..... [..#......###.:.. ## #.....#.#W..# ?###...........### ...$........# ...... .ȸki[ ....###.@.## #.#..# #. .....#.....###.##.# ###.$#..###.$$..###.##..### #..#..#.#.####..#..##....#.....#.#.....###.#ȸki \##.......#..###.#....#.....#ȸki= $.ȸkif 'Wȸki ȸki )5.9 (1 ȸki _ȸki ȸkil ɸki... ludeguy the Toxicologist............. Octopode of Gozag Gold: 700............ Health: 64/64 ========================#....... ..... [.. Magic: 13/15 ====================----#......###.:..## AC: 3Str: 7Doom: 6%#.....#.#...#EV: 14Int: 20?###......*W...### .. SH: 5Dex: 16..$......**# ...... .. XL:  9 Next: 59% Place: Dungeon:6....###.@.##[4ɸkiv0m #.#..# #.. Noise: ---------  Time: 7145.9 (0.0).....#.....###.##.# ###.. c) +0 dagger (protect)#.$#........###.$$..###.... Cast: Poisonous Vapours##..#.......## #..#..#.#....#...........####..#..#......##................#.......... W   phantom (weak)#............##.....###......#...........##.......##.....#............###.#....#.....##Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (wandering, hasn't noticed you, chance to weaken: 76%)  The glob of mercury hits the phantom. The phantom looks weaker.ɸkif1W.ɸki&..ɸki4==6.9 (1ɸki1ɸkionfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (wandering, hasn't noticed you, chance to weaken: 76%)  The glob of mercury hits the phantom. The phantom looks weaker. _The phantom is lightly damaged.ɸkiT ... ludeguy the Toxicologist............. Octopode of Gozag Gold: 700............ Health: 64/64 ========================#....... ..... [.. Magic: 11/15 =================-------#......###.:..## AC: 3Str: 7Doom: 6%#.....#.#...#EV: 14Int: 20ɸkiˡ ?###......W....### .. SH: 5Dex: 16..$......**# ...... .. XL:  9 Next: 59% Place: Dungeon:6....###.@.## #.#..# #.. Noise: ==-------  Time: 7146.9 (0.0).....#.....###.##.# ###.. c) +0 dagger (protect)ɸki #.$#........###.$$..###.... Cast: Poisonous Vapoursɸki% ##..#.......## #..#..#.#....#...........####..#..#......ɸkiJ '##................#.......... W   phantom (weak)#............##.....###......ɸki r#...........##.......##.....#............###.#....#.....##ɸki NCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  ɸkiP Press: ? - help, Shift-Dir - straight lineAim: a phantom (lightly damaged, weak, chance to weaken: 76%)  The glob of mercury hits the phantom.ɸki$ K.Wɸkiy. #...ɸkiT/ +7.9 (1ɸki87 ɸki9 onfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (lightly damaged, weak, chance to weaken: 76%)  ɸki: The glob of mercury hits the phantom. _The phantom is moderately damaged.ʸki SHIFTʸkiz K.Wʸki ʸki" /--8ʸki ʸki ˸ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.˸ki ... ludeguy the Toxicologist .......... ... Octopode of Gozag Gold: 700 ......... ... Health: 64/64 ======================== #....... ..... [.. Magic: 7/15===========------------- #......###.:.. ## AC: 3Str: 7Doom: 6% #.....#.#...#  EV: 14Int: 20 ?###...........### .. SH: 5˸ki"Dex: 16 ..$........# ...... .. XL:  9 Next: 59% Place: Dungeon:6 ....###.@W## #.#..# #.. Noise: ---------  Time: 7148.9 (0.0) .....#.....###.##.# ###.. c) +0 dagger (protect)˸kiB #.$#........###.$$..###.... Cast: Poisonous Vapours˸kiu- ##..#.......## #..#..#.#.... ˸ki#...........####..#..#......  ##................#.......... W   phantom (weak) ˸ki #............##.....###......  #...........##.......##.....#  ............###.#....#.....## _The phantom is moderately damaged.Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.˸ki&Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line˸kiG}Aim: a phantom (moderately damaged, weak, unstickable)˸kiD ... ludeguy the Toxicologist............. Octopode of Gozag Gold: 700............ Health: 64/64 ========================#....... ..... [.. Magic: 7/15===========-------------#......###.:..## AC: 3Str: 7Doom: 6%#.....#.#...#EV: 14Int: 20?###...........### .. SH: 5Dex: 16..$........# ...... .. XL:  9 Next: 59% Place: Dungeon:6....###.@W## #.#..# ˸kiD G[34m#.. Noise: ---------  Time: 7148.9 (0.0).....#.....###.##.# ###.. c) +0 dagger (protect)#.$#........###.$$..###.... Cast: Poisonous Vapours##..#.......## #..#..#.#....#...........####..#..#......##................#.......... W   phantom (weak)#............##.....###......#...........##.......##.....#............###.#....#.....##Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (moderately damaged, weak, unstickable)  The sticky flame hits the phantom!˸kiS Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (moderately damaged, weak, unstickable)  The sticky flame hits the phantom!  The phantom is severely damaged.===9.9 (1˸ki  ˸ki ˸ki '_You block the phantom's attack.˸kiCJ  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.̸ki ... ludeguy the Toxicologist .......... ... Octopode of Gozag Gold: 700 ......... ... Health: 64/64 ======================== #....... ..... [.. Magic: 3/15====-------------------- #......###.:.. ## AC: 3Str: 7Doom: 6% #.....#.#...#  EV: 14Int: 20 ?###...........### .. SH: 5Dex: 16 ..$........# ...... .. XL:  9 Next: 59% Place: Dungeon:6 ....###.@W## #.#..# #.. Noise: ===------  Time: 7149.9 (0.0) .....#.....###.##.# ###.. c) +0 dagger (protect) #.$#........###.$$..###.... Cast: Poisonous Vapours ##..#.......## #..#..#.#.... #...........####.̸ki3.#..#......  ##................#.......... W   phantom (weak)  #............##.....###......  #...........##.......##.....#  ............###.#....#.....## _You block the phantom's attack.  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (severely damaged, weak, unstickable)̸ki_... ludeguy the Toxicologist............. Octopode of Gozag Gold: 700............ Health: 64/64 ========================#....... ..... [.. Magic: 3/15====--------------------̸ki#......###.:..## AC: 3Str: 7Doom: 6%#.....#.#...#EV: 14Int: 20?###...........### .. SH: 5Dex: 16̸ki..$........# ...... .. XL:  9 Next: 59% Place: Dungeon:6....###.@W## #.#..# #.. Noise: ===------  Time: 7149.9 (0.0)̸ki.....#.....###.##.# ###.. c) +0 dagger (protect)̸ki#.$#........###.$$..###.... Cast: Poisonous Vapours̸ki ##..#.......## #..#..#.#....#...........####..#..#......̸ki*##................#.......... W   phantom (weak)̸kiJ#............##.....###......#...........##.......##.....#̸kim............###.#....#.....##Casting: Sticky Flame (dangerous; 3% risk of failure)  ̸kiMConfirm with . or Enter, or press ? or * to list all spells.̸kiAiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line̸kiAim: a phantom (severely damaged, weak, unstickable)  The sticky flame hits the phantom.̸kiԷ/§Wonfirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 3% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (severely damaged, weak, unstickable)  ̸ki2The sticky flame hits the phantom.  The phantom is almost destroyed.̸kiME#....... ..... [ #......###.:.. #. #.....#.#...# .?###...........### ̸ki..$........# ...... .....###.§§## #.#..# #......#.....###.##.# ####.$###.$$..###.##..#.....@.## #..#..#.#.#..........W####..#..#...##.........#..........##.....###.̸ki .##.......## .###.#....#.....# ##.#.##...##..# ##...)......##.#.##....#... .....#.........#...........̸kifK2-̸ki?%50.9 (1̸kiJ` _The phantom hits you. The phantom blinks! You blink.̸kiZJ  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.̸ki' 4̸kid ̸ki P _You don't know that spell.̸ki}Equip or unequip which item?  - - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7} Armour (go to first with [)  l - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv} Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)g - an amulet of guardian spirit  j - an amulet of chemistry Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip ͸ki ͸ki a#....... ..... [. ludeguy the Toxicologist#......###.:..# Octopode of Gozag Gold: 700. #.....#.#...#͸ki5 Health: 62/64 =======================-.?###...........### . Magic: 3/15====--------------------..$........# ...... . AC: 3Str: 7Doom: 6%͸ki ....###.§§## #.#..# #. EV: 14Int: 20.....#.....###.##.# ###. SH: 5Dex: 16͸kiġ F#.$#........###.$$..###... XL:  9 Next: 59% Place: Dungeon:6͸ki ##..#.....@.## #..#..#.#... Noise: ===------  Time: 7150.9 (0.0)#..........W####..#..#..... c) +0 dagger (protect)##................#......... Cast: Poisonous Vapours͸ki #............##.....###.....#...........##.......##.................###.#....#.....# W   phantom (weak)#...........###.#.##...##..###...)......##.#.##....#........#.........#...........͸ki The sticky flame hits the phantom.  The phantom is almost destroyed. _The phantom hits you. The phantom blinks! You blink.  ͸ki *Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. ͸ki. ;_You don't know that spell.͸ki  Okay, then. _θkiJ  Casting: Sticky Flame (dangerous; 3% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.θkiθkioθkiMθkiN"e _You don't have enough magic to cast this spell.θkix$4θki,θki>/F _Unknown command.θki  You miss the phantom. Your squeeze misses the phantom.The phantom is almost destroyed.θki >3--1.8 (0.9θki θkia# M _The phantom misses you.ϸki  You closely miss the phantom.The phantom is almost destroyed.ϸkigh4==--2.7ϸki+ϸki25 _You block the phantom's attack.ϸki $You puncture the phantom!  Your weapon exudes an aura of protection.ϸki#h..ϸki 700 ==10 5633.6 _You destroy the phantom!ϸki#......###.:.. ##. #.....#.#...#  .?###...........### ....$........# ...... .....###...## #.#..# #.ϸkixf.....#.....###.##.# ###.#.$#........###.$$..###...##..#.## #..#..#.#.#.....####..#..#...##......#.....#..##.....####.ϸki##.......##.....#..###.#....#.....######.#.##...##..##...)......##.#.##....#......#.........#...............[...##....#..##ϸkiϸkiSc4=-4.6 (1.0ϸki6-5.6 (2 _You now have 706 gold pieces (gained 6).ϸkiY d. #.....#.#...#  .?###...........### . ..$........# ......  ....###...## #.#..# # .....#.....###.##.# ####.$#...$$..###.#..### #..#..#.# #....####..#..#.#......#... ##.....### #.......## .###.#....ϸki E #.###.#.##...##.. ##...)......##.#.##....#... .....#.........#............[...##....#..## #.......#..........ϸkiU ϸkiQ > 3 6.6 (1ϸki$ ϸki~% ϸki+l .?###...........###..$........# ...... ...###...## #.#..# # .....#.....###.##.# ####.$#...$$..###.#..### #..#..#.# #....####..#..#.#......#... ##.....### #.......## .###.#.... #.###.#.##...##..ϸkilm ##...)......##.#.##....#.. .....#.........#........[...##....#..## #.......#.......... #.#.#.ϸkivϸkiv&7ϸkiI~ϸkiиki Wear or take off which item? Armour (go to first with [)  l - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}[?] describe selected [!] equip|wield|wear|put onиki/y[tab] equip|unequip Ӹki UPut on or removepiece of jewellery? Jewellery"=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn) Ӹki  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)g - an amulet of guardian spirit  j - an amulet of chemistry Talismans (go to first with %)a - a riddle talismanwear|put onոkic ոki ոki¢ .?###...........###ludeguy the Toxicologist...$........# ......Octopode of Gozag Gold: 706 .....###...## #.#..# # Health: 64/64 ========================.....#.....###.##.# ### Magic: 4/15======------------------ոkiA #.$#........###.$$..###.. AC: 3Str: 7Doom: 5%##..#.......## #..#..#.#.. EV: 14Int: 20#...........####..#..#.... SH: 5Dex: 16##................#........ XL:  9 Next: 63% Place: Dungeon:6ոkiz Y#.........@..##.....###.... Noise: ---------  Time: 7157.6 (0.0)#...........##.......##.... c) +0 dagger (protect)............###.#....#..... Cast: Poisonous Vapoursոki ?#...........###.#.##...##..##...)......##.#.##....#.......#.........#.......... ոkio ......[...##....#..##...... #.......#..........#....... #.......#.#................ The phantom is almost destroyed. _You block the phantom's attack.  You puncture the phantom!  Your weapon exudes an aura of protection. _You destroy the phantom! _You now have 706 gold pieces (gained 6).ոkiX P  Okay, then.ոki ոkit ոki . _ָkiָkigָkiEָkisF _Unknown command.ָki ָki Wear or take off which item? Armour (go to first with [)  l - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}ָkiD c[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip ׸kil - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}. A piece of wood and metal, to be strapped on one arm for defence. It is cumbersome to wear, and impedes the evasion, spellcasting ability, and attack speed of the wearer. These penalties are reduced by the wearer's Shields skill and Strength; mastering Shields eliminates penalties. Base shield rating: 8 Encumbrance rating: 10 Max blocks/turn: 3 Rampage: It causes one to take an extra step when moving towards enemies,briefly stunning them if this results in an attack. Dex+3: It affects your dexterity (+3). Slay-6: It affects your accuracy & damage with ranged weapons and melee (-6).SInv:׸ki,It lets you see invisible. It cannot be enchanted further. If you switch to wearing this armour: Your EV would decrease by 2.8 (14.2 -> 11.4). Your SH would increase by 10.5 (5.0 -> 15.5). Your spell failure would worsen by up to 22% (press '!' for details). This ancient artefact cannot be changed by magic or mundane means. You took it off a gnoll sergeant on level 5 of the Dungeon.ܸkiWear or take off which item? Armour (go to first with [)  l - the +2 kite shield "Riow" {Rampage Dex+3 Slay-6 SInv}  [?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip ܸkiJܸki#Rܸki=[.?###...........###ludeguy the Toxicologist...$........# ......Octopode of Gozag Gold: 706 .....###...## #.#..# # Health: 64/64 ========================.....#.....###.##.# ### Magic: 4/15======------------------#.$#........###.$$..###.. AC: 3ܸki\*Str: 7Doom: 5%##..#.......## #..#..#.#.. EV: 14Int: 20#...........####..#..#.... SH: 5Dex: 16##................#........ XL:  9 Next: 63% Place: Dungeon:6#.........@..##.....###.... Noise: ---------  Time: 7157.6 (0.0)#...........##.......##.... c) +0 dagger (protect)............###.#....#..... Cast: Poisonous Vapours#...........###.#.##...##..##...)......##.#.##....#..ܸkib\.....#.........#.......... ......[...##....#..##...... #.......#..........#.......ܸki\p #.......#.#................ You puncture the phantom!  Your weapon exudes an aura of protection. _You destroy the phantom! _You now have 706 gold pieces (gained 6). _Okay, then. ܸki0]1_Unknown command.ܸkidP  Okay, then.ܸkieܸkilܸkio. _ܸki ܸkic ܸkiR ܸki F _Unknown command.ܸki.ܸki/ܸkiB2ܸkiI5ܸki9: _ܸkiB;ܸki;ܸki=ܸki@ܸkiAAT5==ܸki+CܸkilFܸkiFܸkiHܸkiKܸkiL#706ܸkiMܸki$P,ܸkiQܸki"UP==ܸkiVܸkiZܸkiwZܸki\ܸki_ܸki_ܸkiaܸki)eܸkixeS6=ܸki@gܸkijܸkiRjܸki lܸki-oܸkikoܸkiqܸkis,ܸkiuܸki yO=ܸki{ܸkiR}ܸki}ܸkiUܸkiܸkiܸkiܸkiܸki_T7==ܸki0ܸki8ܸkiܸkiܸkiܸki4ܸkiܸkiΖܸkiܸkiܸۘkiܸki:==ܸkiܸkioܸkiܸkixܸki,ܸki!ܸkiܸkiOM8=ܸki!ܸki},ܸki6ܸkiܸki)ܸkiܸkiKܸkiܸki5ܸkiܸki2=ܸkiܸkiܸki?ܸkiܸki,ܸkiܸkiܸkiaN9==ܸkiNܸki,ܸkiܸkig,ܸki9ܸki'ܸkiaܸkiSܸki%ܸki:==ܸki2ܸki$ܸkimܸkiܸkiܸkiܸkiܸkiaܸkiR10/15==ܸki8ܸkiܸki=ܸkiXܸkiܸki!ܸkiܸkiܸkiܸkiܸkiܸki:==ܸkiܸkiܸkiܸkiBܸkiܸki ܸki ܸki ܸkiܸki#%1ܸkiQ(=ܸki?ܸkiܸkiܸkiܸkiܸki4 ܸkiX#ܸki%ܸki%ܸki'ܸkiF+ܸki+#=ܸki+ܸkiz-ܸki%0ܸkio0ܸkiL2ܸki(5ܸkis5ܸki<7ܸkis:ܸki:62==ܸki:ܸkiS<ܸki>,ܸki>ܸki@ܸki,Aݸkiݸkiݸki?ݸkiݸkiݸkip:==ݸkid ݸki ݸki ݸkixݸkiV,ݸkinݸkiMK3=ݸki$ݸkiݸkiݸkiTݸkiݸki!ݸki!ݸkij#ݸkiw%ݸki%ݸki&ݸkip)ݸki)9=ݸkiS+ݸki.,ݸki0ݸki2,ݸki3ݸki6ݸki6L4==ݸki8ݸkih;ݸki;ݸki"=ݸki?ݸki @ݸkiAݸkiiC,ݸkiDݸkiGݸki H:==ݸkiIݸkiLݸkiLݸkiNݸkiP,ݸkiQݸkiSݸki3TݸkiXTE5==ݸkiVݸkiZݸki]ݸki5^ݸki%`ݸkitbݸkidݸkidݸkifݸkijݸkijl,ݸkinݸkipݸkisݸki>t:==ݸkiuݸkixݸkiX{ݸki{ݸki}ݸkiݸkiJݸkiݸkiݸkiaݸki&14ݸkihݸkiM _You now have 714 gold pieces (gained 8).ݸki3ݸki~ݸki?ݸkiDݸkiݸkiݸkiΘݸkiݸkiݸkiݸki<30ݸkiݸki@N _You now have 730 gold pieces (gained 16).ݸki3ݸkiĤݸkiqF ..# #..##... ..........  #.... ......... ݸki #....## #....... .....  ##.....###......###.:..  #...!...# #.....#.#...# ݸkiܪ ###...........## .##..............# .ݸki ##......###...## #.#ݸki& #........#.....###.##ݸkic ###..#........###.$$ ##..#.......## #..# ݸki#...........####..# ݸki##................# #............##.....##ݸki71243.6 (86.0)ݸkiı,4.6 (87ݸki ݸki!d _c - a scroll labelled JODEIS FAARIKHݸkiTݸkiʖݸki—ݸki!ݸki,ݸki>,ݸkiiݸkiݸki٥ݸkiұݸki%,ݸki۶ݸkiϻݸki&ݸkiݸki:u _j - 4 bubbling grey potions (gained 1)ݸkiݸkiEݸkiݸkiCݸki2ݸki{ݸkiyݸkiݸkijݸkiݸki7ݸki"ݸkiݸkiݸkiݸkiݸkiݸkiݸki ݸkiݸki$ݸkiuݸkiNݸkiݸki9ݸkiݸkiݸkiEݸkiݸkiݸkiݸki4ݸki,ݸkiݸkiݸkiݸkiUݸkijݸkibݸkiAݸkiݸkiݸki ,ݸki ݸkiy _n - 2 bubbling amethyst potions (gained 1)ݸkiݸkiݸkiݸkiݸkiݸkiݸkiݸkiݸkiR,ݸki6ݸki ݸkif"ݸki"ݸkit#ݸki)&ݸki),ݸki+ݸki.ݸki31ݸki1ݸki3ݸki5ݸki8ݸki&9ݸki:ݸki[=ݸki@j  A bullfrog comes into view.ݸki*J.....#..............#..#... ....^..##....##.......#. ..#... ...##..##...# .......... ....... ...........## #......... ....... ݸki|J..##........###........F ....... #.....................# ....... #.....................# ......# ݸkiJ.....#.............:#.#. ....#.. ݸkiJ8....####........@....... [...#.. .....###......###.:..... ## ݸkiJR......###.....#.#...###. ..) ......###...........### ..... ݸki+K #..............# ...... .... ##......###...## #.#..# #....ݸkiZKF   bullfrog (wandering) #........#.....###.##.# ###......ݸkiK ###..#........###.$$..###........ݸkiL  ##..#.......## #..#..#.#........ݸkiiL,67.6 (23ݸkiSݸkiT38.6 (24 _ݸkiYݸkiZݸkiP  ^#.......#. ...# .......... ....## #......... ......###........F .................# ..................# .#.............:#.#. .####........@....... [..###......###.:..... ....###.....#.#...###. ..).###....###  ......  #.#..# .##.# $$..#   ݸki3 ' ^#.......#. ...# .......... ....## #......... ......###........F .................# ..................# .#.............:#.#. .####........@....... [ݸki4 #..###......###.:..... ....###.....#.#...###. ..).###....###  ......  #.#..# .##.# $$..#   ݸki= ݸki> ݸkikF ݸkiH _ _A bullfrog is nearby!޸ki......#..... #....#..............#.#.. ..#.^..##....####...)##..##...# ...........## #.. . .##........###F. . ......# ...........# ......##.#.....@.:#.#. ....#.####..........# [...#..###......###.:...... ##....###.....#.#...###.. ..) .....###...........### . . ........##...... .###...####.#..# #. ........#.##.# ### ##..#.#.$$..###.޸ki|5F.޸ki}5F.޸kiP ޸ki 89.6 (1.0) _޸kic޸kiqe޸ki.###......#.... ###....#..............#.#... ..#....)^..##....####...)[##..##...##.......F...$. ...## #.. #####.....# .....# ......##...:#.#. ....#.####..........# [...####......###.:...... ##....###.....#.#...###... ..)###...........### .. . .......##...... # .###...####.#..# #. .......###.# ###޸kie1F.޸ki޸ki'70޸ki ޸ki + _Found 18 gold pieces.޸ki|_###..... #. ...### #......#.... ###........)#..............#.#......#....). .^..##....#.#......#...)[ ##..##...##......F....$# ..## #. ####.....# .....# ......##...޸ki:#.#. ....#. .####..........# [...####......###.:...... ##....###.....#.#...###.... ..)###....####..........##...... .#..###...####.#..# #.޸ki G.F޸ki'D.F޸ki.޸ki?1Poisonous Vapours޸ki޸ki޸ki v U###..... #. #.##.......# ##.)#.... ###.). .#..#.#......#....). ^..##....##.#......#...)[.# #..##...##.$.### #.# .###......F.# .#.# ......##. .#.:#.#. ....#. ####.....# [...#. .###......###.:...... ##.޸kiv ###.....#.#...###.... ..).###.....####....##...... .#..####...####.#..# #.޸ki ^FF޸ki6 .=2޸kiL ޸ki V _The bullfrog closely misses you.޸kih $You puncture the bullfrog!  Your weapon exudes an aura of protection.  You grab the bullfrog. You squeeze the bullfrog!޸ki R޸kic  730 10 473.5 (0.9Poisonous Vapours _You kill the bullfrog!޸ki ޸ki m _Your Short Blades skill increases to level 2!߸kic4߸ki߸kiH _No target in view!߸ki#4߸ki,߸ki./H _No target in view!߸ki!  ### #..##)###.....#.#..... #.).##.......## ## .......#...###........) #..............#.#......#....)... ..##.#......#...)[##...##..$## ## #..#####............#..........#. ....# .#......## #...:#.#. #....#. ###..........# [...# ###......###.:...... ##.... .###.....#.#...###.... ..)###....####...........##...... .#..#߸ki; ߸ki <-4.5 (1.0 _߸kiI ߸kip ߸ki a5-5.5 (2߸kiV ߸kiU > _You now have 735 gold pieces (gained 5).kiL.###.....#.#..... #...........##.......## ##)#...........####......#.#......#....) ^..##....##.......#......#...)[.# #..##....$.............## #...#..###.....#..........#.# .#......## .#:#.#. #....#.. ####kiM?......# [...# .######.:...... ##. ..###.....#.#...###.... ..).###...........####....... ....##...... .#.####...####.#..# #.ki8WkiBX> 3 6.5 (1ki_kiaki3s...#.......## ###...........####..............#.#......#....)^..##....##.......#......#...)[ ##..##...#....$........ ........## #... #..###......#....#.# .###:#.#. #....#..###......# [...# ..###ki2t###.:....... ##. ...###.....#.#...###.... ..).###...........####..........##...... .#.###...####.#..# #...#.....###.##.# ###kiki&7kikikiQ~R#....##........#.#......#....)^..##....##.......#......#...)[##..##...##....$........ .........## #.. ##..###ki(.. ....#.#.# .###:#.#. #....#..###......# [...# ...######.:....... ##...###.....#.#...###.... ..).###...........####..........##...... .#kiv###...####.#..# #..#.....###.##.# ### #..#...$$..###.kikit&8ki*kiMkiw M #.#.#......#....)^..##....##......)[####....$......... .........## #. ##.##.. .....#.## .###:#.#.##....#...####.....# [.kix 1###.:....... ##...###.....#.#...###.... ..).#..$$..# #..#.......## #..#..#.#.......... ki ki &9kiP kir ......#...###........)#..............#.#......#....). .^..##....###......#...)[ ##..##...##..$.# ..ki## #. ####..#......ki..# .#......##...#.#.##....#. .ki }####..........# [...#kiF###......###.:........##....###.....#.#...###.... ..)###kikR....####...ki......##...... .#..ki###...####.#..# #. ......#ki#.##.# ### ..#.#.$$..###.kiki'80kiki)f  You pick up a parchment of Diamond Sawblades and begin reading...ki+1.5 (2ki#ki%J _You add the spell Diamond Sawblades to your library.ki i#......#.#......#....)^..##....##.......#......#...)[##..##...##....$........ .........## #... ##..### ....##.# .####.#.##....#..###.....# [...# ...######.:........##...###.....#.#...###.... ..).###...........####..........##...... .#kix ###...####.#..# #..#.....###.##.# ### #..#...#.$$..###. #..# #..#..#.#ki ki. +2.5 (1kiR ki ki  ^..##....##......)[####....$......... .........## #.. ##.##.. .....#.#.# .####.#.##....#...####ki ....##[....###...##...###.....#.#...###.... ..)......####...............#ki ...#..# ...........####..#..#............ ki9 ki} ki &3kin kiu  You pick up a parchment of Launch Clockwork Bee and begin reading...4.5 (2 _You add the spell Launch Clockwork Bee to your library.ki  ####....$......... .........## #... ##.##.. .....#...## .###.......#.#.##....#...####................##[....###...##...###.#.@.###.... ..).........####.................##...... .##.....# ................#................ 5.5 (1ki ........## #. ##.##. .......#...#... .###..............#.#.##....#...####................##[.###..........##...###.....#.#...###.... ..)......#...........ki"##........####...####.#..#####...#. ...........##.....###............ ki!ki4&6kikiki ##.## .....##...# .###......#.#.##....#...####.........##[....###..........##...###.....#.#...###.... ..)......####.................##.@......####...####.#..#####.#.....###.##.# ##.##.... ..........##.......##.....##..... 7kiDkiki%  .....##. .###.....#.#.##....#...ki% J####.........##[.###..........##...###.....#.#...###.... ..)ki% .........####.................##........#ki5& L###...####@#..#####kiU& .#.....###.##.# ## #..#........###.$$..###..kit& `#..#...ki& ..##.......##.. ki& o..........###.#....#.....###..... ki. kir/ &8ki5 ki7 kiG   .###.....#.#.##....#...####....##[.###..........##...###.....#.#...###.... ..)...#...........##........####...####.#..#####.#.....###@##.# #..#........###.$$..###..## #..#..#.#....#.#....#.... ..........###.#.##...##..##...... ki &9ki kiU ki  ##.#.##....#...####....##[.###...##..ki .###.....#.#...###.... ..)......####...........##........####...####.#..#####.#.....###.##.# ki! #..#........###.@$..###..## #..#..#. ....kiK w##..#..#...kit z##.......##.#ki .#.#.##.. #...)......##.#.##....#...#...... ki kiFki*735ki) 90kickiki(4411.5 (2kickiL> _You now have 741 gold pieces (gained 6).kis#.#.#.##....#. .####.........##[...#.###......###..........##.###.....#.#...###.... ..).###.....####.##........#.###...####.#..#####.#.....###.##.# ###. ..#.###..@..###. ..#.## #..#..#.#.####..#..#....#......##.....###...##.......##.....##.###.#....#.....###.###.#.##...##..##. ...)......##.#.##....#...#.kiA2.5 (1ki kiN  You now have 764 gold pieces (gained 23).ki4643.5 (2kiϟki+/ _You see here a +0 orcbow.ki[ ki[ ki\ kib ki e kite kih kivi kij ki%k kil kiVp kir kiGr kis kiw ki y ,ki\z ki ~ kil ,ki ki ki ,ki kig ki ki2 ki ki kic kiœ ki kiɕ ki ki kiӗ ki ki" kiX kiٝ ki ki ki ki ki ki kiH ki ki ki ,ki ki6 ki ,ki ki <82ki ki N _You now have 782 gold pieces (gained 18).ki kin kiR t .....#..#...## ..##. .......##  .....#.... ......[###.[..#  ###.... #/.... #........##).<# ##.....#.#..... #.........)#####.......## ##........)..###...........###........)...#..#......#....) #....##.......#.@....#...)[.## #...##.....................## ##ki ## #.....................#######.................).....#..........#.....#..#......##.....##...#.#.##....#.........#.......##[...#...ki5 ...###..........##..... 309.5 (16.0)  A malevolent force fills the Dungeon...ki /  --more--kir :*ki ==========Mark With a horrendous wail, an alarm goes off!  A sentinel's mark forms upon you.kif7@ki0* _You hear a shout! x4ki2  )......#....#. #.. .....#..#...## ...##.. .......###.... .....#..... ......[###.[..  ###.... #/.... #........##).< ###.....#.#..... #.........)...##.......## ##........)..##...........###........)...# .......#.#@.....#....).. ##....##.......#......#...)[.##. ##...##........... ## #..........#######...........)......#....#............#..#......##....#.#.##....# #................##[...#ki ki h--------- 10.0)ki_ ki kiM )......#.# ##.## )......#....#. #... .....#..#...# ...##... .......###. .....#...... [###.[. . ###.... #/....####). .###.....#.#...... #.........)...## ##........)..#.........@.###........) ..............#.#......#....).. .##....##.......##...)[.##. .##...##.........  #........######................#....#............#..#......## .#.#.##....#kisWkiuXG---------1kiWfki+4 #.... .# .)......#.# ##.###.)......#...#. #...#......#.. ...##.... .......###. # .....#...... [###.[. ###.... #/....##ki,B##)###.....#.#......# #..)...## ##..)#ki,<.....###........) #..............#.#......#....).. ..##....##.......#ki-C#...)[.#kiR-##...#.....## #...##ki-e###...........ki-.#....#...#..#......##ki125ki3y oYou encounter an ufetubus.ki;7  You encounter an orc. It is wielding a +0 flail.kiE ee   Duvessa5   ufetubuso   orc .................#..#......##....  You encounter Duvessa, Sister of Dowan. She is wielding a +0 short sword.kiT/  --more--kiUk.5ki4`kiaQ 2Poisonous Vapours _kijkki|kio..# .)......#..e# ##.###.)......#.#. #...#......#..#...#.##.... .......##.....#5..... ......[###.[ . ###.... #/....## #..##). .###.....#.#......# .)#......##.......## ##.)..#....#..)...#.#......#....).. .##....##.......#......#...)[.## .##...##...............## ...## .....####...............#...##..###.....iw49m#.#.##....#.....5oki@.ekigkiK .eki=$e   Dowan5   ufetubuso   orckiĴYou encounter Dowan, Brother of Duvessa. He is wielding a +0 dagger and wearinga +1 robe of resistance.ki/  --more--kiki ki 5 3 _kikikiki|URead which item? kipVScrolls  a - 2 scrolls of enchant armourW - 2 scrolls of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedkikiki^ ...# .)......#.... ludeguy the Toxicologist.oe# ##.###.)......#.... Octopode of Gozag Gold: 782.e#. #...#......#..#...# Health: 64/64 ========================...##.... .......###... Magic: 15/15 ========================.....#...... ......[###.[. AC: 3Str: 7ki Doom: 4% . ###.... #/5...## #........##). EV: 14Int: 20 .###.....#.#......# #.........)# SH: 5Dex: 16 ki 6........##.......## ##........).. XL:  9 Next: 67% Place: Dungeon:6 ki -......#.........@.###........)... Noise: ---------  Time: 7313.5 (0.0) kic ..............#.#......#....).... c) +0 dagger (protect) ki &.##....##.......#......#...)[.##. Cast: Poisonous Vapours .##...##.....................## # Mark .....## #.....................### ......###........................ e   Duvessa ................#..........#..... e   Dowan ................#..#......##..... 5   ufetubus ..............#.#.##....#........ o   orc ki g_You hear a shout! x4  You encounter an ufetubus.ki You encounter an orc. It is wielding a +0 flail. _You encounter Duvessa, Sister of Dowan. She is wielding a +0 short sword.ki=You encounter Dowan, Brother of Duvessa. He is wielding a +0 dagger and wearing_a +1 robe of resistance.ki("m  Okay, then.kij-D _kiM ki2P Quiver which action? ([-] to clear) Items ([,] to cycle)  a - Throw: 4 boomerangsb - Zap: wand of polymorph (8)  c - Zap: wand of paralysis (16)  d - Zap: wand of mindburst (8) Spells ([,] to cycle)  e - Cast: Poisonous Vapours  f - Cast: Mercury Arrow  g - Cast: Mephitic Cloud  h - Cast: Olgreb's Toxic Radiance  i - Cast: Sticky Flame (2%) kiP NAbilities ([,] to cycle)  j - Abil: Potion Petition  k - Abil: Call Merchant  l - Abil: Bribe Branch [*/%] inventory [&] all spells [^] all abilities[!] focus mode: off|onkiki...# .)......#.... ludeguy the Toxicologist.oe# ##.###.)......#.... Octopode of Gozag Gold: 782.e#. #...#......#..#...# Health: 64/64 ========================...##.... .......###... Magic: 15/15 ========================.....#...... ......[###.[. AC: 3Str: 7Doom: 4% . ###.... #/5...## #........##). EV: 14Int: 20 .###.....#.#......# #.........)# SH: 5Dex: 16 ........##.......## ##........)i4m.. XL:  9 Next: 67% Place: Dungeon:6 ......#.........@.###........)... Noise: ---------  Time: 7313.5 (0.0) ..............#.#......#....).... c) +0 dagger (protect) .##....##.......#......#...)[.##. Cast: Poisonous Vapours .##...##.....................## # Mark .....## #.....................### ......###........................ e   Duvessa ................#..........#..... e   Dowan ................#..#......##..... ki5   ufetubus ..............#.#.##....#........ o   orcYou encounter an ufetubus.You encounter an orc. It is wielding a +0 flail. _You encounter Duvessa, Sister of Dowan. She is wielding a +0 short sword.You encounter Dowan, Brother of Duvessa. He is wielding a +0 dagger and wearing_a +1 robe of resistance. _Okay, then.ki kiki kiv  Casting: Sticky Flame (dangerous; 2% risk of failure)  kiw \Confirm with . or Enter, or press ? or * to list all spells.ki@ # ##.##.e#. #......##...#......#/5...###.#......#.......##.......@.#.....#.#......#.......#......#.............................................(poisoned).......#.......(poisoned).......#..#.... (poisoned)kiq@  orc (poisoned)You begin to radiate toxic energy. Duvessa is poisoned. Dowan is poisoned.ki# ##.##.e#. #......##...#......#/5...###.#......#.......##.......@.#.....#.#......#.......#......#....................................................#..............#..#....ki .5The orc is poisoned. The ufetubus is poisoned. Duvessa looks even sicker.kiQ.oki D.ekiv: §kizDowan looks even sicker.  Dowan casts a spell.ki Q.5ki%very poisoned)5   ufetubus (poisoned)o   orcki~#1kis-------===4.5 (1Toxic kiki# _Dowan blinks!ki{ ..§# ##.###.)......#.o.#. #...#......#..#...##.e.##.... .###.........#...... ......[###.[###.... #/....## #..##).< kiC| c###.....#.#......# .)## .......##.....5.## ##........)..#...........###........)...#.......#.#@.....#....).. kio| ##....##.......#......#...)[.## ##...##..........ki| S.....## ## ....## #.........##...........).........#.#ki} i......#..###.....#kiE} ....#.#.##....#.... kir} a#...##[...#.ki P.5kiǂ 2oki~ @.ekiF .very poisoned)o   orc (poisoned)ki. /---5kia kif 5 _The ufetubus looks even sicker.ki;#. #...#......#..#...##o..##.... ki1<_.###..........#e..... ......[###.[..####.... #/....## #........##).<# ##.....#.#......# #.........)### kiQ<......##.......## ##........)..ki|<"#.........5.###........)...#........#.#......#....)...... #....##ki<.#.@....#...)[.## #...##..........ki<.....## ## ...## #........ki<##.#.........)..........#ki<#......#..###.....##ki=...#.#.##....#....ki==.......##[...#. ......###ki_=$..##...kiF1$kiH2okiuMz .eYou kill the ufetubus!kiZ. o   orc (ki\782 ---6Poisonous Vapourski\kigkiix _Duvessa says, "My weaknesses are his strengths!"kiño.##.... .###..........#...... ......[###.[..## ###.... #/e...## #........##).<# #.....#.#......# #.........)### .....##.......## ##..)..#.........$.###........)...#.........#.#......#....)......##.......#......#...)[.## ...##...............## ## ..## ##.#...)....##..#..###.....###.#.##....#..........##[...#..###..........##i;49m...#.#...###....# ..)# .eYour toxic aura wanes.kiԵkiG7 87ki1 _You feel a bit more experienced.kikij _Your Air Magic skill increases to level 3!kiO.....#...... ......[###.[..### ##.... #/....## #........##).<# .....#.#..e...# #.........)### ....##.......## ##........)..#####.........$.###........)...#.........#.#......#....)......##.......#......#...)[.####........## ## .## ki{ ##.#...)....##...#..###.....##.#.#.##....#..........##[...#..###..........##...#.#...###....# ..)#.....#......kiG.ekihkiL-------8 _kih*kiE,ki6n#.... #/....## #..##).<# ....#.#......# #.........)### ##.....e.## ##........)..#### .#.........$.###........)...#...ki#.#......#....)......##.#......#...)[.## .##........## ## ## ##.#...)....#kii#...#..###.....##ki#.#.##....#......#...##[...#.kif~.###..........##...#.#...###....# ..)#.....####..........##........##kikijG.ekiT9kiV  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kikiki{ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiM$ekir2==20 _ki*kiki5 #.... #/....## #........##).<#ludeguy the Toxicologist ....#.#......# #.........)###ki ZOctopode of Gozag Gold: 782 ...##.......## ##........)..#### Health: 64/64 ======================== .#.........$.###........)...#..## Magic: 10/15 ================-------- .........#.#e.....#....)........# AC: 3Str: 7Doom: 4% ki( ..##.......#.*....#...)[.##...... EV: 14Int: 20 .##...........*.........## ##.... SH: 5ki\ {Dex: 16 ## #...........*.........####.... XL:  9 Next: 68% Place: Dungeon:6 .###............@...........).... Noise: ---------  Time: 7320.5 (0.0) kiܼ ...........#..........#.......... c) +0 dagger (protect) ...........#..#......##.....##... Cast: Poisonous Vapours .........#.#.##....#.........#..# Mark ki .............##[...#............. ...###..........##............... e   Duvessa (poisoned, weak) kiF F...#.#...###....# ..)........#... .........####.................... ....##........#..........#.......ki{ Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineki Aim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (heavilywounded, poisoned, chance to weaken: 100%)  ki 7The glob of mercury hits Duvessa! Duvessa looks weaker.ki?G.ekiOJ*..kiJ4==1.5 (1kiJPoisonous VapourskiRUkiXB  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (heavilywounded, poisoned, chance to weaken: 100%)  The glob of mercury hits Duvessa! Duvessa looks weaker. _Duvessa is severely wounded.kiV#.... #/....## #........##).<#  ludeguy the Toxicologist ....#.#..e...# #.........)###  Octopode of Gozag Gold: 782 ki...##.......## ##........)..####  Health: 64/64 ======================== .#.........$.###........)...#..## Magic: 9/15==============---------- .........#.#......#....)........# AC: 3Str: 7Doom: 4% ..##.......#.e....#...)[.##...... EV: 14kiIInt: 20 .##.....................## ##.... SH: 5Dex: 16 ## #.....................####.... XL:  9 Next: 68% Place: Dungeon:6 .###............@...........).... Noise: ==-------  Time: 7321.5 (0.0) kixn...........#..........#.......... c) +0 dagger (protect) ...........#..#......##.....##... Cast: Poisonous Vapours ki.........#.#.##....#.........#..# Mark .............##[...#............. ki...###..........##............... e   Duvessa (poisoned, weak) ki...#.#...###....# ..)........#... .........####.................... ....##........#..........#.......kiMConfirm with . or Enter, or press ? or * to list all spells.kiAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetki:Aim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (severelywounded, poisoned, weak)  kiNHPoisonous fumes billow around Duvessa! Duvessa looks even sicker.kiN& #/ ).<# ...# #.........)### ...## ##........) .$.###........)#.#......#....)..#.e....#...)[........##  ....................)ki..#...#.#..#......###.##....#.......##[...#...........##......e  unaware, dazed, very poisone…)###....# ..)...e   Dowan (poisoned).........kiy2-2.5 (1kiakig  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (severelyki wounded, poisoned, weak)  Poisonous fumes billow around Duvessa! Duvessa looks even sicker. _Duvessa is distracted by your dazzling golden aura.ki;E#.... #/....## #........##).<#  ludeguy the Toxicologist ....#.#..$...# #.........)###  Octopode of Gozag Gold: 782 ...##.......## ##........)..####  Health: 64/64 ======================== .#.........$.###........)...#..## Magic: 8/15============------------ .........#.#......#....)........# AC: 3Str: 7Doom: 4% ..##.......#.e....#...)[.##...... EV: 14Int: 20 .##.....................## ##.... SH: 5Dex: 16 ## #.....................####.... XL:  9 Next: 68% Place: Dungeon:6 ki.###............@...........).... Noise: =--------  Time: 7322.5 (0.0) ...........#..........#.......... c) +0 dagger (protect) ...........#..#......##.....##... Cast: Poisonous Vapours .........#.#.##....#.........#..# Mark .............##[...#............. ...###..........##............... e   Duvessa (unaware, dazed, very poisone…)...#.#...###....# ..)........#... e   Dowan (poisoned) .........####.................... ....##........#..........#.......dead, unaware, dazed, very poisoned, weak, hasn't noticed you)  Poisonous fumes billow around Duvessa! Duvessa looks even sicker.  Duvessa snaps out of her daze.  kiVDuvessa shouts!  You kill Dowan!Duvessa screams in rage.ki".ki%ekif #/ ).<# ...# #.........)### ...## ##........) .$.###........)#.#......#....)..#......#...)[kiS........##  ....................)..#...#.#..#......##kiܧ#.##....#.......##[...#...........##......eberserk, very poisoned, weak)ki###....# ..)............ki<371====3.5 (1  Poisonous fumes billow around Duvessa! Duvessa looks even sicker.  Duvessa snaps out of her dazeki.houts!  You kill Dowan!Duvessa screams in rage. _Duvessa goes berserk!ki _Your Fire Magic skill increases to level 2!ki #.... #/....## #........##).<#ludeguy the Toxicologist ....#.#..$...# #.........)###ki\ Octopode of Gozag Gold: 782 ...##.......## ##........)..#### Health: 64/64 ======================== .#.........$.###........)...#..## Magic: 7/15===========------------- .........#.#......#....)........# AC: 3ki4Str: 7Doom: 3% ..##.......#......#...)[.##...... EV: 14ki*Int: 20 .##...........e.........## ##.... SH: 5Dex: 16 ki ## #.....................####.... XL:  9 Next: 71% Place: Dungeon:6 ki#.###............@...........).... Noise: ====-----  Time: 7323.5 (0.0) ...........#..........#.......... c) +0 dagger (protect) ki...........#..#......##.....##... Cast: Poisonous Vapours .........#.#.##....#.........#..# Mark ki.............##[...#............. kiC...###..........##............... e   Duvessa (berserk, unaware, dazed, ext…)ki...#.#...###....# ..)........#... .........####.................... ....##........#..........#.......Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (almostdead, berserk, very poisoned, weak)  kiIPoisonous fumes billow around Duvessa! Duvessa looks as sick as possible!ki_=---4.5 (1ki$ki(e  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (almostki)dead, berserk, very poisoned, weak)  Poisonous fumes billow around Duvessa! Duvessa looks as sick as possible! _Duvessa is distracted by your dazzling golden aura.kiB ##.... #/....## #........##).<#  ludeguy the Toxicologist ....#.#..$...# #.........)###  Octopode of Gozag Gold: 782 ...##.......## ##........)..####  Health: 64/64 ======================== .#.........$.###........)...#..## Magic: 6/15=========--------------- .........#.#......#....)........# AC: 3Str: 7Doom: 3% ..##.......#......#...)[.##...... EV: 14Int: 20 .##.....................## ##.... SH: 5kibB Dex: 16 ## #...........e.........####.... XL:  9 Next: 71% Place: Dungeon:6 .###............@...........).... Noise: =--------  Time: 7324.5 (0.0) ...........#..........#.......... c) +0 dagger (protect) kiB J...........#..#......##.....##... Cast: Poisonous Vapours .........#.#.##....#.........#..# Mark .............##[...#............. ...###..........##............... e   Duvessa (berserk, unaware, dazed, ext…)kiNC ...#.#...###....# ..)........#... .........####.................... ....##........#..........#.......Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: Duvessa, wielding a +0 short sword and wearing a +0 scale mail (almostdead, berserk, unaware, dazed, extremely poisoned, weak, hasn't noticed you)  Poisonous fumes billow around Duvessa! Duvessa looks as sick as possible!  Duvessa snaps out of her daze.kiM  #/ ).<# $...# #.........)### ...## ##........) kiRN 3.$.###........)#.#......#....)..#......#...)[........##  ....................)..#.kiN ..#.#..#......###.##....#.......##[...#...........##......kiN eextremely poisoned,###....# ..)...ki O 0.........kiP I====5.5 (1kiOX kiZ % _Duvessa shouts!kiJ $You hit Duvessa.  Your weapon exudes an aura of protection.ki#Rki'10 27=---6.4 (0.9Poisonous Vapourski0(ki1ki4G _You kill Duvessa!ki  .....#...... [###.[..### ##.... #/....## #........##).<#..#.#..$...# #.........)### ...##.......## ##........)..###...$.###........)...#..ki #.#......#....).. ...####...)[.##. ..#. ## ########..)...#....#.........#..#......###..#.#.##....##...........##[...#.###..........##...kiγ #.#...###....# ..)#......####..kim ki8 P----7.4 (1.0ki\ kiy  You now have 789 gold pieces (gained 7).  Things that are here:97==-8.4 (2ki% ki W _a +0 short sword; a +0 scale mailki g###.... #/....## #........##).<# .....#.#..$...# #...)####.......## ##)..####.........$.##...)...#...kigO..#.#......#....).......##.......#......#...)[.##........## ## #)..#### ...###....)...##.....kigP...#..##.....##ki:hf..#.#.##....#.........#.....##[...#..###....##.....#.#...###....# ..)#.......####..........kiyh1##........##kiPrkir= 3 9.4 (1ki{ki}kiag*.....#.#..$...# #...)### .#.......## ##)..###.........$.##.#....#.#......#....).... #....##.......#......#...)[.## #kih........## ## #)..####..###.....)...........##..........#..##.....##...#.#.##....#.........#.....##[...#.kiXh4.###....##.. #.....#.#...###....# ..)# #...........####........kihU##........#..........# ###...####.#..#####.ki-skis&30ki}ki, _..#.......## ##)..#.........$.##..........#.#......#....).... ##....##.......#......#...)[.## ##.............## ## ....## #...........)..####..###...............)ki 4...........##......#@.#......##.....##.#.##....#......... #.....##[...#. ####....##. ##.....#.#...###....# ..)#...........####........ .##........#..........# .###...####.#..#####. ..#.....###.##.# ###ki ki/ %1ki kiv ki{3kikiZki" 3ki& ,ki* f==ki+ kiS, ki9. ki. ki/ ki5 y8=ki7 ,kim8 ki: ki: ki; ki? Bki A ki^A \789=kiB kixD kiD kiOF kinH ,kiI kieL d9==kiFM ki

kiAki,ki0ki kie ki :==kizkikikiki4 kil"ki$kiP%kiD'ki**ki,,ki/kiH3ki3&94ki5kiK:M _You now have 794 gold pieces (gained 5).ki!=3ki?ki4Cki[F,kiHkiLkiY ###..<.. .# .# #....... ... .# .)......# ....## ##.###.)...... ..#. #...##..#.. .).##........ .# .....#......# ......[###. ###.... #/....## #........#####.....#.#..@...# #.........##.......## #) .#...........###.) .#..............#.#......#....) ^..##....##.......#......#...)[.# #..##...##..........i#Z39;49m....######...........).........# ........###.............................#.#kigp95.4 (5 _Magic restored. _You now have 794 gold pieces (gained 5).  You now have enough gold to fund merchants seeking to open stores in the  dungeon.  You now have 808 gold pieces (gained 14).  Things that are here:kig68086.4 (53kipkisZ _a +0 dagger; a +1 robe of resistancekițPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn)  i - a +4 ring of slaying (worn)g - an amulet of guardian spirit  j - an amulet of chemistry Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip kiЃ j - an amulet of chemistry. An amulet which allows the wearer to extract small amounts of magical energy from any potion they drink and also enhances the power of their alchemy spells. The magic restoration effect requires the amulet to attune itself to the wearer's body while their reserves of magic are full. If you switch to wearing this amulet: Your SH would decrease by 5.0 (5.0 -> 0.0). You took it off a gnoll sergeant on level 5 of the Dungeon. Stash search prefixes: {inventory} {Chemistry} {jewellery} Menu/colouring prefixes: identified jewellerykiPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  h - an amulet of reflection (worn) ki i - a +4 ring of slaying (worn)  g - an amulet of guardian spirit  j - an amulet of chemistry Talismans (go to first with %)  a - a riddle talisman [?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip kikigki{###..<.. ludeguy the Toxicologist.#ki;.# #....... Octopode of Gozag Gold: 808....# .)......#.. Health: 64/64 ========================....## ##.###.)......#.. Magic: 15/15 ========================..#. #...#......#..#.. AC: 3Str: 7Doom: 2%.).##............###. EV: 14Int: 20 .#.....#......# ......[###. SH: 5ki9Dex: 16 ... ###.... #/....## #........## XL:  9 Next: 77% Place: Dungeon:6 ...###.....#.#..@...# #......... Noise: ---------  Time: 7396.4 (0.0) ..........##.......## ##........) c) +0 dagger (protect) ........#...........###........). Cast: Poisonous Vapours .#..............#.#......#....).. ki^..##....##.......#......#...)[.# #..##...##.....................##  .......####...........).........#  ........###......................ki  ..................#..........#...  _You now have 794 gold pieces (gained 5).  kiYou now have enough gold to fund merchants seeking to open stores in thedungeon.You now have 808 gold pieces (gained 14).  Things that are here: _a +0 dagger; a +1 robe of resistanceki;kiMkikikiN  You start removing your amulet.kiYki+7.4 (1kiki$ki+8.4 (2kikiki+9.4 (3ki ki ki-400.4 (4ki!ki+ki,+1.4 (5ki5ki6& ki6c0 _You continue removing your amulet of reflection. x5ki7ki@kiK  You finish removing your amulet of reflection.  You start putting on your amulet.kiRL+2.4 (6kiUkiU_ki_+3.4 (7kiPhkipki}q+4.4 (8kiykiki+5.4 (9kiskiki /6.4 (10.0)ki2ki!You finish removing your amulet of reflection.  You start putting on your amulet. _You continue putting on your amulet of chemistry. x5  You finish putting on your amulet of chemistry.eel a deeper understanding of alchemy.  j - an amulet of chemistry (worn)kiki1kiSj _The amulet throbs as it attunes itself to your body.kii ###..< .## .# # ... .# .)......# ....## ##.###.)......# ..#. #...#......#..# .).##............### #.# .....#......# ......[###kibj). ###.... #/....## #..###.....#.#.@)...# #.##.......## ##..#...###.).#kij.#.#......#....) kij.^..##....##.......#......#...)[. ##..##...##.............####...........). #.###............ki/k).#.#kiXukiv87.0) _kikizkit q _The amulet throbs as it attunes itself to your body.  You are studying Short Blades.have 6 tentacles available for constriction.r movement speed is average. Your attack delay is about 0.8.  Your damage rating with your +0 dagger of protection is about 13 (Base 4 x 115% (Dex) x 116% (Skill) + 8 (Slay)).ki3 ki ki e _Your base attributes are Str 8, Int 21, Dex 12.kiz ki  Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Airki 1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  ki* >d - Olgreb's Toxic RadianceAlchemy1%4  kiN Ee - Sticky FlameFire/Alchemy2%ki 4 ki Select a spell to describe [?] help [!]/[I] toggle spell headerski( Poisonous Vapours Transmutes a small amount of the air around a target into toxic vapours, kipoisoning anyone unfortunate enough to breathe them in. The quantity of air affected is small and it will not persist beyond the turn in which it is cast. It cannot affect those with any resistance to poison. Level: 1Schools: Alchemy/AirFail: 1%  ki2Power: 100% Damage: 1d4  Range: 3  kiQNoise: Almost silent Miscasting this spell causes magic contamination. kipThis spell would have no effect right now because you can't see any hostile targets that would be affected.ki* Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Airkik*1% 1  b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1% 3  d - Olgreb's Toxic Radiance Alchemyki*X1% 4  e - Sticky FlameFire/Alchemy2%ki*34 ki+ki/+ki_+Select a spell to describe [?] help [!]/[I] toggle spell headerskiy Mercury Arrow Conjures an arrow of elemental mercury which deals direct poison damage to whatever it hits and may also weaken their melee attacks for a short while. The physical force of the arrow inflicts a small amount of damage even to those immune to poison, and the weakening effect can splash to adjacent targets and ignores poison resistance altogether. Level: 2Schools: Conjuration/AlchemyFail: 1%Power: 100%Damage: 2d11 Accuracy: +++++ +++Range: 4Noise: Quiet Miscasting this spell causes magic contamination. This spell would have no effect right now because you can't see any hostile targets that would be affected. _________________ “During the course of the treatise, each element is allowed time to tout its  own virtues and usefulness to mankind, but when it comes time for Mercury, kicE Your spells (describe)TypeFailure Level a + Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1% 3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy2% 4  kiX kiSelect a spell to describe [?] help [!]/[I] toggle spell headers kiwMephitic Cloud Conjures a fragile flask that explodes into short-lived clouds of noxious fumes.These clouds may cause confusion in any creature not resistant to poison. Tougher, more experienced creatures are less likely to be affected. Level: 3Schools: Conjuration/Alchemy/AirFail: 1% Power: 44% Range: 4 Noise: Very loud Miscasting this spell causes magic contamination. This spell would have no effect right now because you can't see any hostile targets that would be affected. _________________ “Seit mehreren Jahren schon hatte die indische Cholera eine verstärkte  Neigung zur Ausbreitung und Wanderung an den Tag gelegt. Erzeugt aus  den warmen Moraesten des Ganges-Deltas, aufgestiegen mit dem  mephitischen Odem jener üppig-untauglichen, von Menschen gemiedenen  Urwelt- und Inselwildnis, in deren Bambusdickichten der Tiger kauert,  hatte die Seuche in ganz Hindustan andauernd und ungewöhnlich heftig  gewütet, hatte östlich nach China, westlich nach Afghanistan und kiz Your spells (describe)TypeFailure Level a + Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1% 3  d - Olgreb's Toxic Radiance Alchemy1% 4  e - Sticky FlameFire/Alchemy2%4 Select a spell to describe [?] help [!]/[I] toggle spell headers ki Olgreb's Toxic Radiance Causes the caster to radiate toxic energy, continuously inflicting poison on everything in line of sight for as long as the spell lasts. Level: 4 School: Alchemy Fail: 1% Power: 68% Range: N/A Noise: A bit loud Miscasting this spell causes magic contamination. This spell would have no effect right now because you can't see any hostile targets that would be affected. ki^ = Your spells (describe)TypeFailure Level a + Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic Radiance Alchemy1% 4  e - Sticky FlameFire/Alchemy2%4 Select a spell to describe [?] help [!]/[I] toggle spell headers kir; kiO###..<. ludeguy the Toxicologist.##.# #...... Octopode of Gozag Gold: 808....# .)......#. Health: 64/64 ========================....## ##.###.)......#. Magic: 15/15 ========================..#. #...#......#..#. AC: 3Str: 7Doom: 2%.).##............### EV: 14Int: 20 #.#.....#......# ......[### SH: 0Dex: 16 .... ###.... #/....## #........# XL:  9 Next: [39;4 ki9m77% Place: Dungeon:6 ....###.....#.#.@)...# #........ Noise: ---------  Time: 7407.4 (0.0) ...........##.......## ##........ c) +0 dagger (protect) .........#...........###........) Cast: Poisonous Vapours ..#..............#.#......#....). .^..##....##.......#......#...)[. ##..##...##.....................#  ........####...........).........  #........###.....................  ...................#..........#.. You are studying Short Blades.  You have 6 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 0.8.  Your damage rating with your +0 dagger of protection is about 13 (Base 4 x 115%(Dex) x 116% (Skill) + 8 (Slay)). _Your base attributes are Str 8, kiCInt 21, Dex 12. kiD kiQ _ kiMUr ####.  ###..< .## .# #.... ... .# .)......#....#####.###.)......#.#.##...##.. .).##............  #.# .....#......# [#. ###.... #@....#####.....#.#..)...# #...##.# ##...#...........###....... ...#..............#.#......#....) ..^..##....####...)[##..##...##...... .#) #####.. ki^V8.4 (19.4 (2 kif ki  ki'_a - a wand of flame (9) ki(  ki )  ki=+  ki7  ki<  ki<  ki5^ n ki,_ $  Things that are here: kia   kib Z a +0 flail; a +0 scale mail ki_g  kig  _ kitk  kip  kis , kiw  kiz  kiׅ  . .< .# ### .#.. ... #... ...###... #... #.......) ##.... #...... ###......##.... .# #... .........# .# .)..... .......@#####.###.)13.4 (4 ........#.##...#......# ##......).##.....  #.# ........#......# [ ##..... ###....##.....## #...... #......###.....#.#..)...# #..... ..............##.......## ##...#...........### .....#.......#.# ki # kiO  ki +4.4 (5 ki  ki K _Found a hand axe. Found a stone staircase leading up. ki'  ki  ki  ki  ki B ki  ki , ki  ki  ki , ki6  ki?  kiR  ki  ki  kir kiI kiQ ki'l kil kiEo kiKs ki ki( kic kiߖ, kir ki ki, ki ki@ kiF ki kiҩ ki< ki ki ki9 ki kiH ki kiڷ ki kif kiԽ ki kit ki ki ki7 kiJ ki kiS ki kiB kiv ki ki kig ki kiR ki  ki  kib ki 5 ki: ki= kid, ki2P  You see here a +0 halberd. _ kiF7 ki=B kiA ki;G, kiH kiV ki_X, ki[ ki k ki|o, kir kiw ki{ ki{ ki~ ki ki), kiL ki ki=, kih kik ki, kiq ki ki, ki\ ki ki4, ki ki kis ki kiC ki8 ki, ki kis ki, ki6! kib' ki- ki- kiW1 ki; ki?, ki1C kiyH kirN kiN ki#T kiW kiZ, ki`\ ki` kib kib kisd kiFi kimj ki k kil kip ki\s, kiu ki|, ki'} ki kik ki, kiz kiU kiŽ, kiM ki kir, ki) ki ki ki kiF kiS$  Things that are here: kiS`  a +0 flail; a +0 scale mail ki  kḭ _ ki| kiܵ ki ki  ki{ kiѻ ki<, ki ki` ki ki ki ki#........# #####........###.### #....#.<....#...# ###..#.#..........# #........###......#  #.....#.......)..##  ##.....#......##..# # #.....##....#..#..#### #....@....###..#...)739.0) #.........#####.###.)............#.##...#... ...##......).##......... #.#...........#......#.....  ##..... .###[ kiTU40m....##.....####  #......###.....#.#..)...# ##  #........##.......## ##  ##...#...........## ki6 kixT _Key pressed, stopping explore. kicI kioB4 _ kiI kia kic, kiep ##........ ###......... #........... ###...##...... ###.#........... ##.......###....# ##......###.....#. #..............##. ##@...........#..85.4 (12.....#.........>.^..##....##.......##..##...##.. #..........####.. ......#..##........### ......##.............. ##...###.............. #........ ki,r kiBu kiu,6.4 (13 kiz ki; _Found a stone staircase leading down. ki  ki  ki  kiZ  kiO  ki X ki  ki  kij  ki  ki{  ki  ki !  ki!  kiG$  ki$  ki)%  ki%  kiA'  kif(  ki(  ki9, B ki,  ki-  ki.  ki|/  ki/  ki"1  kiX3  kiz4  ki4  ki5  kiJ7  ki8  ki8  ki9  ki= B kit=  ki? B ki@  kiC  kiD  kihE  kiF  kiG  kiH  ki\I  kiI  kiK  kiK  kiQL  kiL  kiAV  kiW  kiX  kiX  ki[  ki]  ki]  ki0^  ki`  kib , kib  ki e  kif  kif  kilg  kii  kik , kifl  kin  kip , kiq  kiWv X kiw  kiq  ki , ki  ki  ki+ , ki  ki^  kin  kiԨ  kia  ki  ki , ki޵  ki  kim  ki  ki  ki  ki , ki  ki  ki  ki[  ki  ki  ki  ki  kiD  ki  kiX  ki  ki  ki!  ki  ki  ki  ki  ki4 :  Things that are here: kiw# I  a +0 short sword; a stone; a +0 club ki'  kiT 5 _ kix   You see here a +0 dagger. _ ki~ B ki  kis  kiƆ , ki&  ki  kit  kiʋ  ki  ki , ki  kiR  ki  ki% B ki  kiC , ki  kiM N ........###.#.##...##...  kig ~..)......##.#.##....#...#.... ..#.........#..................# ..[...##....#..##..............## ....#..........#........## ....#.#...................#...# ....###........#.........###### ......#...#########.....## .....)#.........@##....># ##...))....########....##  ##.##..#........ ##... ###.....#########)#.....#.##.#.......#######........###.....### ####.##  You pick up a parchment of Hailstorm and begin reading... ki3 .538.4 (52 ki ,9.4 (53 ki­  ki B _You add the spell Hailstorm to your library.kiJkiki_Qki ki ki ki-........###.#.##...##..##........ ludeguy the Toxicologist ..)......##.#.##....#...#........ Octopode of Gozag Gold: 808 ..#.........#..................#. Health: 64/64 ======================== ..[...##....#..##..............## Magic: 15/15 ======================== ....#..........#..............## AC: 3Str: 7Doom: 2% ....#.#...................#...#EV: 14Int: 20 ....###........#.........######SH: 0Dex: 16 ......#...#########.....##XL:  9 Next: 77% Place: Dungeon:6 .....)#.........@##....>#Noise: ---------  Time: 7539.4 (0.0) ##...))....########....##c) +0 dagger (protect)##.##..#........ #ki#...Cast: Poisonous Vapours###.....#########)#.....#.##.#.......#######........###.....#######.## _a +0 short sword; a stone; a +0 club _You see here a +0 dagger.  You pick up a parchment of Hailstorm and begin reading... _You add the spell Hailstorm to your library.  Press: ? - help, v - describe, . - travelThe floor.kiME@#A stone wall.ki[1 ........###.#.##...##..##........ ludeguy the Toxicologist ..)......##.#.##....#...#........ Octopode of Gozag Gold: 808 ..#.........#..................#. Health: 64/64 ======================== ..[...##....#..##..............## Magic: 15/15 ======================== ....#..........#..............## AC: 3Str: 7Doom: 2% ....#.#...................#...#EV: 14Int: 20 ....###........#.........######SH: 0Dex: 16 kiE2 ......#...#########.....##XL:  9 Next: 77% Place: Dungeon:6 .....)#.........@##....>#Noise: ---------  Time: 7539.4 (0.0) ##...))....########....##c) +0 dagger (protect)##.##..#........ ##...Cast: Poisonous Vapours###.....#########)#.....#.##.#.......#######........###.....#######.## _a +0 short sword; a stone; a +0 club _You see here a +0 dagger.  You pick up a parchment of Hailstorm and begin reading... _You add the spell Hailstorm to your library.  Press: ? - help, v - describe, . - travelA stone wall.kix3 kip: kim; . _kikiki@kikiki% _kikikiZki3&ki8,ki ki!,ki#kiO'ki)ki*kiw,ki|2ki 5ki5kiC7kiG9ki:,ki<kiP>kiyBBkiKCkiVDkiDki_EkiZGki?HkiHkiIkiJLkiMkixOki TkiYkiZkiQ[ki\ki_ki!`ki]`ki4akibkicki%dkieki`ki,kikikikiƜkiƝkiki;ki}kiҬkiki,kizkikiki_kiQki+ki%kifkifkiCkiskifkikikiki kikiki ,kikikikikikikiki#ki'%ki%ki&kiH/ki0ki71ki=2ki:ki>;ki;ki<ki]ki`ki$c,kickijkikkiClkiKnkiski ~Xki ki\kikiki0kiۈki ki kiki>kikiki,kiOkikiSkikiʡkizkiШki\kijkimXki:Xkiki,kiki.ki@kikikiJkikikiG,kikiki,kikikikikikiki1ki%kiTki7ki ,ki5 kikiA,kiki~kiSkikiki!ki;,kiykiiJ #########  ##.##.#..#  #........# ###  ##........###.###  #....#.<.. ###..#.#.......... #........###......# #...@.#.......)..##604.4 (65.0) ##.....#......##..# # #.....##....#..#..#### ##.........###..#...).. ###.........#####.###.).. #...........#.##...#.....  ## ###...##......).##.......kiK..  .## ###.#...........#......#.....  ..###.......###....##.....####... kiRkiTE _Done exploring.ki3kilki0.0)........kitkiSkiE _Done exploring.kiM #########.##.#..#  #........# ### #........###.## #....#.<....###..#.#.......###...... .......)..## ##.....#......##..# ki#.....##....#..#..####............kiki25.4 (1 _kiki΀ 3ki ki+ <0ki [ _Done exploring.ki~33ki&4kit4ki{[ _Done exploring.kiIki\ _Done exploring.ki: IkiA kiFC kiRG : _kiI ki2M ,kiN kinx &ki kiJ ,kiC c#.....#......##.....#...... #.....##....#. ##.........###. ###.........##### #...........#.##.#### ###...##......).##.##..## ###.#...#....#....#####....##....14.4 (9#....##.##.....#.#..).kiە n#....#..............##......#####.##............#.........#............#..............##>..........^..##....##.....#..........##..##...##...  ###.................####  #.......#..##........###..ki ki$ ki kiGkiki'ki3=BkiBXkiCkinFkiG,kiLBkiLkiMkiOkiQkiwQkisRkiTki&W,kiWkiYkiP[ki[ki\ki^ki_ki6`kim{  # #### ###...## ##..## ###.#.... #....###.......## ....##......###. ....#..........  ###.##..........  #............#.  #>@.........^..##25.4 (11.0)  #..........##..##.  ###...........  #.#..##  ##......##.  ###...###...  ##...##.....#  #...###....####  ##...##.....###[4kio|50mki~L  #  #### ###...  ##..## ###.#  #....###.......  #....##......###  #....#...  #####.##..  #.....#  #@..........^..##  #.##..##  ###  #.......#..## ki ##......##  ###...###  ##...##.....#  #...###....####  ##...##.....###kicki16.4 (1.0)kiki5 _Done exploring. ____There is a stone staircase leading down here.kij kia 7 _ki&7ki8{ #  ############.#.  ....$..........  .........^..>..  .......  .#####.#####...  ... ###. kix#. ## kiX-8.9 (2.5ki)^kik`e _You climb downwards.  Found 6 gold pieces. Found a stone staircase leading down.kiba _There is a stone staircase leading up here.kicki$gRead which item? Scrolls  a - 2 scrolls of enchant armourW - 2 scrolls of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedkiVki|kiL >ludeguy the ToxicologistOctopode of Gozag Gold: 808Health: 64/64 ========================Magic: 15/15 ========================#AC: 3Str: 7Doom: 2%############.#.EV: 14Int: 20....$..........SH: 0Dex: 16.........^..>..XL:  9 Next: 77% Place: Dungeon:7.......@.......Noise: ---------  Time: 7628.9 (0.0).#####.#####...c) +0 dagger (protect)...Cast: Poisonous Vapours###.kiY c#.## _Done exploring. _Done exploring. _There is a stone staircase leading down here. _You climb downwards.  Found 6 gold pieces. Found a stone staircase leading down. _There is a stone staircase leading up here.kiP  Okay, then.kiki=kir. _kiz  ##############.#.ki $..........^..>..#.......<.......#.#####.#####... ....###.# #..###ki> ki 29.9 (1 _ki ki kin ##.#..$..^..>...#.<. #.#####.#####... .... ###.## #.. ###kiuki]v'30ki1{ki }ki-  #.#.#..$..^..>..#.#.<. #.#####.#####...# .... ###.### #.. ###kiV5ki5&1ki:ki:=kib ##.##############.#.#$................^..>..##.#.......<....... #.#####.#####...#. .....# ###.### #..###kiki&2ki׫kiki c# #.#.#. #.. .^..>.. ##.#.<. #.#####.#####...#. .....# ###.###kie#..###kiki&3ki[kiki4144.9 (2ki kiB> _You now have 814 gold pieces (gained 6).kiJ kiN Read which item? Scrolls  a - 2 scrolls of enchant armourW - 2 scrolls of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE kiN  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedkiUkirkipludeguy the ToxicologistOctopode of Gozag Gold: 814Health: 64/64 ========================Magic: 15/15 ========================AC: 3Str: 7Doom: 2%EV: 14Int: 20#SH: 0Dex: 16#.##############.#.XL:  9 Next: 77% Place: Dungeon:7#.......@..........Noise: ---------  Time: 7634.9 (0.0).............^..>..c) +0 dagger (protect)kiK##.#.......<.......Cast: Poisonous Vapours#.#####.#####...#. .....# ###.####..### _There is a stone staircase leading down here. _You climb downwards.  Found 6 gold pieces. Found a stone staircase leading down. _There is a stone staircase leading up here. _Okay, then. _You now have 814 gold pieces (gained 6).kiP  Okay, then.ki(kiki. _kiTnWield or unwield which item (- for none)?- - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}kioc[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip ki0kiki@ludeguy the ToxicologistOctopode of Gozag Gold: 814Health: 64/64 ========================Magic: 15/15 ========================AC: 3Str: 7Doom: 2%EV: 14Int: 20#SH: 0Dex: 16#.##############.#.XL:  9 Next: 77% Place: Dungeon:7#.......@..........Noise: ---------  Time: 7634.9 (0.0).............^..>..c) +0 dagger (protect)##.#.......<.......Cast: Poisonous Vapours#.#####.#####...#. .....# ###.####..### _You climb downwards.  Found 6 gold pieces. Found a stonekiV staircase leading down. _There is a stone staircase leading up here. _Okay, then. _You now have 814 gold pieces (gained 6). _Okay, then.kimP  Okay, then.ki kiki3. _kikiRead which item? Scrolls  a - 2 scrolls of enchant armourW - 2 scrolls of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedki  a - 2 scrolls of enchant armour  W - 2 scrolls of brand weaponki q  W - 2 scrolls of brand weapon  V - 2 scrolls of vulnerabilitykil kil!ludeguy the ToxicologistOctopode of Gozag Gold: 814Health: 64/64 ========================kiͳMagic: 15/15 ========================AC: 3Str: 7Doom: 2%EV: 14Int: 20#SH: 0Dex: 16kij#.##############.#.XL:  9 Next: 77% Place: Dungeon:7#.......@..........Noise: ---------  Time: 7634.9 (0.0).............^..>..c) +0 dagger (protect)##.#.......<.......Cast: Poisonous Vapours#.#####.#####...#. .....# ###.####..ki###Found 6 gold pieces. Found a stone staircase leading down. _There is a stone staircase leading up here. _Okay, then. _You now have 814 gold pieces (gained 6). _Okay, then. _Okay, then.kiekiU{Brand which weapon? Hand Weapons ki> c - a +0 dagger of protection (weapon)  b - a +0 dagger of protection[?] describe selectedkiU ludeguy the ToxicologistOctopode of Gozag Gold: 814Health: 64/64 ========================Magic: 15/15 ========================AC: 3Str: 7Doom: 2%EV: 14Int: 20#SH: 0Dex: 16#.##############.#.XL:  9 Next: 77% Place: Dungeon:7#.......@..........Noise: ---------  Time: 7634.9 (0.0).............^..>..c) +0 dagger (protect)##.#.......<.......Cast: Poisonous Vapours#.#####.#####...#. .....# ###.####..###Found 6 gold pieces. Found a stone staircase leadki| ing down. _There is a stone staircase leading up here. _Okay, then. _You now have 814 gold pieces (gained 6). _Okay, then. _Okay, then.ki I ki= R #  #.##############.#. kil > #.......@..........  ki K.............^..>..  ##.#.......<.......  ki A#.#####.#####...  #. ..... ki J # ###.###  ki D #..  kiU  ###    As you read the scroll of brand weapon, it crumbles to dust.  ki~ 1Your +0 dagger of protection craves living souls! ki, #  #.##############.#.  kiA-'#.......@..........  .............^..>..  ##.#.......<.......  #.#####.##### #. .... # ###.## ki~. #.. ###  ki4 ki<5+5.9 (1 ki: ki<1 _b - a +0 dagger of draining!ki! !ki# 7Wield or unwield which item (- for none)?- - Tentacles Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon) !ki$  b - a +0 dagger of draining  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7}[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip "ki<"ki1B"kiHxludeguy the ToxicologistOctopode of Gozag Gold: 814Health: 64/64 ========================Magic: 15/15 ========================AC: 3Str: 7Doom: 2%EV: 14Int: 20"kiI#SH: 0Dex: 16#.##############.#.XL:  9 Next: 77% Place: Dungeon:7#.......@..........Noise: ---------  Time: 7635.9 (0.0).............^..>..c) +0 dagger (protect)##.#.......<......."kiICast: Poisonous Vapours#.#####.#####...#. .....# ###.####..### "kiJ>_You now have 814 gold pieces (gained 6). _Okay, then. _Okay, then.As you read the scroll of brand weapon, it crumbles to dust.  Your +0 dagger of protection craves living souls! _b - a +0 dagger of draining"kiPP  Okay, then."kiQ"ki,W"kiaY. _"kiI: "ki; "ki? "kiA _You can't see any susceptible monsters within range! (Use Z to cast anyway.)"ki I"ki "ki "ki $ _"ki X"kii "ki "ki ,"ki "ki "kia ,"kiz "ki "ki "ki ,"ki1 "ki ,"ki "ki "ki "ki "kiv "ki "ki "ki) "ki "ki "ki "ki "ki= "ki+ "ki ,"kiw "ki "ki ,"ki| "ki "kiM "ki "ki0 "ki "ki "ki "kig "ki "ki "ki% "ki "ki "ki ,"kiI ,"ki "ki# "ki "kiP "kix "ki "kiw "ki "ki ,"kiq "ki "ki" ,"kip# "ki(% "ki& "ki^' "ki' "ki8) "ki"- i  You encounter an ufetubus."ki2 2. ...#.##############.5######.#.....................................^.........#.##.#.......<...."ki93 ####...#.##.#.#####.#####..........#.#.# .....##.##.......#.# ###.### ........####.# #.. ####...@# #.# ### #.#  .#########.#.#  #.#  "ki3 5   ufetubus (wandering) "kiy4 /520.0)"ki9 "ki: 36.9 (21 _"ki? "kiA #ki7 . ...#. .5######.#.. ......................^ .......#.##.#.......< ####...#.##.#. ..........#.#.# .....  ##.##.......#.#   ........####.# #..  ####...@# #.# ###  ...........#.#  .#########.#.#  #.# #ki . ...#. .5######.#.. ......................^ .......#.##.#.......< ####...#.##.#. #ki;|..........#.#.# .....  ##.##.......#.#   ........####.# #..  ####...@# #.# ###  ...........#.#  .#########.#.#  #.# #ki/ #ki#ki#ki#kiK` _An ufetubus is nearby!#kiC . ...#. .5######.#.. ......................^ #ki.......#.##.#.......< ####...#.##.#. ..........#.#.# .....  ##.##.......#.#   ........####.# #..  ####...@# #.# ###  ...........#.#  #ki J.#########.#.#  #.# #ki<3#ki  . ...#. .5######.#.. ......................^ .......#.##.#.......< ####...#.##.#. ..........#.#.# .....  ##.##.......#.#   ........####.# #..  ####...@# #.# ###  ...........#.#  .#########.#.#  #.#  #ki #ki #kiS #ki ` _An ufetubus is nearby!$ki _An ufetubus is nearby!  You are studying Short Blades.  You have 6 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 0.8.  Your damage rating with your +0 dagger of protection is about 13 (Base 4 x 115% (Dex) x 116% (Skill) + 8 (Slay)).$ki$kiE$ki_ e _Your base attributes are Str 8, Int 21, Dex 12.$ki $kiK Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft5% 1  b - HailstormConjuration/Ice 7% 3 $ki c - Launch Clockwork Bee Forgecraft16% 3  d - Sigil of BindingHexes16% 3  e - Curse of AgonyNecromancy77% 5  f - Diamond SawbladesForgecraft100% 7 $ki2 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exit&kiX&ki &ki. ...#.############## ludeguy the Toxicologist.5######.#............... Octopode of Gozag Gold: 814......................^.. Health: 64/64 ========================.......#.##.#.......<.... Magic: 15/15 ========================####...#.##.#.#####.##### AC: 3&ki%eStr: 7Doom: 2%..........#.#.# .....EV: 14Int: 20##.##.......#.# ###.###SH: 0Dex: 16........####.# #..XL:  9 Next: 77% Place: Dungeon:7####...@# #.# ###Noise: ---------  Time: 7656.9 (0.0)...........#.#c) +0 dagger (protect).#########.#.#Cast: Poisonous Vapours#.#5   ufetubus (wandering)You are studying Short Blades.  You have 6 tentacles available for constriction.  Your movement speed is average. Your attack delay is about 0.8.  Your damage rating with your +0 dagger of protection is about 13 (Base 4 x 115%(Dex) x 116% (Skill) + 8 (Slay)). _Your base attributes are Str 8, Int 21, Dex 12.&kin  Okay, then.&ki`2D _'ki^ #####.#  .. ...#.############# .5######.#............ ................^ .......#.##.#.......<... ####...#.##.#.#####.#### ..........#.#.# .....'ki##.##.......#.# ###.###.......@.####.# #..#####....# #.# ### ...........#.#..#########.#.##.#'ki85.'ki'ki27.9 (1 _'ki'ki'kiq_ #.#. #####.# 5 ...#.############...######.#.. .........^ .......#.##.#.......<..#####...#.##.#.#####.###.....#.#.# ..... ##.##.@.....#.# ###.###..........####.# #..######....# #.# ### ...........#.#..#########.#.##.#55.5 2 ufetubi (wandering)8 _You encounter an ufetubus.'ki8t #.#.) #.#55 #####.# . ...#.###########....######.#. ............. .......#.##.#.......<.######...#.##.#.#####.##......#.#.# .....####.##.......#.# ###.## ..........####.# #..######....# #.# ### ...........#.#..#########.#.##.#'ki{ 5Found a whip.'kiA}J.5'ki51 wandering)==9'ki'ki/* _The ufetubus shouts!'ki  ..... #.##.) #.##.5. #####.# #..5. ...#.##########.....######.#............................#.##.#.......< ######@..#.##.#.#####.#.......#.#.# ....#####.##.......#.# ###.# ..........####.# #..'kiK######....# #.# ### ...........#.#..#########.#.##.#'kiiQ.5'ki_.5.'kiiN.5'kiPs   ufetubus'kiI--60Poisonous Vapours'ki'kil'ki ...ludeguy the Toxicologist...#.#Octopode of Gozag Gold: 814#.)#.#Health: 64/64 ========================#... #####.#Magic: 13/15 ====================----#.... ...#.########## AC: 3Str: 7Doom: 2%.....######.#........... EV: 14Int: 20.....5.................. SH: 0Dex: 16'kiϙ ......*...#.##.#.......< XL:  9 Next: 77% Place: Dungeon:7######@..#.##.#.#####.# Noise: ---------  Time: 7660.9 (0.0).............#.#.# .... c) +0 dagger (protect)#####.##.......#.# ###.# Cast: Poisonous Vapours..........####.# #..######....# #.# ###...........#.#'ki h5   ufetubus (weak)..#########.#.##.#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an ufetubus (chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the ufetubus!  The ufetubus looks weaker.'kit$ 5.5'kiA( {5 2 ufetubi (1 wandering, 1 weak)'ki ) 4==1.9 (1'ki0 'ki-2   Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an ufetubus (chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the ufetubus!  The ufetubus looks weaker. _The ufetubus is almost dead.(ki6C $(kiλYou completely miss the ufetubus. You grab the ufetubus.  You squeeze the ufetubus.(ki .5You kill the ufetubus!   ufetubus(kiV814 =2.8 (0.9(ki(ki* _The ufetubus shouts!(kik? z ...$. ...(kii@ ^.... #.# #.). #.# ######.# ##.... ...#.#########>....5######.#.).......................@...#.##.#.......########...#.##.#.##### .......#.#.# ...#####.##.......#.# ### ..........####.# #.######....# #.# ## ...........#.#..#########.#.##.#(kiE P.5(kiO  (kiXQ  Found a runed spear and 17 gold pieces. Found a stone staircase leading down.--3.8 (1.0(kiW (kiY  (kiY _The ufetubus barely misses you. The ufetubus closely misses you.(ki \ Q _You see here 5 gold pieces.(ki*  $You puncture the ufetubus!  Your weapon exudes an aura of protection.(ki((ki10 8=-4.6 (0.8Poisonous Vapours(kiJ(ki'[ _You kill the ufetubus!(kij(P9--5.6 (1(kiU.(ki0> _You now have 819 gold pieces (gained 5).)ki7 ........ ...$... ......... #.# #.).. #.# #.... #####.# ###.... ...#.#########>.....######.##).................#.##.#.....#########...#.##.#.##### .......#.#.# .#####.##.......#.# ### ..........####.# ######....# #.# # ...........#.#..#########.#.#)ki)kiG--60)ki,)ki)ki254== 3 7.6 (2)ki)ki> _You now have 825 gold pieces (gained 6).)kiT..... ......... ...$.... .......... #.# #.)..# #.# #....# #####.#  ###....# ...#.####### #>....@######.# #)...... #...........#.##.#.....#########...#.##.#.#### .......#.#.# .#####.##.......#.# # ..........####.#######....# #.# ...........#.#)ki\)ki]+8.6 (1)kid)kie)ki&>)ki>)ki?*ki*ki]*kiB*kiF*kiP==*ki *ki *kic *ki *ki,*kiR*ki*ki0L5==*kid*ki$4 _Magic restored.*ki"*ki#*ki$*ki(*ki6+..[.#... #...... .....#.............. ...#....... .......$........ ... ........# #.# #.)..# #.# *ki7' #.@..# #####.# 75.6 (7 ###....# ...#.##### #>.....######.#. #)...................#...........#.##.#..#########...#.##.#....#.#.#.##.......#.#####.#*kimBN8256.6 (8*kiN^ _Found a ring mail.*ki@3*ki\*ki*ki^*ki,*kif==42 _You now have 842 gold pieces (gained 17).*ki*ki_B*ki*ki*kiN*ki *ki*kij*ki*ki*ki  #.............. ..... #.............. ... #....... ... #........ ... #...........## #.#######.)..#.# #.# #....# #####.###....# ...#.###>@....#.... #)................. #...........#.##.# #########...#.##.# .............#.# #####.##.......#.  ..........####.  ######....# #.  .....#. *ki #.  #........ ... #........ ... #...........## #.#*kit` ######.)..#.# #.# #....# #####.####....# ...#.## #>.....######.#... #@............ ##.##.# #########...#.##.# .............#.# #####.##.......# ..........#### ######....# # ...........##########.#*ki,85.6 (9*ki/6.6 (10.0)*ki=*kih'w _You see here a +0 spear of venom.+kiI+ki;+ki+ki: _+ki+ki+kiB+ki ,+ki+ki+ki +kit +ki +ki[+ki+ki+ki|+ki+ki+ki+ki+ki +kiQ#+ki#+kiS%+kiA0+kin1+ki1+ki2+kiQ3+ki4,+ki5+ki9+ki<,+ki=+kio@+kiB+ki+C+ki}D+ki"F+kiH,+kiI+kiK+kiN+kiO+kieP+kiU+ki[X+kiX+kiZ+ki]+ki`+ki4a+ki&c+kif+ki>i,+ki$k+kim+kiap+kip+kir+kiw+ki z+kiz+ki2|+ki~+ki,+ki@+ki+ki8+ki+kid+ki+kiޏ+ki:+ki+kiM+ki{,+kif+kiX+ki+ki+ki@+ki+kiڡ+ki9+kip+kiѮa  You see here a +0 ring mail.+ki +ki _+ki+ki+kiж,+kiC+ki+ki+ki+ki+kiC7 _You open the door.+kiE+ki+ki +kiz@  There is an open door here.+ki++ki _+ki+ki@+ki,+ki+ki+kiX+ki+ki+ki+kiv+ki+ki+kin+kiX+kiB         ###########   #.........   #..........##  ###..........#.  ....'..[.......#  ####........+kii720.6 (34  '# #............  ... #............  ..... #...  #......#...........  #......######.)..#.  #..<#### #....#.  #...# ###....#..  +ki2 #>.....## _You open the door.+kiUY _Found a stone staircase leading up.+kiF 3+kiG +kiJ +kiL +kiP : _+ki S @  There is an open door here.+kiT +kiU  _+ki_ +kiEd +kie +ki4f +kif +kih +kiLj +kij +ki=k +kil +kiGn +kin +kido +kiq +kiar +kir +ki6s +ki u +ki[v +kiv +kinw +kiy +kiz ,+ki{ +ki} +ki1~ +ki~ +ki* +ki +ki҂ +ki> +ki +ki3 +ki +ki +ki +ki +kiÊ +ki1 +ki +ki +ki Y#.####............###'####............#......#............#......#............#.......##......######.)..#.#..<#### #....#.###...# ###....#.#...@+ #>.....####....# #).....#....# #.+ki j#....# #########.#....# ........#..... #####.##.###.. ......#.# ... ###### ....+ki ######'.....#32.6 (12####.#+kiH +ki M======3.6 (13+ki +ki^ = _As you open the door, it creaks loudly!+kiH 3+kiu +ki +kii +ki +ki ,+kin  You encounter an orc priest. It is wielding a +0 hand axe.+ki7 <#...............#.....######.)..#.#..<#### #....###...###...#..#....'.....#>.....##....#####.#).........@# #.........------+ki  ######### .o   orc priest (wandering)#. o.  .....###  +ki 14.0)+ki )+ki Q------5.6 (2 _+ki +ki -kiK######.)..#<#### #..##...########.....'.....#>.....###.#####.#).........# #.######## ........#####.#####.. ......# ...######. o..# .... ....-kieL9..###..-kiM9o.-kimT-kiDU+6.6 (1-kim[-kia-ki7/ #......#............ ludeguy the Toxicologist #......#...........# Octopode of Gozag Gold: 842 #......######.)..#.# Health: 64/64 ======================== #..<#### #....#.# Magic: 13/15 ====================---- ##...#########....#.. AC: 3Str: 7Doom: 2% #....'.....#>.....### EV: 14Int: 20 #....#####.#)........ SH: 0Dex: 16-ki8 #....# #......... XL:  9 Next: 78% Place: Dungeon:7 #...@# #########. Noise: ---------  Time: 7736.6 (0.0) #....# ........ c) +0 dagger (protect) #..... #####.## Cast: Poisonous Vapours #.###.. ...... #.# .$. ###### #. ...# .... o   orc priest .... ..### ..... Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an orc priest, wielding a +0 hand axe (chance to weaken: 100%)  You feel a surge of power!  The glob of mercury hits the orc priest!!  The orc priest looks weaker.-ki=  #.... #....) #..<####   > -ki=)     #...*#  #....*  #.###*.  #.# .$.  #. ...# -ki=9.... .....-ki4...-kie842 19==7.6 (1-ki.-kih  Press: ? - help, Shift-Dir - straight line  Aim: an orc priest, wielding a +0 hand axe (chance to weaken: 100%)  -kiYou feel a surge of power!  The glob of mercury hits the orc priest!!orc priest looks weaker. _You kill the orc priest!-ki  ######.)..#<#### #..##...########.-ki G....'.....#>.....########.#)........ #.######## ..........# #####.#####...# .......##......  -ki& -kiG' &---kij' 8-ki, -ki- .ki10 #####.)..#<#### #..##...########.....'.....#>.....########.#)........ #.########### ........kip...# #####.##### ......#.# .$######..f   sleepcap (dormant)..ki?......f  .kiW--9.kiƿ.kiY _You encounter a sleepcap..ki}t ) #..<####  ##...# #....'> .ki ~#....#) #....#  #....#  #....####  #...@...#  .ki~i#.###...#  #.# .$.#  #. ...#  ..... .ki~? ......  .......  .kiK......f .ki# ) #..<####  ##...# #....'> #....#) #....#  #....#  #....####  #...@...#  #.###...#  #.# .$.#  #. ...# ..... ...... ..............ki$.ki&_ _A sleepcap is nearby!.ki*v  ) #..<####  ##...# #....'> #....#) #....#  #....#  #....####  .kiv #...@...#  #.###...#  #.# .$.#  #. ...#  .....  ......  .......  .kiv K......f .ki Z ) #..<####  ##...# #....'> #....#) #....#  #....#  #....####  #...@...#  #.###...#  #.# .$.#  #. ...# ..... ...... ..............ki\ .ki .ki .ki0 _ _A sleepcap is nearby!/kiJ #..<#### #....#.# ##...#########....#... #....'.....#>.....#### #....#####.#)......... #....# #.. #....# ######### #....#### ........ #.......# #####.## #.###@..# ....... #.# #.$.# ###### #. #...#  ..... ........#### .. .... ........fo   orc (asleep) ....o...... /ki/ki_'40/ki/kiD _You encounter an orc. It is wielding a +2 short sword of venom./ki\}##...#########....#....#....'.....#>.....######....#####.#)..........#....# #..#....# ##########....#### ........#.......# #####.###.###...# .......#.# #.@.# #######. #...#  ..... .........######....#.....#..f#....o......JJ   jelly (asleep)#...o..o   orc wizard (asleep)o   orc (asleep)/kiы/kih&1/ki/ki~ _You encounter a jelly and an orc wizard.Things that are here:/ki͖R _6 gold pieces; a +0 hand axe/kiI#....'.....#>.....#######....#####.#)...........#....# #..##....# #########...##....#### ........#.......# #####.###.###...# .......#.# #.$.# #######. #..@#  .....#............[. ..########.....# #...#./kif..##....o......J#...o........./kiq/ki&2/ki2/kiM _Found a leather armour.0ki ##...#########....#.... #....'.....#>.....##### #....#####.#). #....# #........... #....# ######### #....#### ....... #.......# #####.## #.###...# ..... #.# #.@.####### #. #...# ...... #.....[. ..#######..# #..... #.........f..# #....oJ. #...o...............4==3  Thin0kicgs that are here: _6 gold pieces; a +0 hand axe0ki ....'.....#>.....#####.#####.#)..........#....# #.#.########0ki y#....#### ..............# #####.##### ...... #.$###### 0ki < ....#............[. ..#######.....#  ...f..#0ki8 o......J.o.......0ki1 `4 _0ki< e#####.#)..........#....# #...########...#### ............# #####.##### ...... #.$#######.###...##.### ....#.....@......[. ..######.#  .f..#o......J.o...........! 5 _Found a potion of mutation.1ki#L #....#####.#).......... ludeguy the Toxicologist #....# #........... Octopode of Gozag Gold: 842  #....# #########... Health: 64/64 ======================== #....#### .......... Magic: 12/15 ===================----- #.......# #####.##.. AC: 3Str: 7Doom: 1% #.###...# ........ EV: 14Int: 20 #.# #.$.# ######.. SH: 0Dex: 16 #.###...##.### ...... XL:  9 Next: 79% Place: Dungeon:7 1kiL#.....@......[. ..##### Noise: ---------  Time: 7745.6 (0.0) ##............#  c) +0 dagger (protect) #.............  Cast: Poisonous Vapours #.........f..#  #....$......J.  #...o.........  f   sleepcap (dormant) ..............  J   jelly (asleep) ....!.........  o   orc wizard (asleep)  o   orc (asleep)1kiM'Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an orc, wielding a +2 short sword of venom (asleep, chance to weaken:  1kiMM100%)  You feel a surge of power! The glob of mercury hits the orc!  The orc looks weaker. The mercury splashes! The orc wizard looks weaker.1kiU ) #....#  #....# 1ki7x #....####      #.# #.$.#  #.###  #...[.  ##....*.......#  #....*........  #....*....f.. #.. #...o.........  ..............  ....!......... 1kix, weak) 1ki7 o....oweak)1kiB=80==6.6 (11ki1ki  Press: ? - help, Shift-Dir - straight line  Aim: an orc, wielding a +2 short sword of venom (asleep, chance to weaken:  100%)  You feel a surge of power! The glob of mercury hits the orc!  The orc looks weaker. The mercury splashes! The orc wizard looks weaker. _You kill the orc!1kiq% [#....#####.#).......... ludeguy the Toxicologist#....# #........... Octopode of Gozag Gold: 842 #....# #########... Health: 64/64 ========================#....#### .......... Magic: 10/15 ================--------#.......# #####.##.. AC: 3Str: 7Doom: 1%#.###...#........ EV: 14Int: 20#.# #.$.#######.. SH: 0Dex: 161ki% #.###...##.### ...... XL:  9 Next: 80% Place: Dungeon:7#.....@......[. ..##### Noise: ==-------  Time: 7746.6 (0.0)##....*.......#c) +0 dagger (protect)#....*........Cast: Poisonous Vapours#...*.....f..##...o$......J.#.............f   sleepcap (dormant)..............J   jelly (asleep)....!.........1kiv& o   orc wizard (weak)  Press: ? - help, Shift-Dir - straight lineAim: an orc wizard, wielding a +0 dagger and wearing a +0 robe (weak, chance toweaken: 100%)  You feel a surge of power!  The glob of mercury hits the orc wizard!  The orc wizard looks even weaker.1ki 9o.1kiײ 0...1ki D7.6 (1Poisonous Vapours1ki& 1ki ^  Aim: an orc wizard, wielding a +0 dagger and wearing a +0 robe (weak, chance toweaken: 100%)  You feel a surge of power!  The glob of mercury hits the orc wizard!orc wizard looks even weaker. _The orc wizard is heavily wounded.2ki #....#####.#).......... ludeguy the Toxicologist #....# #........... Octopode of Gozag Gold: 842  #....# #########... Health: 64/64 ======================== #....#### .......... Magic: 8/15============------------ #.......# #####.##.. AC: 3Str: 7Doom: 1% #.###...# ........ EV: 14Int: 20 #.# #.$.# ######.. SH: 0Dex: 16 #.###...##.### ...... XL:  9 Next: 80% Place: Dungeon:7 #.....@......[. ..##### Noise: ==-------  Time: 7747.6 (0.0) ##............# 2ki [40m c) +0 dagger (protect) #.............  Cast: Poisonous Vapours #....$....f..#  #....$......J.  #.............  f   sleepcap (dormant) ..............  J   jelly (asleep) ....!.........  o   orc wizard (weak)Press: ? - help, Shift-Dir - straight lineAim: an orc wizard, wielding a +0 dagger and wearing a +0 robe (heavilywounded, weak, chance to weaken: 100%)  You feel a surge of power!  The glob of mercury hits the orc wizard!  The orc wizard looks even weaker. ) #....#  #....#  #....####      #.# #.$.#  #.###  #...[2ki[34m.  ##....*.......#  #....*........  #.. #.. #.............  ..............  ....!......... 2kiS^#.2ki`.2kie%12kif8.6 (12kif%Poisonous Vapours2ki,g2kio2kis  2ki'tAim: an orc wizard, wielding a +0 dagger and wearing a +0 robe (heavily2kitFwounded, weak, chance to weaken: 100%)  2kit=You feel a surge of power!  The glob of mercury hits 2kicuthe orc wizard!2kiu&orc wizard looks even weaker. 2kivC_You kill the orc wizard!2ki  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b + Mercury ArrowConjuration/Alchemy 1% 2 c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy2%4 Select a spell to describe [?] help [!]/[I] toggle spell headers3ki! 3ki8#....#####.#).......... ludeguy the Toxicologist#....# #........... Octopode of Gozag Gold: 842 #....# #########... Health: 64/64 ========================#....#### .......... Magic: 8/15============------------#.......# #####.##.. AC: 33kipStr: 7Doom: 1%#.###...#........ EV: 14Int: 20#.# #.$.#######.. SH: 0Dex: 16#.###...##.### ...... XL:  9 Next: 81% Place: Dungeon:7#.....@......[. ..##### Noise: ==-------  Time: 7748.6 (0.0)##............#c) +0 dagger (protect)#.............Cast: Poisonous Vapours#....$....f..##....$......J.#.............f   sleepcap (dormant)..............J   jelly (asleep)....!.........  3kikAim: an orc wizard, wielding a +0 dagger and wearing a +0 robe (heavilywounded, weak, chance to weaken: 100%)  You feel a surge of power!  The glob of mercury hits the orc wizard!  The orc wizard looks even weaker. _You kill the orc wizard!3kiB43kiK3ki3kiY  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.4ki44ki4ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)5ki#....# #..##....# #########...##....#### ........#.......# #####.###.###...# .......#.# #.$.# # #######.###...##.#### .....#............[. ..######## . #....$....f..# #....$......J#.......... ....! .......#####5ki5ki;;--9.6 (1 _5kib5ki5ki#....# #...........# ludeguy the Toxicologist#....# #########...# Octopode of Gozag Gold: 842 #....#### ........... Health: 64/64 ========================#.......# #####.##... Magic: 6/15=========---------------#.###...#......... AC: 3Str: 7Doom: 1%#.# #.$.# # ######... EV: 14Int: 20#.###...##.#### ....... SH: 0Dex: 16#............[. ..###### XL:  9 Next: 81% Place: Dungeon:7i4m##.....@......#Noise: ---------  Time: 7749.6 (0.0)#......**.....c) +0 dagger (protect)#....$...*f..#Cast: Poisonous Vapours#....$......J.#............................f   sleepcap (weak)....!..........J   jelly (asleep).......#####...  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a sleepcap (dormant, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the sleepcap.  The sleepcap looks weaker.5ki&f.  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a sleepcap (dormant, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the sleepcap.  The sleepcap looks weaker.is lightly damaged.5ki1J.5ki'f..J5kiވ5==50.6 (15ki 5kisZ _The jelly quivers.5ki6 #....# #...........# ludeguy the Toxicologist#....# #########...# Octopode of Gozag Gold: 842 #....#### ........... Health: 64/64 ========================#.......# #####.##... Magic: 4/15======------------------#.###...#......... AC: 3Str: 7Doom: 1%#.# #.$.# # ######... EV: 14Int: 20#.###...##.#### ....... SH: 0Dex: 16#............[. ..###### XL:  9 Next: 81% Place: Dungeon:75kiϤ ##.....@......#Noise: ==-------  Time: 7750.6 (0.0)#......**.....c) +0 dagger (protect)#....$...f.J.#Cast: Poisonous Vapours#....$........#............................f   sleepcap (weak)....!..........J   jelly.......#####...  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a sleepcap (lightly damaged, weak, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the sleepcap.  The sleepcap looks even weaker.5ki# cf.J.5ki+ .5==1.6 (15kig3 5ki5 MAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line: a sleepcap (lightly damaged, weak, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the sleepcap.  The sleepcap looks even weaker. _is lightly damaged.7kir #....#####.#). #....# #........... #....# ######### #....#### ....... #.......# #####.## #.###...# ..... #.# #.$.# # ###### #.###...##.#### ...... [. ..######......# #.......f..... #....$....J..# #....$. #. ..... ....!.................#####...7kishf.J.7kiz7ki7{/--27ki7ki7kik?'.....#>.....######....#####.#).............# #########..#### ...........#####.####...# ......#.# #.$.# # #######.###.@.##.#### ............[. ..######f.....#.........J...#$ #.....!.......7ki=7f.7ki6J.7kiB7kiA--37kix7ki7ki d#...#########....#.....'.....#>.....######....#####.#)#.........#....# #########....#### ...........#####.####...# ......7ki*  #.@.# # #######.###...##.#### ......#......f.....[. ..######.....#...J.....#$ #.7ki$ nf.J.7ki <47ki 7ki6 $  Things that are here:7ki R _6 gold pieces; a +0 hand axe7kiB! #..<#### #....#.## ##...#########....#... #....'.....#>.....#### #....#####.#) #....# #....... #....# ######### #....#### ....... #.......# #####.## #.###@..# ..... #.# #.$.# # ######8ki% #.###.f.##.#### ..... #............[. ..######.......J....# #...... #....$# #....$.. #.8ki *f. 3-The sleepcap attacks as it pursues you! The sleepcap releases spores at you.  You are engulfed in a cloud of soporific spores!  You fall asleep.8ki/  --more--8ki6 [ #..<####  ##... #....> #....) #....#  #....#  #....####  #.......#  #.###@..#  #.# #f$.# #  #.###...#  #............[.  8ki=7 ##.......J....#  #.............  #....$.......#  #....$........   8kiB 9J.8ki@E 8kiF == 2  =5 _8kiH 8kiN `6.6 (28kiO 8kiS h _The sleepcap completely misses you.8kiZ   #..<####  ##... #....> #....) #....#  #....#  #....####  #.......# 8kio[  #.###@..#  #.# #fJ.# #  #.###...#  #............[.  ##......... #.............  #....$.......#  #....$...... 8ki[ A  The sleepcap releases spores at you but does no damage.8kin 8kio 514 7.6 (38ki 8ki L _You wake up.9kiF2  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.9ki- #..<#### #....#.## ludeguy the Toxicologist ##...#########....#... Octopode of Gozag Gold: 842  #....'.....#>.....#### Health: 63/64 =======================- #....#####.#)......... Magic: 1/15=----------------------- 9ki.#....# #.......... AC: 3Str: 7Doom: 1% #....# #########.. EV: 14Int: 20 #....#### ......... SH: 0Dex: 16 #.......# #####.##. XL:  9 Next: 81% Place: Dungeon:7 #.###@..# ....... Noise: =--------  Time: 7757.6 (0.0) 9kiI.*#.# #fJ.# # ######. c) +0 dagger (protect) #.###...##.#### ..... Cast: Poisonous Vapours9ki. #............[. ..#### ##............#  #.............  f   sleepcap (weak) #....$.......#  J   jelly #....$........  #............. 9ki/_You wake up.Casting: Mercury Arrow (safe; 1% risk of failure)  9ki1/ Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  9ki\/Press: ? - help, Shift-Dir - straight lineAim: a sleepcap (lightly damaged, weak)9ki #..<#### #....#.## ludeguy the Toxicologist##...#########....#... Octopode of Gozag Gold: 842 #....'.....#>.....#### Health: 63/64 =======================-#....#####.#)......... Magic: 1/15=-----------------------#....# #.......... AC: 3Str: 7Doom: 1%9ki #....# #########.. EV: 14Int: 20#....#### ......... SH: 0Dex: 16#.......# #####.##. XL:  9 Next: 81% Place: Dungeon:7#.###@..#....... Noise: =--------  Time: 7757.6 (0.0)#.# #fJ.# # ######. c) +0 dagger (protect)#.###...##.#### ..... Cast: Poisonous Vapours#............[. ..######............##.............f   sleepcap (burning, weak)9ki% #....$.......#J   jelly#....$........#.............Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight line9ki^ Aim: a sleepcap (lightly damaged, weak)  You feel a surge of power! The sticky flame hits the sleepcap!  The sleepcap is severely damaged.9ki  Press: ? - help, Shift-Dir - straight line: a sleepcap (lightly damaged, weak)  You feel a surge of power! The sticky flame hits the sleepcap!  The sleepcap is severely damaged.  The sleepcap is covered in liquid fire! The sleepcap burns!  The sleepcap releases spores at you but does no damage.9ki 52----2====8.6 (19kiס 9ki, E _The jelly hits you. You are splashed with acid!:kivJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.:ki":ki1#:kiE*:ki,e _You don't have enough magic to cast this spell.:kiJ@Z  #......######.)..#.   #..<#### #....#.#   ##...#########....#..   #....'.....#>.....###   #....#####.#)   #....# #.......   #....# #########   #....#### .......   #...@...# #####.##   #.###...# .....  :kiFA #.# #fJ.# # ######   #.###...##.#### ....   #....[. ..###  #......#   #......   #....$#   #....$.;ki t $The sleepcap burns!;ki GJ$;ki J   jelly  You destroy the sleepcap!;kiT==3--9;ki;kix _The jelly attacks as it pursues you! The jelly closely misses you.;ki..............######.) #..<#### ##...#########....#..'.....#>.....#######.#)........ ############# ............#####.###.###J..# ......#.# #$$.# # #########...##.#### .........[. ..####....#.........#;ki6J.;ki;kiQ---60;ki;ki";kis M...............######.) #..<#### ##...#########....#..'.....#>.....###;ki t ####.#)........ #########.#### ..........J...# #####.##  #.###...#......;kiht .##J   jelly......;kiu 7J.;ki~ ]  The jelly attacks as it pursues you! The jelly hits you.;ki l46------=1;ki ;ki 1 _You are splashed with acid.;kiPAM...............######.) #..<#### #;kiA#...#########....#..'.....#>.....#######.#).........# #########J#### ........  #.......# #####.##..J   jelly.#...........#######.#).........J# #########  #....#### ........J   jelly....#....@.....#>.....#### #....#####.#) #...J# #......... #....# ######### #....#### ......... #.......# #####.##.....##...J#####.#).#....# #.#....# #.#....#### .#.......# #####.##.#.###...# .=ki1#.# #$$.# # ######.#.###...##.#### .=kiJJ.=kidX3=-5 =ki _=kiQ=kiN=kiG] The jelly attacks as it pursues you! The jelly hits you but does no damage. _There is an open door here.  You puncture the jelly!  Your weapon exudes an aura of protection.  Your tentacles burn!  The jelly is heavily wounded.43-10 ==6.5 (0.9 _The jelly misses you.=ki`  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.=kiB=kiͷ=kie _You don't have enough magic to cast this spell.>ki   You hit the jelly. Your tentacles burn!  The jelly is almost dead.>kij s38----7.4>kit>kid< _The jelly hits you but does no damage.>kiNJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.?kis?kit8-?ki z?ki|e _You don't have enough magic to cast this spell.?kiaq $You hit the jelly.?ki$R?ki|)842 9--=48.3?ki/?ki1I _You kill the jelly!?ki9  #.#### ###'#### #......# #......# #......#. #......######.)..#.# #..<#### #....#. ##...###....# #....@.....#>..... #....#####.#) #....# # #....# # #....####  #.......# #####.## #.###...#  #.# #$$.# # ###### #.###...##.#### -9.3 (1.0?ki3F  You now have 850 gold pieces (gained 8).50-70.3 (2?kiL ?kiO 1 _There is an open door here.?ki?kiv?ki#?ki?kifT40=?ki ,?ki#4== 3 ?ki0?ki?ki?ki?kiK1=?ki?ki?ki:==?kiH?ki{?ki?kiL?ki?ki22?ki.?ki`?kiT5==?ki?ki,?ki?ki?kicS3=?ki?ki@850?ki7?ki?ki:==?ki?ki?ki?ki?kiD?kiK4=?ki?ki ?kisS6=?ki ?kif ?ki ?ki ?ki4?ki95?ki?ki,?ki\?ki?kiR9=?ki?ki#?kiN46=?ki?kif,?ki?kir ,?ki"?ki#?ki#T7==?ki?%?ki'?kiU'W7=?ki.)?ki*?ki)+?ki,?ki.,?ki~/?kiG1?ki1h8===?kiA5B?ki6?ki8?kiJ9?kiW:?ki/<?ki<9=8=@ki@ki,@ki@ki ,@ki @ki#,@ki@ki@kiQ50=@ki$@ki@kiE@ki@ki@ki@ki@kin@kiT#1=9==@ki%$@ki%@ki&@ki%'@ki)@kia)U2=@ki*@kiQ,@ki,:==@ki#.@ki,0@kiw0@ki1@kil3,@ki4@kiv6@ki6Y310/15==@kiX8@ki :,@ki;@ki_=,@ki>@ki@K4=@kiA@ki:B@kiaDP==@kiE@kiG@ki`H@kiI@ki(K@kifK@kiKN5=@kiBM@kiO@kiOM1=@ki%Q@ki/S@kiS@kitT@kiV,@ki+X@kiBb6==@kic@kiae@kieU7=@kif@kih@kiiL2==@kij@kil@kil@kin@kio@kimp%8@kiq@kiUs@kit@kiu@kiw@kix:==@kiz@ki?|,@ki}@kiw9=@ki݃@ki4@ki]D3=@kiB@ki͉@ki=l60=@ki@ki@ki@@ki@ki@ki9=@ki@ki@ki+%1@kiĚ@kiʜ,@ki@ki5@ki@kiơ@ki@ki(L4==@kiq@kie92@ki§(=@ki@ki ,@kiʰX@kiӱ@ki5h3===@ki@kiѵ@ki7@kip@ki@kit@kiɺ@kik _You start resting.HP restored.@ki@ki1850.3 (80.0)@kiI4=5==1.3 (81 @ki _@ki@ki@kiw3@kiy@ki|@ki}@kiB@ki@kiV@ki8@kiDŽ@ki@kĭ@ki @ki[@ki؊@kiK===@ki@ki @ki͏@ki @kiq@ki@ki#@kik@ki@ki@kiz@ki@ki,@ki=;4@ki @kiYM _You now have 854 gold pieces (gained 4).@ki%@kip@ki]@kis  You now have 860 gold pieces (gained 6).60@ki@ki@ _You see here a +0 hand axe.@ki3@kiG@ki@ki@kiE@ki-@ki@ki@ki@ki@ki@ki@kiN@ki@ki@kiz#....#### #.......# #####.###.###...# # #.# #.).# .# #######.###...##.#### ......#............[. ..#####@ki##............# ............. ..# 65.3 (14$........ ......... .....................!..................#####...........# ..@ki=...._...# @kiB6.3 (15@ki9_@ki _Found a shimmering altar of Xom.  You now have 864 gold pieces (gained 4).  Things that are here:@ki{447.3 (16@kiS9_@kiIL _a +0 dagger; a +0 robe@kiV@ki@kiZ@ki....)....@ki  ...# #####.###.#### ......#.# #.).# .# ######.###...##.#### ...............[. ..#######.#  .)#.....@kiP ..._ß_..#@kiy ,0.0)@ki +8.3 (1@kiv' ;_@ki6 _Found a white marble altar of Elyvilon and a broken altar of Ashenzari.  You now have 870 gold pieces (gained 6).709.3 (2@ki8 9_@ki: ] _You see here a +2 short sword of venom.@ki 3@ki$ @ki] @ki  #.###...# # ..... #.# #.).# .# ###### #.###...##.#### ... #............[. ..#### ##..#  #.. #....)# #....).. #.0....!.....#####...# ._...#_ß_..#@kiJ g##..._##@ki @ki ,70.3 (1@ki J__@ki @ _Found a shimmering blue altar of Sif Muna.Bki  #.# #.).# .# ######   #.###...##.#### ...   #............[. ..###   ##..#   #..   #....)#   #....)..  #####....BkiP.  .....  !.  ....#####...  Bkix.#  _...#  BkiհJ_ß_..#  ###..._##   #......  BkiBki&1BkiBkiBkiܩt ##...##.#### ....#............[. ..####.#  .)#)BkiE.#####...............##### .. ########  Bki]Bki&2Bki9_BkiBki+3.3 (2BkiB__BkiZ _M - 3 potions of mutation (gained 1)Bkih ...........[. ..####.#  .)#).#####..........Bki4##### .. _Bki\F  Bki\Bki"+4.3 (1Bki"T__BkiCkiJ ##  #.  #....)#  #....).  #####......  Cki..........  .......  .#####...  .CkiƿU# ..  Cki......_...#  Cki 1....._ß_..#  ###..._..##Cki,n #......# #######CkiN:# CkiCki&5CkiCkiCki  .).......#)........#####.......................##### .. _ _ß_###..._..#CkiCki&6Cki8_CkiCkim   #....)#   #....)..  #####.....   .....   .   #####...   Ckitm <.#   _...#   ....._ß@..#  Ckim  ###..._..##  Ckin  #......   ########      CkiQu Ckiu &7Cki}{ W__Cki~ e _There is a white marble altar of Elyvilon here.Dki}]  #....)..  ######.....  .....  #.  ######...  #.#  #_...#  #....._ß_..#  ###...@..##   #......  ########      8 _DkibB_Dkieh _There is a shimmering blue altar of Sif Muna here.Dki.   #....).  ######......  #.......  #........  #.#####...  #.# ..  #......_...#  #....._ß_..#  ###..@_..##  #......#  #      9 ___EkiGozag Ym Sagoz the Greedy Gozag Ym Sagoz the Greedy teaches that the world belongs to the rich. Those accepting this principle may exchange their gold for divine assistance. Followers of Gozag do not earn piety; the only way to impress this god is by amassing a fortune, and worshippers may request as much assistance as they can afford. Fortunately, Gozag's worshippers are said to have the touch of gold. Title - Capitalist Favour - Gozag is pleased with you. Granted powers:(Cost)Gozag turns your defeated foes' bodies to gold. Your enemies may become distracted by gold. You can petition Gozag for potion effects.(400 Gold)You can fund merchants seeking to open stores in the dungeon. (800 Gold)You can bribe branches to halt enemies' attacks and recruit allies. (3000 Gold)[!]: Overview|Powers|Wrath|ExtraEki$~ Eki~ Eki  #....)........ludeguy the Toxicologist  ######.............Octopode of Gozag Gold: 870  #..................Health: 64/64 ========================  #..................Magic: 15/15 ========================  #..........#####...AC: 3Str: 7Doom: 1% Eki 4 #..........# ..EV: 14Int: 20  #......_...#SH: 0Dex: 16  #....._ß_..#Eki :XL:  9 Next: 84% Place: Dungeon:7  ###..@_..##Noise: ---------  Time: 7879.3 (0.0)  #......#c) +0 dagger (protect)  ########Eki) GCast: Poisonous Vapours    EkiI    Ekid DYou now have 870 gold pieces (gained 6). Eki _You see here a +2 short sword of venom. _Found a shimmering blue altar of Sif Muna. Eki _M - 3 potions of mutation (gained 1) _There is a white marble altar of Elyvilon here. Ekiֈ 3_There is a shimmering blue altar of Sif Muna here.Eki Eki: Ekiؖ Eki Fki&FkiuFkiFkiFkiFki,FkiYFki-,FkiFkiFkiFkiFkiWFkiFkiQ,FkiFkiuFki,Fki7Fki FkiuFkiFkiZFkiFkiE,Fki7FkiFki,Fki2FkigFkiq,FkiFkiFki,FkiFkihFki,FkiFkiFki,FkiUFkiFki,Fki>FkiFkiFkiFkiFki Fki ,Fkih FkiT;7FkiFkiM _You now have 877 gold pieces (gained 7).FkiFki!FkiFkiFki/,FkiFkiFki,Fki Fki1#Fki*..................### ..................... .......#####.....### .......# #.....# ..._...# #.....# Fki8+.._ß_..# #.....# ..._..## #.....# ......# #.....# ####### #....@# 98.3 (1Fkin+9.0) ##....# #..........#Fki+ #..........# #..........# #...........Fki+ #.....!....# Fki+]#....(.....# Fki2B9.3 (20FkiN89_Fki_:J _Found 4 large rocks.Gki$ Gki) Read which item? Scrolls  a - 2 scrolls of enchant armourW - a scroll of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH  d - a scroll labelled EQUGIAGHAO  h - a scroll labelled GETAEGREE VIBE Gki|)  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedHki` HkiK Hki4 ..................###ludeguy the Toxicologist .....................Octopode of Gozag Gold: 877 .......#####.....###Health: 64/64 ======================== .......# #.....#Hki Magic: 15/15 ======================== ..._...# #.....#AC: 3Str: 7Doom: 1% .._ß_..# #.....#EV: 14Int: 20 ..._..## #.....#SH: 0Dex: 16 ......# #.....#XL:  9 Next: 84% Place: Dungeon:7 ####### #....@#Noise: ---------  Time: 7899.3 (0.0)##..........#c) +0 dagger (protect)HkiO #..........#Cast: Poisonous Vapours#..........##..........##...........Hki} #.....!....##....(.....# _Found a shimmering blue altar of Sif Muna. Hki _M - 3 potions of mutation (gained 1) _There is a white marble altar of Elyvilon here. _There is a shimmering blue altar of Sif Muna here. Hki d_You now have 877 gold pieces (gained 7). _Found 4 large rocks.Hki &  Hki As you read the scroll labelled EQUGIAGHAO, it crumbles to dust.  You hear a loud clanging noise!  It was a scroll of noise.Hki O=========900.3 (1Hki= 9_Hki ' _You hear a shout!Ikir .. .#####.....### ..# #.....# _...# #.....# IkiG _ß_..# #.....# ._..## #.....# ...# #.....# ###### #.....#+##### #.....#.# #.# #..#.....!....#Iki ~#....(.....##.....Iki Iki$ H---------1Iki" 7_Iki:$ Ikig  #####.....###   __ß_._..#...# ######+##### ##.......... #..........#Iki3 Iki} )---------Iki 2Iki 7_Iki3 Jki"   __ß_._..#...# ######+##### ##.......... ..Jki"S#..........#JkiF,Jki,&3Jki 37_Jkim5Jki&E __ß_._..#...# ######+##### ##.......... ..!....##..........#JkiTLJkiL&4JkiS%_JkiUJkiNV_ß_._..#...# ######+##### ##.......... ...!....#(.....# .JkiV1##########JkiU_Jki_&5Jkif9_JkihJki|m_..## #.....# ..# #.....# ##### #.....#+##### #.....# #.# #.# #.#..#..#.#. #....(.....# #..........# ############ Jki#Jki&6Jki_7_JkiJki+7.3 (2Jki7_JkiuT _d - a silvery potionJkiH ..# #.....# #### #.....#+##### #.....# #.# #.# ###.#...#..#.#. #....(.@...# #..........# #.Jki |# ############ JkiJki5+8.3 (1JkiaJkiKkiJ"Kki(-Drink which item? Potions  c - 7 potions of curing  g - a potion of magicb - a potion of brilliance  e - 5 potions of enlightenment  M - 3 potions of mutation  d - a silvery potion  f - 2 sedimented cyan potions  j - 4 bubbling grey potions  k - a sapphire potion  n - 2 bubbling amethyst potions  o - 2 murky coppery potions KkiO) p - a glowing amethyst potion [!] read|quaff|evoke[?] describe selectedMki֞ Mki̤|...# #.....#ludeguy the Toxicologist #### #.....#+#####Octopode of Gozag Gold: 877##..........#Health: 64/64 ========================#..........#MkiRMagic: 15/15 ========================#..........# ##AC: 3Str: 7Doom: 1%#..........#...EV: 14Int: 20#..............SH: 0Dex: 16#..........#.XL:  9 Next: 84% Place: Dungeon:7#....(.@...#Mkiv1Noise: ---------  Time: 7908.3 (0.0)#..........#c) +0 dagger (protect)#..........#MkiCast: Poisonous Vapours#..........##..........#Mki############ _Found 4 large rocks.  As you read the scroll labelled EQUGIAGHAO, it crumbles to dust.  MkiťEYou hear a loud clanging noise!  It was a scroll of noise. Mkiޥ_You hear a shout! Mki?_d - a silvery potionMkiI9.3 (1Vertigo MkiC _It was a potion of moonshine. You feel tipsy.NkiEaNkiaL 9  NkiPdNkieNkici=NkijNkikNkilNkin,NkimpNki s,Nki|tNkiv,NkiLxNkizNki{Nki|Nki,Nki/Nki,Nki^NkixNki214 Nki$Nkih _The world stops spinning.Nki֎3NkiNkiuNkiՖ,NkiNkiNki,NkigNki!Nki  You encounter an orc. It is wielding a +0 hand axe.Nkif# #.....#  #.....# #.....# #.....#+##### ##....# #....# ####....####...o#....#....###Nkid#..........@...?...#..........#....####....(.....#....##....#######....##..........# o   orc (wandering)#..........#############Nkiڰ/212.0)NkiNki32.3 (13 _NkiNkiNki  #     #.....#+#####  ##..........# #..........# ###  Nki#..........####...o  #..........#....###  #..........@...?...  #..........#....###  NkiP#....(.....#....#  #..........######  Nki':#..........# #..........# NkiD6#..........# ############Nki`!NkilQ      #.....#+#####  ##..........# #..........# ###  #..........####...o  #..........#....###  #..........@...?...  #..........#....###  #....(.....#....#  #..........###### #.......... #..........# #.......... ########### NkiatNki.uNki{Nki9~[ _An orc is nearby!Oki.# #.....# ## #.....# # #.....# # #.....#+##### ##.# #.# ### #.####...o #.#....### #..@....?... #....#....### #....(.....#....# #.###### #.# #.# #.# ##Oki k3.0) _Okig2oOkio.o   orc (wandering)Okio&4Oki)vOkiwOki6# #.....#  #.....#  #.....#  #.....#+##### ##.# #.# ### #.####..o. OkiH#.#....### #.?... #.#....### #....(.....#....# #.#######.##.# #.Oki%U###Oki3o.OkiOki&5OkiOkiOkiUK  #.....#  #.....# #.....# #.....#+##### ##....# #...# ##.OkiK .####.o.#.#....##.?.#.OkiK #....##....(.....#....# #...#OkiK Z######....#OkiL #..........# #..........#Oki!L 3############OkiMM .OkiS (OkiT &6OkiY OkiW[ Okit J  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Oki&=Oki=OkiBOkiE _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Pkiv#.....# #.....# #.....# #.....#+##### ##..........# ##..........# o#### #...####..... #.#....##.?.#.#....##....(.....#....# #........#..........##..........# o   orc (wandering)#..... Pki.Pki߳(PkiK&7PkiPPki0 _The orc leaves your sight.Pki#.....#  #.....# .##.....# .##.....#+##### .###.# o# #..........# .#### #....####..... #.#....##.?.#.#....##....(.....#....# #.  #.# o   orc (wandering) Pki#Q.oPki*ToPki4,I===8Poisonous VapoursPki1Pkie4% _The orc shouts!Pki- #.....# #.....# #.# #.....# #.# #.....#+##### #.# ##.# #.#  #.# #o####  #....####.....  #.#....##..  #.#....##....(.....#....#  #.# Pkiś N.oPkij Pki 0---9Pki Pki _You see here a scroll labelled XOHY EMISHRO.Qkil3B#.....# ludeguy the Toxicologist #.....# #.# Octopode of Gozag Gold: 877 #.....# #.# Health: 64/64 ======================== #.....#+##### #.# Magic: 13/15 ====================---- ##..........# #.# AC: 3Str: 7Doom: 1%  #..........# #.####  EV: 14Int: 20  #..........####$....  SH: 0Dex: 16  #..........#....#######  XL:  9 Next: 84% Place: Dungeon:7  #..............@.......  Noise: ---------  Time: 7929.3 (0.0) Qki4 #..........#....#######  c) +0 dagger (protect)  #....(.....#....# Cast: Poisonous Vapours  #..........######  #..........#  #..........# o   orc  #..........#  ############Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an orc, wielding a +0 hand axe and wearing a +0 chain mail (chance to  weaken: 100%)  Qki4_You feel a surge of power! The glob of mercury hits the orc!  The orc looks weaker.Qki:" #.# #.# #.# #.#       ...#...*#######  ......  ...###  #....(           Qki5.Qki877 5==30.3 (1Poisonous VapoursQkiyQki  Press: ? - help, Shift-Dir - straight line  Aim: an orc, wielding a +0 hand axe and wearing a +0 chain mail (chance to  weaken: 100%)  You feel a surge of power! The glob of mercury hits the orc!  The orc looks weaker. _You kill the orc!QkiUM .....#+#### # # #.#######...####$..........#...@#######....?.............#######....(.....#....#QkiwQki/--1QkiQkiSQki t aM. .....#+#### # # #.###########@..........#....#######....?.......#..........#....#######.Qki{ 8--Qki>| 2Qki Qki j  You now have 883 gold pieces (gained 6).  Things that are here:Qki H833.3 (2Qki QkiƖ T _a +0 hand axe; a +0 chain mailQki  ..##+##### ##..........  ##########).......#...@#######.......?.......#....#######.############QkiҳQki+4.3 (1QkiQQkiRki= #+##### ##..........  ##########)..........#....#######RkiQ.......@.......#....#######(..... RkiRki &5RkiRkinRkiZ4==6.3 (2RkiRkib _e - a scroll labelled XOHY EMISHRORki7Rki:Read which item? Scrolls  a - 2 scrolls of enchant armourRki:W - a scroll of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH Rki;R e - a scroll labelled XOHY EMISHRO  h - a scroll labelled GETAEGREE VIBE RkiA;  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedSki SkiV SkiF #.....##.#ludeguy the Toxicologist #.....##.#Octopode of Gozag Gold: 883 #.....##.#Health: 64/64 ======================== #.....#+##### #.#Magic: 14/15 ======================-- ##..........# #.#AC: 3Str: 7Doom: 1%  #..........# #.#######EV: 14Int: 20  #..........####).......SH: 0Dex: 16  #..........#....#######XL:  9 Next: 85% Place: Dungeon:7  #..............@.......Noise: ---------  Time: 7936.3 (0.0)  Ski #..........#....#######c) +0 dagger (protect)#....(.....#....#Cast: Poisonous Vapours#..........#######..........##..........##..........#############The orc looks weaker. _You kill the orc!You now have 883 gold pieces (gained 6).  Things that are here: _a +0 hand axe; a +0 chain mail _e - a scroll labelled XOHY EMISHROSki" P  Okay, then.Ski'# Ski( Ski* . _Ski .....# #.# .....# #.# .....# #.# .....#+##### #.# .# #.# #.# #.####### #.SkiR ####)....... #.#....# #. #.#....# Ski #....(.....#....# #.###### Ski Ski Skiw 27.3 (1 _Ski, Ski TkiTki|/Drink which item? Potions  c - 7 potions of curing  g - a potion of magicb - a potion of brilliance  e - 5 potions of enlightenment  M - 3 potions of mutation  j - 3 potions of moonshine  d - a silvery potion  f - 2 sedimented cyan potions  k - a sapphire potion  n - 2 bubbling amethyst potions  o - 2 murky coppery potions  p - a glowing amethyst potion [!] read|quaff|evoke[?] describe selectedUkiqUkiUkit".....##.#ludeguy the Toxicologist .....##.#Octopode of Gozag Gold: 883 .....##.#Health: 64/64 ======================== .....#+##### #.#Magic: 14/15 ======================-- #..........# #.#AC: 3Str: 7Doom: 1% #..........# #.#######EV: 14Int: 20 #..........####).......SH: 0Dex: 16 Uki8#..........#....########XL:  9 Next: 85% Place: Dungeon:7 #...............@.......Noise: ---------  Time: 7937.3 (0.0) #..........#....########c) +0 dagger (protect) #....(.....#....#Cast: Poisonous Vapours #..........###### Uki#..........# #..........# #..........# ############ _You kill the orc!UkiJYou now have 883 gold pieces (gained 6).  Things that are here: _a +0 hand axe; a +0 chain mail Ukiw_e - a scroll labelled XOHY EMISHRO _Okay, then.Ukiq  #.# #.# #.# #.# #.# #. ####) ..#....######## .......@....... ..#....######## (.....#....#######     It was a potion of berserk rage.  A red film seems to cover your vision as you go berserk!  You feel yourself moving faster! You feel mighty!  You extract magical energy from the potion.Uki96/965==8.3 (1Berserk Uki!Ukiݯ7 _f -> B - a potion of berserk rageVki # #.# # #.# # #.# #+##### #.# .# #.# .# #.# .####). .#....# ..#....#. ....(.....#....# .###### .# .Vki5 7# .#  Vki$ @9 (0.6Vkik VkiX k _You feel a strong urge to attack something.Vki0i# #.# # #.# # #.# #+##### #.# # #.# # #.# ####). #....###....#.#(.....#....# ###### # # #  Vkia8Vki9\9.6 (0.7Berserk Vki>Vki?Wki# #.# # #.# # #.# #+##### #.# # #.# # #.# ####). #....# # #....#.# (.....#....# ###### # # #  WkiWki1-40.2 (0.6Wkiy _You feel your anger nearly subside.Wkii# #.# .# #.# .# #.# .#+##### #.# # #.# # #.# ####). #....# # #....#.# .(.....#....# ###### # # #    #.# #.# #.# #.# #.# )...########## .......@....# ...########.# (  You are no longer berserk.64/64==9 (0.7Slow -Berserk WkiWki _You are exhausted. You feel yourself slow down.WkiRN# #.# # #.# # #.# #+##### #.# WkiS# #.# # #.# ####). #....# # #....#WkigS&.# (.....#....# ###### ### Wki1ZWkiZ98832.4 (1.5Wkin_Wki&bWkiu #.#  #.#  #.# +##### #.# # #.# # #.# ####). Wkiu"#....# # #....#.# .....#....# Wki.vj####### #WkiQv[## Wki~Wkiƅ'3.9WkiwWki1Wki 3Wki WkiE BWki Wki Wki Wki Wki WkiW Wki Wki8 Wki Wki Wki Wki Wkit Wki Wki= Wki ,Wki Wkit ,Wkih Wki{ Wki Wki Wki Wki Wki~ WkiL Wki Wki? Wki Wki Wkij Wki Wki Wki Wki WkiV Wki Wki ,Wkis Wki Wki Wki! Wki Wki Wki Wki Wki Wki} Wki, ,Wki Wki Wki Wki WkiG ,Wki( Wki+ ,Wki, Wki. ,Wki. Wki"1 ,Wki7 Wki9 Wki9 Wkiz: WkiG= W _You start waiting.WkiWF WkiL 081.4 (37.5)WkiL 92.9 (39.0WkifV q _You feel yourself speed up.XkiXki~uXkinXkiXki,XkiXkiXkiXkiXkiA Xki Xki; XkiD ,Xki XkiIXkiXki9XkiXki9XkiXkidXkiXkiXkiXki+XkiXkiXkiXkiXki$Xki|(Xki^Xki!r _You recover from your berserk rage.Xki"Xki"Xki#Xki$Xki%XkiF&Xki&Xki'Xki2)Xki)Xki*Xki?,Xkii-Xki-Xki<.Xki/Xki1Xki1Xki 2Xki(3Xki}4Xki4Xkiz5Xki6Xki7Xki7Xki8Xki:Xkiu<Xki<XkiY=Xki>Xki?Xki@Xki@XkiIBXkimCXkiCXkiDXkiFXkiGXkiH,XkiIXkiJXki"KXkiKXkiLXkiM,Xki4NXki=OXkiPXkiPXkiZQXkiiRXkiSXkiSXkiVTXkimUXkiVXkiVXki0WXkiCXXkiYXki6ZXkiZXki`\Xki\Xki]]Xki]Xki_Xki`,XkiQaXkicXkicXkidXkidXkiOfXki3gXkigXkiYki?YkiD.... ###...  #.# ##.##....F#.#.# ..#.#########.###...........  ### #############Yki}Yki&5YkiYki^Yki ##### .... ###...  #.# ##.##....F#.#.# ..#.#########.###...........  ### #############Yki Yki &6Yki Ykih Yki $The helpless bullfrog fails to defend itself.  You skewer the bullfrog like a kebab!!!  Your weapon exudes an aura of protection.YkiE =# Yki_ 883 10 97.8 (0.9Poisonous Vapours _You kill the bullfrog!Yki Yki YkiP q _You feel the doom around you dissipate.ZkizZki{Zki{Zki}Zki~ZkiW _ZkiX27ZkiZkiM _You now have 887 gold pieces (gained 4).Zki!ZkiZki ZkiZkiZki0 3 ZkiZkiݎZki~n  You encounter a water moccasin.Zki #........# ........# ... .......# Zki###### ......# .....# S.... ####.# ZkiT...  #.# .##.##Zki?9#....Zkip#.#.# #..#.# #..#.#.# #.#ZkiK#.#.#.##.#ZkiʗS   water moccasin (asleep)#...#.#########.#Zki#.###...........#### #############Zkip.31.8 (4.0ZkiE22.8 (5 _Zki*ZkiZkiw #........#  ........#  .......#  ......#  S.... ...  #.# #.#  ZkiKx| #@#   #.#   #.#   #.#  Zkirx/ #.#   #.# Zkix. #.#  ..# Zkix/ ### Zki)  #........#  ........#  .......#  ......#  S.... ...  #.# #.#   #@#   #.# Zki   #.#   #.#   #.#   #.#  #.# Zki l ..#  ### Zki Zki Zki Zki& e _A water moccasin is nearby!Zki Z #........#  ........#  .......#  ......#  S.... ...  #.# #.#   #@#   #.#  Zki #.#   #.#   #.#   #.#  #.#  Zki =..#  ### ZkiC " #........#  ........#  .......#  ......#  S.... ...  #.# #.#  Zki\D  #@#   #.#   #.#   #.#   #.#  ZkiD #.#  #.#  ZkiD c..#  ### ZkiJ Zki[K ZkiP ZkiuR e _A water moccasin is nearby![ki62ludeguy the Toxicologist#........#Octopode of Gozag Gold: 887 ###........#Health: 64/64 ======================== ..........#Magic: 13/15 ====================---- ######......#[ki2AC: 3Str: 7 .....#S....EV: 14Int: 20 ####.#*..SH: 0Dex: 16[ki2#.##*#XL:  9 Next: 89% Place: Dungeon:7  [ki2>###.####@#[ki3Noise: ---------  Time: 8032.8 (0.0)  #.....##.#[ki'36c) +0 dagger (protect)[kiE3t#.#.#.##.#Cast: Poisonous Vapours[kie34#.#.#.##.#[ki3>#.#.#.##.#[ki3K#.#.#.##.#[ki3S   water moccasin (weak)#...#.#########.#[ki3B#.###...........#[ki4### #############Aiming: Mercury Arrow (safe; 1% risk of failure)  [kix4Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (asleep, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the water moccasin.  The water moccasin looks weaker.[kidG.S[ki,$.[kiƽ4==3.8 (1[ki[ki  Press: ? - help, Shift-Dir - straight line  Aim: a water moccasin (asleep, chance to weaken: 88%)  [kirYou feel a surge of power!  The glob of mercury hits the water moccasin.water moccasin looks weaker[ki-. _is lightly wounded.[kiڈ  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.[kiP [kiQ [kiU [kiW _You can't see any susceptible monsters within range! (Use Z to cast anyway.)\kiu  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.\ki>4\kidC\kiE  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failure)\kiEonfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)\ki & _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.\ki# \ki \kiL   Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)]ki  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b + Mercury ArrowConjuration/Alchemy 1% 2 c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy2%4 Select a spell to describe [?] help [!]/[I] toggle spell headers^ki*^ki^kivludeguy the Toxicologist#........#Octopode of Gozag Gold: 887 ###........#Health: 64/64 ======================== ..........#Magic: 13/15 ====================---- ######......#AC: 3^ki¾+Str: 7 .....#.....EV: 14Int: 20 ####.#S..SH: 0^kiuDex: 16#.##.#^kiXL:  9 Next: 89% Place: Dungeon:7  ###.###^kiF#@#Noise: ==-------  Time: 8033.8 (0.0)  #.....##.#^kidTc) +0 dagger (protect)#.#.#.#^kiV#.#Cast: Poisonous Vapours^ki #.#.#.#^ki>#.##.#.#.#^kiֿs#.##.#.#.##.#^ki mS   water moccasin (weak)^kiC#...#.#########.##.###...........#### #############^kiaCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. ^ki_You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)^ki+^ki^ki^kiz_kiŲ Cludeguy the Toxicologist#........#Octopode of Gozag Gold: 887 ###........#Health: 64/64 ======================== ..........#Magic: 11/15 =================------- ######......#AC: 3Str: 7 .....#....._ki@ EV: 14Int: 20 ####.#*..SH: 0Dex: 16#.##*#XL:  9 Next: 89% Place: Dungeon:7  ###.####@#_ki zNoise: ==-------  Time: 8033.8 (0.0)  #.....##.#c) +0 dagger (protect)#.#.#.##.#Cast: Poisonous Vapours#.#.#.##.##.#.#.##.##.#.#.##.#S   water moccasin (weak)#...#.#########.##.###...........#### #############Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (lightly wounded, weak, chance to weaken: 88%)  You feel a surge of power!_ki; Q.Sonfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a water moccasin (lightly wounded, weak, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury misses the water moccasin._ki< +4.8 (1_ki-B _ki5D \ _The water moccasin closely misses you.`kiP  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.`kit   ludeguy the Toxicologist #........#  Octopode of Gozag Gold: 887 ### ........#  Health: 64/64 ======================== ... .......#  Magic: 7/15===========------------- ###### ......#  AC: 3Str: 7 .....# ..... EV: 14Int: 20 ####.# ... SH: 0Dex: 16 `kiu  #.# #S# XL:  9 Next: 89% Place: Dungeon:7  ###.### #@# Noise: ==-------  Time: 8034.8 (0.0)  #.....# #.# c) +0 dagger (protect)  #.#.#.# #.# Cast: Poisonous Vapours  #.#.#.# #.#  #.#.#.# #.#  #.#.#.# #.# S   water moccasin (weak) `kiv  #...#.#########.#  #.###...........#  ### ############# _The water moccasin closely misses you.Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.`kiZv XAiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (lightly wounded, weak)`kiY! Sludeguy the Toxicologist#........#Octopode of Gozag Gold: 887 ###........#Health: 64/64 ======================== ..........#Magic: 7/15`ki# -===========------------- ######......#AC: 3Str: 7 .....#.....EV: 14Int: 20 ####.#...SH: 0Dex: 16#.##S#XL:  9 Next: 89% Place: Dungeon:7  ###.####@#Noise: ==-------  Time: 8034.8 (0.0)  #.....##.#c) +0 dagger (protect)#.#.#.##.#Cast: Poisonous Vapours#.#.#.##.##.#.#.##.##.#.#.##.#S   water moccasin (burning, weak)#...#.#########.##.###...........#### #############Aiming: Sticky Flame (dangerous; 2% risk of failure)  `kiN# &Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (lightly wounded, weak)  You feel a surge of power!  The sticky flame hits the water moccasin!  The water moccasin is heavily wounded.`ki  : a water moccasin (lightly wounded, weak)  You feel a surge of power!  The sticky flame hits the water moccasin!  The water moccasin is heavily wounded.water moccasin is covered in liquid fire!  The water moccasin burns!=5.8 (1`ki; `ki F _The water moccasin bites you but does no damage.akia $You puncture the water moccasin!  Your weapon exudes an aura of protection.akieh(akiwlf10 95--6.7 (0.9aki%rakisR _You kill the water moccasin!akirM # ####. ... #.. ###### #........# ....+........# ####........# #.# ##.##.....  aki#.#.#.##.#....#akiakiW---7.7 (1.0akiaki~aki928=-8.7 (2akiaki%> _You now have 892 gold pieces (gained 5).aki 892 3 aki% Baki aki 2=akiӏ akiF aki aki aki ,aki aki aki] N9==akiL akiB ,aki akiS aki aki5 aki$ akib akiΝ aki/ aki :==akis aki aki aki akiң aki aki¤ akiC aki R10/15==aki aki6 ,aki aki akiΫ aki aki ,aki akiL aki :==aki aki aki aki akiڵ ,aki) akit aki aki aki aki] M1=akiź aki3 akiw aki> aki\ aki akit aki akiF aki aki akiW #=aki akir aki4 aki| akia aki) akib aki^ aki: aki aki E2==akit aki aki aki aki! akit akiz akij aki aki ,aki2 :==aki aki ,aki/ akiU aki aki+ aki_ aki #3aki (=aki akiO aki aki akix ,aki aki7 aki| aki aki O=akiJ aki9 akiq aki aki akif aki akid aki 64==aki akis aki aki aki aki aki4 aki aki aki0 aki aki aki :==aki aki aki aki aki aki> aki aki akiJ L5==aki akis 4 _Magic restored.aki aki aki akij aki aki! aki aki akis g  You encounter a phantom.aki[ "W ### # ... ###### #.....@..# .....# +........# ####.# #........#aki > #.# ######.#####.##....#W   phantom (dormant)aki: #.#.# #..#.# #aki 090.7 (52.0)aki *1.7 (53 aki _aki aki" bki:g #..W.....#  #........#  #........#  #........#  #........#  #........#  #........#  #.....@..#  +........#  #........#  #.# ######.###   #.#   #.#   #.#   #.#   #.#bki #..W.....#  #........#  #........#  #........#  bkiw#........#  #........#  #........#  #.....@..#  +........#  #........# bki #.# ######.###   #.# bki_  #.#  bki #.#   #.# bkiB  bkif bkibkiYbki+bkiZH _A phantom is nearby!bkibki^$ #..W.....#  #........#  #........#  bki$#........#  #........#  #........#  #........#  #.....@..#  +........#  #........# bki%A #.# ######.###   #.# bki5%  #.# bkiX%  #.#  bkix% #.#  bki%, #.#bkiK #..W.....#  #........#  #........#  #........#  #........#  #........#  #........#  #.....@..# bkiO +........#  #........#  #.# ######.###   #.#   #.#   #.#   #.#   bkibkibkibki*^ _A phantom is nearby!bki  ########## #..W.....# #.# #.# #.# #.# #### #.# .... #.# ####### #........# ......# +........# #####.# #........# #.# ######.### ###.### #.# #.....# #.# #.#.#.# #.#  #.#.#.# #.#bki~ bkiة U==2.7 (1.0) _bki bkiް ckiPEJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.cki+  _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ckiN3 ########## #..W.....# #.# #.# #.# #.# ##### #.# ..... #.# ######## #.# .......# +.# ######.# #........# #.# ######.### ###.### #.# #.....# #.#  #.#.#.# #.#cki&;cki<$3 ckiL< _ckiKAcki;CckiJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ckiackiacki5gcki2i  Casting: Sticky Flame (dangerous; 2% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) ckii Casting: Sticky Flame (dangerous; 2% risk of failure)ckiionfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ckiW V ########## #..W.....# #.# #.#ckiW  #.# #.# ###### #cki0X .# ...... #.# ######### ckicX k#.# ........# +ckiX .# #######.# #........# #.# ######.### ###.### #.# #...ckiY I..# #.#ckia ckic -4 _ckih ckimj ckiU{ludeguy the ToxicologistOctopode of Gozag Gold: 892Health: 64/64 ========================##########Magic: 13/15 ====================----#..W.....#AC: 3Str: 7#..*.....#EV: 14Int: 20#..*.....#SH: 0Dex: 16#..*.....#cki{VXL:  9 Next: 95% Place: Dungeon:7#..@.....#Noise: ---------  Time: 8094.7 (0.0) #######........#c) +0 dagger (protect) ......#........#Cast: Poisonous Vapours ######### #........# ........# +........# #######.# #........#W   phantom (weak)#.# ######.######.###cki|J#.##.....##.#cki4|Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  ckiZ|;Press: ? - help, Shift-Dir - straight linecki|Aim: a phantom (dormant, chance to weaken: 76%)  You feel a surge of power! The glob of mercury hits the phantom.  The phantom looks weaker.cki(G.Wcki&..ckiR&==cki5.7 (1cki\ cki   Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (dormant, chance to weaken: 76%)  You feel a surge of power! The glob of mercury hits the phantom.  The phantom looks weaker. _is lightly damaged.dki,<ludeguy the ToxicologistOctopode of Gozag Gold: 892Health: 64/64 ========================##########Magic: 11/15 =================-------#........#AC: 3Str: 7dki,2#..W.....#EV: 14Int: 20#..*.....#SH: 0Dex: 16#..*.....#XL:  9 Next: 95% Place: Dungeon:7dki-6#..@.....#Noise: ==-------  Time: 8095.7 (0.0) #######........#dki=-Rc) +0 dagger (protect) ......dki^-h#........#Cast: Poisonous Vapours dki-######### #........# ........# +........# dki-#######.# #........#W   phantom (weak)dki-#.# ######.######.###dki-J#.##.....##.#dki.MConfirm with . or Enter, or press ? or * to list all spells.dki6.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (lightly damaged, weak, chance to weaken: 76%)  dkiX.eYou feel a surge of power! The glob of mercury hits the phantom.  The phantom looks even weaker.dkig.W.dkik+6.7 (1dkihdkiǹ  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (lightly damaged, weak, chance to weaken: 76%)  You feel a surge of power! The glob of mercury hits the phantom.  The phantom looks even weakerdki-. _is lightly damaged.dkil;ludeguy the ToxicologistOctopode of Gozag Gold: 892Health: 64/64 ========================##########Magic: 9/15==============----------#........#AC: 3Str: 7dki@m_#........#EV: 14Int: 20#..W.....#SH: 0Dex: 16#..*.....#XL:  9 Next: 95% Place: Dungeon:7#..@.....#Noise: ==-------  Time: 8096.7 (0.0) #######........#c) +0 dagger (protect) ......#........#Cast: Poisonous Vapours ######### #........# dkihm ........# +........# #######.# #........#W   phantom (weak)dkimj#.# ######.###dkim`###.####.##.....##.#dkimCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.dkimAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (lightly damaged, weak, chance to weaken: 76%)  dkin@You feel a surge of power! The glob of mercury hits the phantom.dkivG.WdkiLA7.7 (1dkidki,MConfirm with . or Enter, or press ? or * to list all spells.Aim  dki^Press: ? - help, Shift-Dir - straight line: a phantom (lightly damaged, weak, chance to weaken: 76%)  dkiYou feel a surge of power! The glob of mercury hits the phantom. _The phantom is moderately damaged.eki3   Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.eki  ludeguy the Toxicologist  Octopode of Gozag Gold: 892  Health: 64/64 ======================== eki##########  Magic: 5/15========---------------- #........#  AC: 3Str: 7 #........#  EV: 14Int: 20 #........#  SH: 0Dex: 16 #..W.....#  XL:  9 Next: 95% Place: Dungeon:7 eki#..@.....#  Noise: ==-------  Time: 8097.7 (0.0) ###### #........#  c) +0 dagger (protect) eki...... #........#  Cast: Poisonous Vapours ######### #........# ........# +........# eki#######.# #........#  W   phantom (weak) ekiH#.# ######.###  ###.### #.# eki7{ #.....# #.# _The phantom is moderately damaged.ekirCasting: Mercury Arrow (safe; 1% risk of failure)  ekiConfirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a phantom (moderately damaged, weak, unstickable)ekiYG ludeguy the ToxicologistOctopode of Gozag Gold: 892Health: 64/64 ========================##########Magic: 5/15========----------------#........#AC: 3Str: 7#........#EV: 14Int: 20ekiH #........#SH: 0Dex: 16#..W.....#XL:  9 Next: 95% Place: Dungeon:7#..@.....#Noise: ==-------  Time: 8097.7 (0.0) #######........#c) +0 dagger (protect) ......ekiH e#........#Cast: Poisonous Vapours ######### #........# ........# +........# #######.# #........#W   phantom (weak)#.# ######.######.###ekiH J#.##.....##.#eki0I Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  eki\I Press: ? - help, Shift-Dir - straight lineAim: a phantom (moderately damaged, weak, unstickable)  You feel a surge of power! The sticky flame hits the phantom.eki Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (moderately damaged, weak, unstickable)  You feel a surge of power! The sticky flame hits the phantom.  The phantom is heavily damaged.eki 3=8.7 (1eki' eki T _The phantom barely misses you.fkic  You barely miss the phantom. Your squeeze misses the phantom.The phantom is heavily damaged.fkidT2---fkid9.6 (0.9fkijfkipl+ _The phantom hits you.fki   ludeguy the Toxicologist  Octopode of Gozag Gold: 892  Health: 62/64 =======================- fki ##########  Magic: 1/15=----------------------- #........#  AC: 3Str: 7 #........#  EV: 14Int: 20fki.  #........#  SH: 0Dex: 16 #..W.....#  XL:  9 Next: 95% Place: Dungeon:7 fki\ #..@.....#  Noise: =--------  Time: 8099.6 (0.0) fkir ###### #........#  c) +0 dagger (protect) fki ...... #........#  Cast: Poisonous Vapours fki N######### #........# ........# +........# fki #######.# #........#  W   phantom (weak) fki !#.# ######.### fki N ###.### #.#  #.....# #.# fki 3_The phantom hits you.  fki- +Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.fkiW Aiming: Sticky Flame (dangerous; 2% risk of failure)  fkio Press: ? - help, Shift-Dir - straight lineAim: a phantom (heavily damaged, weak, unstickable)fkix Oludeguy the ToxicologistOctopode of Gozag Gold: 892Health: 62/64 =======================-##########Magic: 1/15=-----------------------#........#AC: 3Str: 7fkily ?#........#EV: 14Int: 20#........#SH: 0Dex: 16#..W.....#XL:  9 Next: 95% Place: Dungeon:7#..@.....#Noise: =--------  Time: 8099.6 (0.0) #######........#c) +0 dagger (protect) ......#........#Cast: Poisonous Vapours ######### #........# fkiy ........# +........# #######.# #........#W   phantom (weak)#.# ######.######.####.##.....##.#fkiz +Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.fki%z Aiming: Sticky Flame (dangerous; 2% risk of failure)  fkiJz Press: ? - help, Shift-Dir - straight lineAim: a phantom (heavily damaged, weak, unstickable)  fkihz =You feel a surge of power! The sticky flame hits the phantom!fkionfirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a phantom (heavily damaged, weak, unstickable)  You feel a surge of power! The sticky flame hits the phantom!  The phantom is severely damaged.fkiO6==100.6 (1fkiP fki T _The phantom barely misses you.gki  You puncture the phantom!  Your weapon exudes an aura of protection.  The phantom is almost destroyed.gki]10 --1.5 (0.9gkigki > _The phantom hits you but does no damage.gkiL-s $You hit the phantom.gki2(gki3gki_7ludeguy the ToxicologistOctopode of Gozag Gold: 892 Health: 62/64 =======================-##########Magic: 2/15===---------------------#........#gki7`AC: 10  Str: 7#........#EV: 14Int: 20#........#SH: 0Dex: 16#..$.....#XL:  9 Next: 100% Place: Dungeon:7#..@.....#Noise: =--------  Time: 8102.4 (0.9) gki$8Q#######........#gki?8c) +0 dagger (protect) ......#........#gkiU8,Cast: Poisonous Vapours gkik8]######### #........# gki8G........# +........# gki8h#######.# #........#gki8x#.# ######.######.###gki8*#.#gki8#.....##.# gki8F_The phantom barely misses you.gki8fYou puncture the phantom!  Your weapon exudes an aura of protection.  gki%9:The phantom is almost destroyed. gki;9Z_The phantom hits you but does no damage.  You hit the phantom.gki: _You destroy the phantom!You have reached level 10!gkiE/  --more--hki{9/716==810 0% hki<hkifR _You feel stronger.hki 3hki hki hki[ 70 _hki hki hki hki hki% hki hki' t1= 3 hki hki z _HP restored.3=hki hki hki hki hki hki hki< hki+ hkia 9=hki hki hki 9=hki hki hki hkiE hki; ,hki hki {8924==hkif hki hki< hki hkiu hki hki hki hki  hkin hki hki :==hki[ hki hki hkig hki hki hki= hki4 i5=hki hkiU hki hki hki" ,hkiz" hki$ ,hkii% hki& hki' 9=hki' hkiO) hki) hkig* hki+ hki, T6==hki, hki. ,hki/ hki1 hki>2 hki2 hkiG4 hkij4 hki4 hki5 hki5 :==hkiY6 hki<7 hki^7 hki7 hki8 hki8 hkiF9 hkiG: hki: S7=hki; hki< ,hki|< hki-= hki\= hki= hkim> hki> hki> hki? hki? 9=hki@ hkiA ,hkizB hki:C hki^C hkiC hkiD hkiD T8==hkibE hkiiF ,hkiF hkiG hki H hki[H hki I hki;I hkiI hkiJ hkiJ :==hki:K hkiL hkiIL hkiL hkiEM hkizM M9=hki N hkiiO hkiO hkiP hkiQ ,hki......## #........##.# .........# #........##.# .......# #........# hki ## #.#.....# #........# .# #.# #...# #........# .# #.##########@##.#........#-hki 211.4 (109.0) .####)..............#........# .#....##########.####........# ...............#....'........# .#....########.######........# hki+ .#....# #.# ######.### .###### ###.### #.# .# #.....# #.# .# #.#.#.# #.#hkit hki G-2.4 (110hki]  _Found a stone staircase leading down. _There is an open door here.hkiݤ hkiG hki hki hki hki P _hki hki ,hkil hki ,hki| hki hkiB hkii hkiķ hki hki' hkio hki hkiH hki߼ hkiľ hki hki hki hki hki; ,hki hkiL hki hki hki! hki hkiw hki hki& hki hki hki hki hki= hki5 hkij hki hki hki hki, hki hki hki ,hkip hkiv hkin hki hki hkiX hki hki hki hki hki hkiZ hki< hkiM hki hki) hki hkii hki ,hki| hki$ hki( ,hki hki hki hkio hki O _a - 3 scrolls of enchant armour (gained 1)hki hki hki hki hki hki hkiD hki hki} hki hki hkiB hki7 hkir hki hkiO hki ,hki< hki^ hki; hkiv hki hkid hki ,hki hkil hki hki hkiN hkim hki hki  hkiO hki hki ,hki hki> hki hki hki> hki[ hki hki hkiG hki hkiv hki ,hki% hkil hki hki= \..............^..>.. .##.#.......<.......# .##.#.#####.#####...## ..#.#.# ..... .... ....#.#.###.### ... ## .####.#.# #.. .. .. hkiz .####.#.# ### .#.##.. ...#.#.###....... ###.#.#.# ####.@.#.# hki n...#.#.# #........# ###...#.####.#.####+# hki .#........# ####....###.####hki .....#.###.# #.#...#.#hki .............######.#.######hkij 48.4 (36.0)  A malevolent force fills the Dungeon...hki+ /  --more--ikiY T  You fall into a shaft and drop 3 floors!iki3` /  --more--kki Generating dungeon...o\\/o/ building the Dungeonkki < \o\kki< /o/kki< \o\lki]9lkigludeguy the ToxicologistOctopode of Gozag Gold: 898Health: 71/71 ========================Magic: 16/16 ========================AC: 3Str: 8EV: 14Int: 20SH: 0Dex: 16XL: 10 Next:  0% Place: Dungeon:10Noise: ---------  Time: 8248.4 (36.0)c) +0 dagger (protect)Cast: Poisonous Vapours _You open the door. _Found a stone staircase leading down. _There is an open door here. _a - 3 scrolls of enchant armour (gained 1)  A malevolent force fills the Dungeon...You fall into a shaft and drop 3 floors!lkin############....##......$..##.........###..........##..........##.....@....#+..........##.........###.........##.........############lki0 _The shaft crumbles and collapses.lkiK _Found 18 gold pieces.mkiOmkiфRead which item? Scrolls  a - 3 scrolls of enchant armourW - a scroll of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled JODEIS FAARIKH  e - a scroll labelled XOHY EMISHRO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedmkixmkimkiludeguy the ToxicologistOctopode of Gozag Gold: 898######Health: 71/71 ========================######....#Magic: 16/16 ========================#......$..#AC: 3Str: 8#.........##EV: 14mkiInt: 20#..........#SH: 0Dex: 16#..........#XL: 10 Next:  0% Place: Dungeon:10#.....@....#Noise: ---------  Time: 8248.4 (0.0)+..........#c) +0 dagger (protect)#.........##Cast: Poisonous Vapours#.........##.........############ _There is an open door here. _a - 3 scrolls of enchant armour (gained 1)  A malevolent force fills the Dungeon...You fall into a shaft and drop 3 floors! _The shaft crumbles and collapses. _Found 18 gold pieces.mki  As you read the scroll labelled JODEIS FAARIKH, it crumbles to dust.  It is a scroll of amnesia.mki=/  --more--okilokiTo Your spells (forget)TypeFailure Level  a - Poisonous VapoursAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemyokio81%4  e - Sticky FlameFire/Alchemyokio2%4 Select a spell to forget [?] help [!] toggle spell headers[Esc] exitoki6oki:oki>^ludeguy the ToxicologistOctopode of Gozag Gold: 898######Health: 71/71 ========================######....#Magic: 16/16 ========================#......$..#AC: 3okiw?fStr: 8#.........##EV: 14Int: 20#..........#SH: 0Dex: 16#..........#XL: 10 Next:  0% Place: Dungeon:10#.....@....#Noise: ---------  Time: 8248.4 (0.0)+..........#c) +0 dagger (protect)#.........##Cast: Poisonous Vapours#.........##.........############A malevolent force fills the Dungeon...oki?You fall into a shaft and drop 3 floors! _The shaft crumbles and collapses. _Found 18 gold pieces.  As you read the scroll labelled JODEIS FAARIKH, it crumbles to dust.  It is a scroll of amnesia.oki@okiDE=ludeguy the ToxicologistOctopode of Gozag Gold: 898######Health: 71/71 ========================######....#Magic: 16/16 ========================#......$..#AC: 3Str: 8#.........##EV: 14Int: 20#..........#SH: 0Dex: 16#..........#XL: 10 Next:  0% Place: Dungeon:10#.....@....#Noise: ---------  Time: 8248.4 (0.0)+..........#c) +0 dagger (protect)#.........##Cast: Poisonous Vapours#.........#okiE#.........############A malevolent force fills the Dungeon...You fall into a shaft and drop 3 floors! _The shaft crumbles and collapses. _Found 18 gold pieces.  As you read the scroll labelled JODEIS FAARIKH, it crumbles to dust.  It is a scroll of amnesia.okiKokidLReally abort (and waste the scroll)? Y - Yes  okiMN - Nopki5 pkiś pkiܜ Really abort (and waste the scroll)? Y - Yes  pki% QN - No [Y]es or [N]o only, please.pki pki ludeguy the ToxicologistOctopode of Gozag Gold: 898######Health: 71/71 ========================######....#Magic: 16/16 ========================#......$..#AC: 3Str: 8#.........##EV: 14Int: 20#..........#SH: 0Dex: 16#..........#pki XL: 10 Next:  0% Place: Dungeon:10#.....@....#Noise: ---------  Time: 8248.4 (0.0)+..........#c) +0 dagger (protect)#.........##Cast: Poisonous Vapours#.........##.........#pkiO ~###########You fall into a shaft and drop 3 floors! _The shaft crumbles and collapses. pkiz _Found 18 gold pieces.  As you read the scroll labelled JODEIS FAARIKH, it crumbles to dust.  It is a scroll of amnesia.  pki +Okay, then.pki 29.4 (1 _pkiC pki qkiǪqki!qki, ###### ######....# #......$..# #.qki­6## #.# #.# #.# +. qki#.# #.........############qki =50qkiܿqkiqkiM ##########..$..# ##qkilI+..........#qkiqkiI&1qkiqkiqkiR;[M #####qki;#####..$..# ###..........############qkiw@qki@&2qkiZCqkiEqkiL M ##########.. ###..........##.........#qkiR qkiR &3qkiV qki] qkiH^ 59164.4 (2qki` qkic _The shaft crumbles and collapses. _Found 18 gold pieces.  As you read the scroll laqkid belled JODEIS FAARIKH, it crumbles to dust.  It is a scroll of amnesia. _You now have 916 gold pieces (gained 18).qkii H############....# #.........# #.## #..# #.#  #.# +.# ### #.  #.# ###########qkis qki( +5.4 (1qki! qki] rki############....# #.........# #.## #..# #.#rkis #.# +.# ### #.  #.# #########rki>(## rkirkiP&6rkiErkirki############....# #.........# #.## #..# #.# #.#rki(G +.# ### #.  #.# ########### rkirkis&7rkiͲrki,rkiph############....# #.........# #.## #..# #.# #.# +.# #rki# #.  #.# ########### rkirkiH&8rkiTrkirkiJ ############....# #.........# #.## #..# #.#rkiJ  #.# +.# ## #. #.# ########### rkiS rkiT &9rkirY rki[ rki& ############....# #.........# #.## #..# #.# #rki X.# +.# ## #. #.# ########### rki rkis '60rkirkirkirkirki͑rkiskiski(Read which item? Scrolls  a - 3 scrolls of enchant armourskinW - a scroll of brand weapon  V - 2 scrolls of vulnerability  e - a scroll labelled XOHY EMISHRO  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedtki######ludeguy the Toxicologist######....#Octopode of Gozag Gold: 916#.........#Health: 71/71 ========================#.........##Magic: 16/16 ========================#..........#AC: 3Str: 8#..........#EV: 14Int: 20#..........#SH: 0Dex: 16+..........#XL: 10 Next:  0% Place: Dungeon:10#@........##Noise: ---------  Time: 8260.4 (0.0)#.........#c) +0 dagger (protect)#.........#Cast: Poisonous Vapours########### _The shaft crumbles and collapses. _Found 18 gold pieces.  As you read the scroll labelled JODEIS FAARIKH, it crumbles to dust.  It is a scroll of amnesia. _Okay, then. _You now tki{7have 916 gold pieces (gained 18).  As you read the scroll labelled XOHY EMISHRO, it crumbles to dust.  You assume a fearsome visage. Nothing appears to happen.1.4 (1 _It was a scroll of fear.tki MM ########## ##+.##.........#tki' tki( &2tki!. tki0 uki^Read which item? Scrolls  a - 3 scrolls of enchant armourW - a scroll of brand weapon  V - 2 scrolls of vulnerability  h - a scroll labelled GETAEGREE VIBE  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selecteduki( uki ludeguy the Toxicologist######Octopode of Gozag Gold: 916######....#Health: 71/71 ========================#.........#Magic: 16/16 ========================#.........##AC: 3Str: 8#..........#EV: 14Int: 20uki3 #..........#SH: 0Dex: 16#..........#XL: 10 Next:  0% Place: Dungeon:10+@.........#Noise: ---------  Time: 8262.4 (0.0)#.........##c) +0 dagger (protect)#.........#Cast: Poisonous Vapours#.........############It is a scroll of amnesia. _Okay, then. _You now have 916 gold pieces (gained 18).  uki As you read the scroll labelled XOHY EMISHRO, it crumbles to dust.  You assume a fearsome visage. Nothing appears to happen. _It was a scroll of fear.uki L  This is a scroll of acquirement!uki#! /  --more--vkiBvki'FUChoose an item to acquire.  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5}  b - the spore talisman of the Shoals {rPois Will+}  c - the +0 hat of Demaxke {Ice}vkiFd - 438 gold pieces (you have 916 gold) [!] acquire|examine items [a-d] select item for acquirement[Esc] exitxkiSyacquire|examineexamine itemyki)W 'The spore talisman of the Shoals {rPois Will+}. A small charm made from a still-living mushroom. Transforms one of the wearer's arms and parts of their lower body into a vibrant mass of multicoloured fungus. Melee attacks in this form may release spores that weaken their target, as well as cause mushrooms to sprout on the ground behind them which will release their own bursts of dazing spores if allowed to grow. Shapeshifting skill increases the durability of these mushrooms as well as their damage. ____________________________________________________________Skill HP UC Base Dmg Burstshroom damage -------------------------------------------------------- Min 8+0%+42d7 Max 14 +0%+42d12 Cur 0.0 -80% +42d1 Melds: Offhand, Boots ykiW ____________________________________________________________ rPois: It protects you from poison. Will+: It increases your willpower. Your skill: 0.0  At 100% training you would reach 8.0 in about 1.2 XLs.ki CChoose an item to acquire.  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5}  b - the spore talisman of the Shoals {rPois Will+}  c - the +0 hat of Demaxke {Ice}  d - 438 gold pieces (you have 916 gold) kiun[!] acquire|examine items [a-d] examine item [Esc] exitkiqy The ring "Tatui" {Fly rN+ Str+5 Dex+5}. It is an ancient artefact. kiFly: It grants you flight. rN+:It protects you from negative energy. Str+5: It affects your strength (+5). Dex+5: It affects your dexterity (+5). If you were wearing this ring: Your EV would increase by 0.9 (14.4 -> 15.3). You acquired it on level 10 of the Dungeon. Stash search prefixes: {artefact} {artifact} {Fly} {jewellery} ki1Menu/colouring prefixes: identified artefact jewellery _________________ “What surprised him the most, however, was the logic of his wings. They seemed  so natural on that completely human organism that he couldn't understand why ki\ other men didn't have them too.”  -Gabriel Garcia Marquez, _A Very Old Man with Enormous Wings_. 1955. trans. Gregory Rabassa. 1972kiki6 Choose an item to acquire.  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5}  b - the spore talisman of the Shoals {rPois Will+}  c - the +0 hat of Demaxke {Ice}  d - 438 gold pieces (you have 916 gold) ki& [!] acquire|examine items [a-d] examine item[Esc] exitkiۡ  The ring "Tatui" {Fly rN+ Str+5 Dex+5}. It is an ancient artefact. Fly: It grants you flight. rN+:It protects you from negative energy. Str+5: It affects your strength (+5). Dex+5: It affects your dexterity (+5). If you were wearing this ring: Your EV would increase by 0.9 (14.4 -> 15.3). You acquired it on level 10 of the Dungeon. Stash search prefixes: {artefact} {artifact} {Fly} {jewellery} Menu/colouring prefixes: identified artefact jewellery _________________ “What surprised him the most, however, was the logic of his wings. They seemed  so natural on that completely human organism that he couldn't understand why  other men didn't have them too.”  -Gabriel Garcia Marquez, _A Very Old Man with Enormous Wings_. 1955. trans. Gregory Rabassa. 1972kiChoose an item to acquire.  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5} kiB b - the spore talisman of the Shoals {rPois Will+}  c - the +0 hat of Demaxke {Ice}  d - 438 gold pieces (you have 916 gold) ki5ki\ ki[!] acquire|examine items [a-d] examine itemki<[Esc] exitki\ The ring "Tatui" {Fly rN+ Str+5 Dex+5}. It is an ancient artefact. Fly: It grants you flight. ki%]rN+:It protects you from negative energy. Str+5: It affects your strength (+5). Dex+5: It affects your dexterity (+5). If you were wearing this ring: Your EV would increase by 0.9 (14.4 -> 15.3). You acquired it on level 10 of the Dungeon. kiC]Stash search prefixes: {artefact} {artifact} {Fly} {jewellery} Menu/colouring prefixes: identified artefact jewellery kij]_________________ ki]“What surprised him the most, however, was the logic of his wings. They seemed  so natural on that completely human organism that he couldn't understand why ki]x other men didn't have them too.”  -Gabriel Garcia Marquez, _A Very Old Man with Enormous Wings_. 1955.ki]7 trans. Gregory Rabassa. 1972ki2jChoose an item to acquire.  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5}  b - the spore talisman of the Shoals {rPois Will+}  c - the +0 hat of Demaxke {Ice}  d - 438 gold pieces (you have 916 gold) [!] acquire|examine items [a-d] examine item[Esc] exitkiOThe spore talisman of the Shoals {rPois Will+}. A small charm made from a still-living mushroom. Transforms one of the wearer's arms and parts of their lower body into a vibrant mass of multicoloured fungus. Melee attacks in this form may release spores that weaken their target, as well as cause mushrooms to sprout on the ground behind them which will release their own bursts of dazing spores if allowed to grow. Shapeshifting skill increases the durability of these mushrooms as well as their damage. ____________________________________________________________Skill HP UC Base Dmg Burstshroom damage -------------------------------------------------------- Min 8+0%+42d7 Max 14 +0%+42d12 Cur 0.0 -80% +42d1 Melds: Offhand, Boots ____________________________________________________________ rPois: It protects you from poison. Will+: It increases your willpower. Your skill: 0.0  At 100% training you would reach 8.0 in about 1.2 XLs.kiChoose an item to acquire.  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5}  b - the spore talisman of the Shoals {rPois Will+}  c - the +0 hat of Demaxke {Ice} ki d - 438 gold pieces (you have 916 gold) kiLN[!] acquire|examine items [a-d] examine item [Esc] exitki  a - the ring "Tatui" {Fly rN+ Str+5 Dex+5}  b - the spore talisman of the Shoals {rPois Will+}acquire|examineselect item for acquirementki{+ Acquire the ring "Tatui" {Fly rN+ Str+5 Dex+5}? (y/N)ki ki& ludeguy the Toxicologist######Octopode of Gozag Gold: 916######....#Health: 71/71 ========================#.........#Magic: 16/16 ========================#.........##AC: 3Str: 8#..........#EV: 14Int: 20#..........#SH: 0Dex: 16#..........#XL: 10 Next:  0% Place: Dungeon:10+@.........#Noise: ---------  Time: 8262.4 (0.0)#.........##c) +0 dagger (protect)#.........#Cast: Poisonous Vapours#.........############ _Okay, then. _You now have 916 gold pieces (gained 18).  As you read the scroll labelled XOHY EMISHRO, it crumbles to dust.  You assume a fearsome visage. Nothing appears to happen. _Iki}' t was a scroll of fear.  This is a scroll of acquirement!3.4 (1 _You now have 916 gold pieces (gained 18).  As you read the scroll labelled XOHY EMISHRO, it crumbles to dust.  You assume a fearsome visage. Nothing appears to happen. _It was a scroll of fear.  This is a scroll of acquirement! ki( (_Something appears before you!ki1ki2&4ki$HkiKr _n - the ring "Tatui" {Fly rN+ Str+5 Dex+5}ki |ki~Put on or remove which piece of jewellery? Jewellery (go to first with "=) ki d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  i - a +4 ring of slaying (worn)  j - an amulet of chemistry (worn)g - an amulet of guardian spirit  h - an amulet of reflection  n - the ring "Tatui" {Fly rN+ Str+5 Dex+5} Talismans (go to first with %)kia - a riddle talisman[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip kiD kio ki ludeguy the Toxicologist######Octopode of Gozag Gold: 916######....#Health: 71/71 ========================#.........#Magic: 16/16 ========================#.........##AC: 3Str: 8#..........#EV: 14Int: 20#..........#SH: 0Dex: 16#..........#XL: 10 Next:  0% Place: Dungeon:10+@.........#Noise: ---------  Time: 8264.4 (0.0)#.........##c) +0 dagger (protect)#.........#Cast: Poisonous Vapours#.........############ki dAs you read the scroll labelled XOHY EMISHRO, it crumbles to dust.  You assume a fearsome visage. Nothing appears to happen. _It was a scroll of fear.  This is a scroll of acquirement! _Something appears before you! _n - the ring "Tatui" {Fly rN+ Str+5 Dex+5}ki  You feel stronger. You feel agile.You fly up into the air.kie 135219 (0.5Fly ki3 kih G _n - the ring "Tatui" (worn) {Fly rN+ Str+5 Dex+5}kip###### ######....# #.# #.## #.# #.# #.# +.# #.## #.# #.# ##kiKxkix,5.9 (1.0ki}kiLkia ###### ######....# #.# #.## #.# #.# #.# +.# #.## #.# #.# ##kijkiok%6ki pkirkir ki;  Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft4% 1b - HailstormConjuration/Ice6% 3  c - Launch Clockwork BeeForgecraft16% 3  d - Sigil of BindingHexes16% 3  e - Curse of AgonyNecromancy77% 5  f - Diamond Sawbladeski Forgecraft100% 7 3 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitki4kiludeguy the Toxicologist######Octopode of Gozag Gold: 916######....#Health: 71/71 ========================#.........#Magic: 16/16 ========================#.........##AC: 3Str: 13#..........#EV: 15Int: 20#..........#SH: 0Dex: 21#..........#XL: 10 Next:  0% Place: Dungeon:10+@.........#Noise: ---------  Time: 8266.9 (0.0)#.........##c) +0 dagger (protect)#.........#Cast: Poisonous Vapours#.........#Fly ###########This is a scroll of acquirement! _Something appears before you! _n - the ring "Tatui" {Fly rN+ Str+5 Dex+5}You feel strkioTonger. You feel agile.You fly up into the air. _n - the ring "Tatui" (worn) {Fly rN+ Str+5 Dex+5}  Okay, then. _kiskiw  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 4.3   5.9  -1          kiw b - Polearms   0.0   1.0   0   k - Conjurations   4.0   5.0   0   c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1   d - Throwing   0.0   1.0   0   m + Fire Magic2.3   3.0   0      n + Air Magic3.3   4.0   0  kiCxc e + Short Blades   2.8   1.5   0 +4     f - Long Blades   1.5   1.0   0   o - Evocations   0.0   0.8  +1       p - Shapeshifting   0.0   1.2  -1  g + Dodging4.7   5.0   0       h - Shields   0.0   1.0   0  kix    i + Stealth6.6   3.5  +4          kix                    ki3y                Skills enhanced by cross-training are in green. Bonus from skill manuals is in  ki]yred.  [?] Help[=] set a skill target  kiTz}[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetski ki ki ludeguy the Toxicologist######Octopode of Gozag Gold: 916######....#Health: 71/71 ========================#.........#ki 8Magic: 16/16 ========================#.........##AC: 3Str: 13#..........#EV: 15Int: 20#..........#SH: 0Dex: 21#..........#XL: 10 Next:  0% Place: Dungeon:10+@.........#Noise: ---------  Time: 8266.9 (0.0)#.........##c) +0 dagger (protect)kix #.........#Cast: Poisonous Vapours#.........#Fly ########### _Something appears before you! _n - the ring "Tatui" {Fly rN+ Str+5 Dex+5}You feel stronger. You feel agile.You fly up into the air. _n - the ring "Tatui" (worn) {Fly rN+ Str+5 Dex+5} _Okay, then.ki 3ki ki ki!ki)0Read which item? Scrolls  a - 3 scrolls of enchant armourW - a scroll of brand weapon  V - 2 scrolls of vulnerability  l - a scroll labelled OGGU BAMAEC FAUN [!] read|quaff|evoke[?] describe selectedki=ki6BkiU1=ki?kiDkiDkiEkiJki2KL6==kiLkiQ4 _Magic restored.ki]R%2kiSkiXkihYkiZki_ki `ki2akiekifh3===kihkilkimmkinkiskiEtkiukizki?{U4=ki|ki8kiǁkikikikimkiukikikinki%5kidki,kikiҟ,kiokiFkiåK6=ki{ki+kikikikikiVki_ki#7ki2=kihkiؼ,kikikiEkiBkikiz%8kiki*kikikiRkikikiki@K9=kiki0kikikiki kikiv,kiki4kiV70=ki kikikikijkikikiv ki K1=ki ki 1 _HP restored.ki  You encounter a wight. It is wielding a +0 battleaxe.ki n....### ######......######....#.....#.#.(...#.##...#.#..#.#.#.#.@..#.#kih .##..#.#...#.#....####.....z   wight (dormant)#...z.#.....ki] 1342.6 (50.0)ki/ 23.6 (51 _kig' ki/ Q _There is an open door here.ki  ....### ######  .......######....#  .......#.........#  ...(...#.........##  .......#..........#  .......#..........#  ki_ d.......#..........#  .......@..........#  .......#.........##  .......#.........#  .......#.........#  .......###########  ....... ##...z. #.....ki?  ....### ######  .......######....#  .......#.........#  ...(...#.........##  .......#..........#  .......#..........#  .......#..........#  .......@..........#  .......#.........##  .......#.........#  .......#.........# kik  .......######## ....... ##...z. #..... ki# ki# ki) ki<, \ _A wight is nearby!kiLp ~ ....### ######  ....######....#  .#.........#  (...#..##  kiq .....#...#  .#.#  .#.#  .'.#  #.........##  .#.........  .#.........#  .###########  kirq E..  ###...z..   #......   #.......  kiq ki[| ki:} 74.6 (1.0) _kiق kiH kiJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kikiόki\kiS _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki1 ki  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  ki# b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemyki 1%4  e + Sticky FlameFire/Alchemy2% 4 ki Select a spell to describe [?] help [!]/[I] toggle spell headerski/ ki4 ki9  ....### ######ludeguy the Toxicologist  ........######....#Octopode of Gozag Gold: 933  ........#.........#Health: 71/71 ========================  ....(...#.........##Magic: 16/16 ========================  ........#..........#AC: 3Str: 13  ........#..........#EV: 15Int: 20  ........#..........#SH: 0Dex: 21  ........'..........#XL: 10 Next:  6% Place: Dungeon:10  .......@#.........##Noise: ---------  Time: 8344.6 (0.0)  ........#.........#ki: c) +0 dagger (protect)  ........#.........#Cast: Poisonous Vapours  ........###########Fly  .........  ###...z..z   wight (dormant)  #......  #.......  _You encounter a wight. It is wielding a +0 battleaxe. _There is an open door here. _A wight is nearby!Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki> kiy? ki B kiVC kiO  ........######..........(...#.........##...................'......#.........# #########. ###...zzzz 2 wights (dormant)#.......#  kiR ki *5.6 (1kiA ki t _You encounter a wight. It is wielding a +0 scimitar.ki(e ........######....#ludeguy the Toxicologist  ........#.........#Octopode of Gozag Gold: 933  ....(...#.........##Health: 71/71 ========================  ........#..........#Magic: 14/16 =====================---  ki0)........#..........#AC: 3Str: 13  ........#..........#EV: 15Int: 20  kiW)........'..........#SH: 0Dex: 21  kiy)E........#.........##ki)XL: 10 Next:  6% Place: Dungeon:10  .......@#.........#ki)Noise: ---------  Time: 8345.6 (0.0)  ki).......*#.........#c) +0 dagger (protect) ki)j .......*###########ki*Cast: Poisonous Vapours  ......*..ki8*Fly  ###...z..  kiX*#......zzz 2 wights (1 dormant, 1 weak) kiv*T #.......  ki*I#.......#  ki*Aiming: Mercury Arrow (safe; 1% risk of failure)  ki*+Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 battleaxe and wearing a +0 robe (dormant, chance toweaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks weaker.ki8z.ki)..ki 3==6.6 (1ki.kip  Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 battleaxe and wearing a +0 robe (dormant, chance toweaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks weaker. _is lightly damaged.ki- 3ki ki kiF ....### ##########.....#.........# (......#...........#......'..........#kiF...........###########......z##    wight (weak)z ki&G0#.......#kiJ6z.kiUkiU.--7ki)^ki_ki1 ....### ######  .######....#  ........#..#  ....(...#..##  .ki! #.#  .#.#  .#.# kiFe ...........#  kihL.#.........#kit .#.........# ki .ki^#.........#  .kiVz########### kiV.........  ki c###...... ki'X#......z ki@1#.ki-6z.kiki5@--8ki"kiiQ _There is an open door here.ki :...### ###### ........######....# ........#.# ....(...#.## ........#.# ........#.# ........## .'. .#.#.#.# .z#.........#.ki #.###########.........###......#......zki? 0zki; y.z   wight (weak)kiX ,9 _ki< ki( kiR%ludeguy the ToxicologistOctopode of Gozag Gold: 933....### ######Health: 71/71 ========================........######....#ki%wMagic: 12/16 ==================------........#.........#AC: 3Str: 13....(...#.........##ki%EV: 15Int: 20........#..........#SH: 0ki&Dex: 21........#..........#XL: 10 Next:  6% Place: Dungeon:10ki)&........#@.........#Noise: ---------  Time: 8349.6 (0.0)kiM&........*..........#c) +0 dagger (protect)kis&.......*#.........##Cast: Poisonous Vapourski&.......*#.........#Fly ........#.........#ki '........###########z   wight (weak).........###......#......zCasting: Mercury Arrow (safe; 1% risk of failure)  ki:'Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  ki`'Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 battleaxe and wearing a +0 robe (lightly damaged,  weak, chance to weaken: 100%)ki8z.ki/"'ki4==50.6 (1kiSkiSonfirm with . or Enter, or press ? or * to list all spells.kiAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  kiӽtAim: a wight, wielding a +0 battleaxe and wearing a +0 robe (lightly damaged,  kiweak, chance to weaken: 100%) _You feel a surge of power! The glob of mercury misses the wight.ki-~ ludeguy the ToxicologistOctopode of Gozag Gold: 933....### ######Health: 71/71 ========================........######....#Magic: 10/16 ===============---------........#.........#AC: 3Str: 13....(...#.........##EV: 15Int: 20........#..........#ki~ SH: 0Dex: 21........#..........#XL: 10 Next:  6% Place: Dungeon:10........#@.........#Noise: ==-------  Time: 8350.6 (0.0)........*..........#c) +0 dagger (protect).......z#.........##Cast: Poisonous Vapours........#.........#Fly ki~ V........#.........#........###########z   wight (weak).........ki ###......#......zAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 battleaxe and wearing a +0 robe (lightly damaged,  weak, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks even weaker.ki 9z.ki$ ki *1.6 (1ki ki Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 battleaxe and wearing a +0 robe (lightly damaged,  weak, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks even weaker. _The wight is moderately damaged.ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki8  ludeguy the Toxicologist  Octopode of Gozag Gold: 933 kiz....### ######  Health: 71/71 ======================== ........######....#  Magic: 6/16=========--------------- ki........#.........#  AC: 3Str: 13 ki=....(...#.........##  EV: 15Int: 20 ki]........#..........#  SH: 0Dex: 21 ki........#..........#  XL: 10 Next:  6% Place: Dungeon:10 ki ........#@.........#  Noise: ==-------  Time: 8351.6 (0.0) ki........z..........#  c) +0 dagger (protect) kik........#.........##  Cast: Poisonous Vapourski ` ........#.........#  Fly ki#8 ........#.........# kil ........###########  z   wight (weak) ......... ###...... #......zkiCasting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 battleaxe and wearing a +0 robe (moderatelydamaged, weak)ki=ludeguy the ToxicologistOctopode of Gozag Gold: 933....### ######Health: 71/71 ========================........######....#Magic: 6/16kir=========---------------........#.........#AC: 3Str: 13....(...#.........##EV: 15kiInt: 20........#..........#SH: 0ki՛|Dex: 21........#..........#kiXL: 10 Next:  6% Place: Dungeon:10........#@.........#kiNoise: ==-------  Time: 8351.6 (0.0)........z..........#ki=c) +0 dagger (protect)........#.........##Cast: Poisonous VapourskiG........#.........#Fly ........#.........#........###########kiz   wight (burning, weak).........kiȜJ###......#......zkiAiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineki Aim: a wight, wielding a +0 battleaxe and wearing a +0 robe (moderatelydamaged, weak)  ki.You feel a surge of power! The sticky flame hits the wight!  The wight is severely damaged.kiL$&$Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 battleaxe and wearing a +0 robe (moderatelydamaged, weak)  ki$You feel a surge of power! The sticky flame hits the wight!  The wight is severely damaged.  The wight is covered in liquid fire! The wight burns!ki+)ki.:933 7ki.@=8=ki. 2.6 (1kiG4ki9L _You destroy the wight!ki,p a....### ######.......######....# ........#.........# ....(...#.## ........#..# ........#.# ........#.# .........# .## .#. .#.# ..########### ... ###...... #......z #.......kiy ki-z /---3ki~ ki(  You now have 939 gold pieces (gained 6).  There is an open door here.  Things that are here:ki b9---4.6 (2ki> ki O _a +0 battleaxe; a +0 robekia@....### ###### ........######....# ........#.# ....(...#.## ........#.# ..#.# .#.# .)# .#.## ..#.ki# ........#.# ........####.........###......#......z kiSki*5.6 (1kiki{kiA kiB kiC kiI kiEM O=kiP ki2Q kiR ki{W kiW T8==kiY ki_ ki_ kira kif kif kih kizm kim kixo kis ki t :==kiu kiy kijz *939kis| ki ki ki ki% kif M9=kiF ki kid ki] ki kiO ki ki kię ki ki kic 9=ki ki ki ki kig ,kiB ki ki] R10/16==kiP kiݷ ki ki kiɾ ,ki kiE ,kie ki kiO :==ki kiP ki ki< ki< ki M1=kiz kiu ki ki kiJ ki ki kib ki kiu ki ki 9=ki kiv ki ki ki ki1 ki ki ki N2==kirki,kijkiu ki ki1 ki kikikiki:==ki{ki:kiukizkiC#ki#ki$ki)kiO*#3ki*(=ki,kiO8ki8ki9ki=ki=ki>ki_BkiBkiCki)FkiF9=kiGki~JkiJkiKkiMkiN64==ki$NkiNkiQkiJQki!RkiTkiTkiUkiWkiCXki'Yki[kie[:==ki\ki^ki+_ki `kibkibkivcki+ekiekieD5=kigkiikiikijki+mkimmkiCnkip,kiqkiukiCv#=kiavki#yki>|,ki}kiki+kikin _You start resting.Magic restored.kiki1411.6 (56.0)kia6==2.6 (57 _kiǞkiGki_kiS_ki1`kikbkidkimg,ki$i  kiPi7There is an open door here.  Things that are here:kisl^  a +0 battleaxe; a +0 robekikpkiq _kirkitkiwg  A wight comes into view.ki}, ........######....#   ........#.........#   ....(...#.........##  ki}* ........#..........#   ........#..........#   ........#..........#  ki%~q ........)..........#   kiL~S..#.........##   kis~S.@#.........#   ki~v..#.........#   ........###########  ki~> .........  ki~ ###......   #......zkiz   wight (dormant)   #....... ki4d  #.......# kiS, ki[14.6 (2.0)ki"15.6 (3 _kikikicJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiOt .....(.......##ki....#..............).#.#.kiM #########. ki8###. ki%z##ki1zz 2 wights (dormant)#.....z.#  kiPkikiG==6.6 (1kikiv _You encounter a wight. It is wielding a +0 dire flail.ki * ........#.........#ludeguy the Toxicologist  ....(...#.........##Octopode of Gozag Gold: 939  ........#..........#Health: 71/71 ======================== ki  ........#..........#Magic: 14/16 =====================---  ........#..........#AC: 3Str: 13  ........)..........#EV: 15Int: 20  ........#.........##SH: 0Dex: 21  ki ........#.........#XL: 10 Next:  8% Place: Dungeon:10  ki, .......@#.........#Noise: ---------  Time: 8416.6 (0.0) kiG b .......*###########kib c) +0 dagger (protect)  ........*ki~ ?Cast: Poisonous Vapours  ki x###.....*.Fly ki ^ #......z# ki N #.......#ki czz 2 wights (1 dormant, 1 weak)  ki L#.......#  ki i#.....z.#  ki2 Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linekiL kAim: a wight, wielding a +0 scimitar and wearing a +0 robe (dormant, chance to  kie Yweaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  ki The wight looks weaker.ki*Z 7z.ki^c +...kic 3==7.6 (1kik ki@n o  Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 scimitar and wearing a +0 robe (dormant, chance to  weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks weaker. _is lightly damaged.ki .#####........# (...#.........#....#.).#.........###########......... ki. ##z.#   wight (weak)#.#.....z.#kiz18z.ki8ki9.--8kiu?kikiM ....### ##########.....#.........# (......#...........#......)..........#.........###########........zkiJq##. .#.ki4z.kiki@--9kizkinkiU ....### ######  .######....#  ........#..ki#  ....(...#..##  .#.ki=#  .ki L#.#  ki, 9.#.kiF ?#  .ki` ^..........#  .kiz W#.........# ki .ki ^#.........#  .ki N#.........#  ki K.z###########ki  ki W.........  ki2 d###....... kiK Y#.......# kid  ki 6z.kipki&20kiSki2  There is an open door here.  kiThings that are here:ki o _a +0 battleaxe; a +0 robekio ...### ###### ........######....# ........#.# ....(...#.ki_p ## ........#.# ........#.# ........## .). .#.kip B#.#.kip n# .z#.........kip 1#.kip @.###########kiq S.........ki q >###.......ki9q * kit 0zki~ y.z   wight (weak)kiv ,1 _ki{ ki ki7z.kikiS5=2ki|kiqki07z.ki~ki%3kiski7 ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kig ki8  ludeguy the Toxicologist kih Octopode of Gozag Gold: 939 ....### ######  Health: 71/71 ======================== ........######....#  Magic: 11/16 ================--------ki0 ........#.........#  AC: 3Str: 13 ....(...#.........##  EV: 15Int: 20ki ........#..........#  SH: 0Dex: 21 ki........#..........#  XL: 10 Next:  8% Place: Dungeon:10 ........#@.........#  Noise: ---------  Time: 8423.6 (0.0) ........z..........#  c) +0 dagger (protect) kiS........#.........##  Cast: Poisonous Vapours ........#.........#  Fly  ........#.........#  ........###########  z   wight (weak) ......... ###....... #.......#Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki|Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 scimitar and wearing a +0 robe (lightly damaged,  weak)kipludeguy the ToxicologistOctopode of Gozag Gold: 939....### ######Health: 71/71 ========================........######....#Magic: 11/16 ================--------........#.........#AC: 3Str: 13....(...#.........##EV: 15kiInt: 20........#..........#SH: 0Dex: 21........#..........#XL: 10 Next:  8% Place: Dungeon:10........#@.........#Noise: ---------  Time: 8423.6 (0.0)........z..........#c) +0 dagger (protect)........#.........##ki~Cast: Poisonous Vapours........#.........#Fly ........#.........#........###########kiKz   wight (burning, weak).........###.......#.......#kiAiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 scimitar and wearing a +0 robe (lightly damaged,  weak)  You feel a surge of power! The sticky flame hits the wight.  The wight is moderately damaged.ki Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 scimitar and wearing a +0 robe (lightly damaged,  weak)  You feel a surge of power! The sticky flame hits the wight.  The wight is moderately damaged.  The wight is covered in liquid fire! The wight burns!kiTP: 64/69 (71)--kiWP: 11/16 ===4.6 (1Drainki# ki# _The wight hits you with a +0 scimitar! You partially resist. You feel drained.ki $You hit the wight.  Your weapon exudes an aura of protection.kio 939 10 9--5.5 (0.9 _You destroy the wight!kii$ki$kiY&ki?*ki.b5--ki1ki22kix=kiKAkiA0 3 kiBkiFkiJGT62==kiHkiMkiMkiNkixRkiRkiTkiXkiXK7=ki%Zki5_P==kilkiokip|8=3=kiqkitkitki)vkiz,ki{ki@k _You start resting.HP restored.kiH---kiu038.5 (13.0)kir9=-9.5 (14 _kikiki4ki*5ki6ki:ki>O=ki&AkieA*939kiCkiFkiGL4==kiHkiRLkiL9=kiNkicQkiQkiSkiVkiVkiXkiG[ki[:==kiI]ki<`kiu`kiakid,kiekiikiZiK5=kijkim,kiokir,kitkiwkiwkixkid}O=ki~ki _You start resting.Magic restored.55.5 (166==6.5 (17 _kiYi....### ######.......######....# ........#.........# ....(...#.## ........#..# ........#.# ........#.# .........# .## .#. .#.# ..########### ... ###....... #.......#  #.#ki4`ki`07.0)kifkiDsp  You now have 944 gold pieces (gained 5).  There is an open door here.kis3448.5 (2kizkiݝH _Items here: )) [[.ki  ....### ######  ....######....#   .#.........#   ....(...#..##   ........#...#   .#.#   .#.#   .).#   #.........##   .#.........   .#.........#   .###########   ..   ###.......   #.......#  ki  #.......#   #.#ki* ]9.5 (1kigs ........######..........(...#.........##...................)......#.........# #########Fly Drain.#.......#  ki&#.....z.#kiwkiC==60kikiZ .....(.......##....#..............).## #########. ###.##z   wight (dormant)#.....z.#  kixekie%1ki_mki#oki,(#..)## #########..# ###.# #z######ki6ki7%2ki(=ki3?ki' ..)## #########..# ### kip( Kz######kij5 ki 6 %3ki3@ kiB ki5 J  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki| ki ki kip _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki!J  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kil  Casting: Sticky Flame (dangerous; 2% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Sticky Flame (dangerous; 2% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki _)## #########..# ### z######.kit ki ,4 _kiF ki kiv % ........#..........#ludeguy the Toxicologist  ........#..........#Octopode of Gozag Gold: 944  ........)..........#HP: 69/69 (71) ========================  ki ........#.........##MP: 14/16=====================---  ........#.........#AC: 3Str: 13  ........#.........#ki kEV: 15Int: 20  ki` ........###########SH: 0Dex: 21  ..........#XL: 10 Next:  9% Place: Dungeon:10  ###....@..#ki Noise: ---------  Time: 8464.5 (0.0)  #....*..#ki c) +0 dagger (protect)  #....*..#Cast: Poisonous Vapours ki d #.....*.#ki TFly Drain  ki/ #.....z.#  #.#######kiH iz   wight (weak)  ki` X#.  . kiy  ki Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineki jAim: a wight, wielding a +0 dire flail and wearing a +0 robe (dormant, chance  ki \to weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  ki The wight looks weaker.kiy 8z.ki +...ki4 3==5.5 (1ki ki0   Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 dire flail and wearing a +0 robe (dormant, chance  to weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks weaker. _The wight is moderately damaged.ki9g#).#.........###########...##.z......########..ki=4z.kidDkiD.--6kiJkiYMki (##).#.........###########...##.z......########.z.--kiP7ki֑kikiH. (##).#.........ki###########....####.......#z......#######ki- 5z.kiki\%8kikiOki>#####........# (...#.........#....#.).#.........###########..........###....z..###......9ki?ki@ ) ....### ##########.....#.........# (......#...........#......)..........#.........###########........ki ~###....z...#ki z.5=70kij" ki"% ki  ....### ######  .######....#  ........#..#  ....(...#..ki4 ##  .#.#  .#.# kiX > .#.kiy #  ...........# ki  .ki W#.........# ki ^.#.........#  ki Y.#.........# ki " .###ki5 4######## kiU .......z..#  ###......kiy Z.# #.......ki 2# kil 6z.ki[ ki %1kiq ki *  There is an open door here.ki h _Items here: )) [[.kiI!...### ###### ........######....# ........#.# ....(...#.## ........#.# ........#.# ........## .).kiJ .#.#.#.# .ki.Jf.#.........#.kiQJz###########..........#kitJi###.......# ki:UkiV,2 _ki^kis0zkihz   wight (weak)ki%3kiJkikiD ludeguy the ToxicologistOctopode of Gozag Gold: 944....### ######HP: 69/69 (71) ========================........######....#MP: 13/16===================-----........#.........#AC: 3Str: 13ki >....(...#.........##EV: 15Int: 20........#..........#SH: 0Dex: 21........#..........#XL: 10 Next:  9% Place: Dungeon:10ki ........#@.........#Noise: ---------  Time: 8473.5 (0.0)ki f........*..........#ki c) +0 dagger (protect).......*#.........##kiB Cast: Poisonous Vapours.......z#.........#ki Fly Drain........#.........#.......z###########z   wight (weak)..........####.......#ki #.......#Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineki Aim: a wight, wielding a +0 dire flail and wearing a +0 robe (lightly damaged,  weak, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks even weaker.kiF!8z.kiM64)ki63==4.5 (1kiK?kiAPress: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 dire flail and wearing a +0 robe (lightly damaged,  weak, chance to weaken: 100%)  You feel a surge of power! The glob of mercury hits the wight.  The wight looks even weaker. _The wight is moderately damaged.¹kiЉ7z.¹ki¹ki.--5¹kiҚ¹ki¹kix  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.¹kiT   ludeguy the Toxicologist  Octopode of Gozag Gold: 944 ....### ######  HP: 69/69 (71) ======================== ........######....#  MP: 9/16=============----------- ........#.........#  AC: 3Str: 13 ....(...#.........##  EV: 15Int: 20 ........#..........#  SH: 0Dex: 21 ........#..........#  XL: 10 Next:  9% Place: Dungeon:10 ........#@.........#  Noise: ---------  Time: 8475.5 (0.0) ........z..........#  c) +0 dagger (protect) ........#.........##  Cast: Poisonous Vapours ........#.........#  Fly Drain¹ki; [40m ........#.........#  .......z###########  z   wight (weak) ..........# ###.......# #.......#Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 dire flail and wearing a +0 robe (moderatelydamaged, weak)ùkiPludeguy the ToxicologistOctopode of Gozag Gold: 944....### ######HP: 69/69 (71) ========================........######....#MP: 9/16=============-----------........#.........#AC: 3Str: 13....(...#.........##EV: 15Int: 20........#..........#SH: 0Dex: 21........#..........#XL: 10 Next:  9% Place: Dungeon:10........#@.........#Noise: ---------  Time: 8475.5 (0.0)........z..........#c) +0 dagger (protect)........#.........##Cast: Poisonous Vapours........#.........#Fly Drain.....ùki...#.........#.......z###########z   wight (weak)..........####.......##.......#Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 dire flail and wearing a +0 robe (moderatelydamaged, weak)  You feel a surge of power! You miscast Sticky Flame.  You are blasted with searing fire!57-----Contam: 16% =6.5 (1  Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 dire flail and wearing a +0 robe (moderatelydamaged, weak)  You feel a surge of power! You miscast Sticky Flame.are blasted with searing fire! _The wight hits you with a +0 dire flail.ùki/B You are blasted with searing fire! _The wight hits you with a +0 dire flail.  You hit the wight.r weapon exudes an aura of protection.grab the wight.  The wight is heavily damaged.ùkiU010/16==10 7.4 (0.9ùkim6ùki8d _You constrict the wight. The wight misses you.ùkiJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Ĺkim2  ludeguy the Toxicologist  Octopode of Gozag Gold: 944 ....### ######  HP: 57/69 (71) ===================----- ........######....#  MP: 6/16=========--------------- ........#.........#  AC: 10  Str: 13 ....(...#.........##  EV: 15Int: 20 Contam: 16%  ........#..........#  SH: 0Dex: 21 ........#..........#  XL: 10 Next:  9% Place: Dungeon:10 ........#@.........#  Noise: =--------  Time: 8477.4 (0.0) ........z..........#  c) +0 dagger (protect) ........#.........##  Cast: Poisonous Vapours ........#Ĺki2y.........#  Fly Drain ........#.........#  .......z###########  z   wight (weak) ..........# ###.......# #.......#Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 dire flail and wearing a +0 robe (severely damaged,constricted by you, weak)Ĺki}  ludeguy the Toxicologist  Octopode of Gozag Gold: 944 ....### ######  HP: 57/69 (71) ===================----- ........######....#  MP: 6/16=========--------------- ........#.........#  AC: 10  Str: 13 ....(...#.........##  EV: 15Int: 20 Contam: 16%  ........#..........#  SH: 0Dex: 21 ........#..........#  XL: 10 Next:  9% Place: Dungeon:10 ........#@.........#  Noise: =--------  Time: 8477.4 (0.0) ........$..........#  c) +0 dagger (protect) ĹkiV........#.........##  Cast: Poisonous Vapours ........#.........#  Fly Drain ........#.........#  .......z###########  z   wight (weak) ..........# ###.......# #.......#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wight, wielding a +0 dire flail and wearing a +0 robe (severely damaged,constricted by you, weak)  You feel a surge of power! The sticky flame hits the wight!ĹkiR  ######  ######....#  #.........#  Ĺkinv....(...#.........##  #..........#  ........#  ........#  ........$..........#  ........#.........##  ĹkiÈ_........#.........#  ........#........ .......z#########Ĺki: ...... ###... ĹkiĹkih944 8/7011==8.4 (1ĹkiĹkim  Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a wight, wielding a +0 dire flail and wearing a +0 robe (severely damaged,constricted by you, weak)  You feel a surge of power! The sticky flame hits the wight! _You destroy the wight!Ĺki w....### ######.......######....# ........#.........# ....(...#.## ........#..# ........#.# ........#..# .........# .## .#. .#.# ..########### ....# ###.......# #.......#  #.#Ĺkiʢ Ĺki3 /---9Ĺki= Ĺki p  You now have 952 gold pieces (gained 8).  There is an open door here.Ĺki! 52 3 ---80.4 (2Ĺki Ĺki J _Items here: ))) [[[.Ĺki. ....### ######  ....######....#   .#.........#   ....(...#..##   ........#...#   .#.#   .#..#   .).#   #.........##   Ĺkia.#.........   .#.........#   .###########   ...#   ###.......#   #.......#   #.......#   #.#ĹkiĹki_X9=1.4 (1ĹkiĹkiIŹkism3ŹkimŹkiqŹkiu,ŹkiwŹkiAx74ŹkiyŹki}Źki}60=7=2Źki~Źkiʁh9520Źki2ŹkiO8% ŹkiɅŹkiŹkiM16ŹkiŹki=4ŹkioŹki72ŹkiQŹkisŹki2=8==1ŹkiŹki3Źki'Źki՛Źkiw _Your magical contamination has completely faded away.ŹkiUŹkiŹkiŹki;Źki`Źki§h3===Źki Źki¬,ŹkiŹki߰,ŹkiŹkiCŹkiT49=ŹkiKŹki,ŹkiŹki,ŹkiŹkidŹkiK5=Źki-ŹkiŹki9=Źki'ŹkiŹkiiŹkiŹkiŹkiU6=ŹkiŹkiOŹkiR10/16==ŹkiŹki,ŹkiŹki@ŹkiŹkiŹkigŹki%7ŹkijŹkiwP==ŹkiNŹki,Źki|Źki8=1=Źki`ŹkiŹki{ŹkiLŹkiŹkiXŹki7ŹkiU9=ŹkiŹkiO=ŹkiMŹki ,Źki Źki70= _HP restored.2==Źkir,Źki$XŹki$Źki&Źki'9=Źki'Źki+Źkij,:==Źki-Źki1,Źki2Źkie4,ŹkiW5Źki7Źki8K3=Źki9Źki>BŹkiAŹki"BŹkiCŹkixE,ŹkiKPŹkiSO=ŹkiTŹkiW,ŹkiXŹki]Źkid^L4==Źki_Źkib,ŹkicŹkieŹki0fŹkifŹkij,ŹkilŹkioP==ŹkiqŹkiuŹkieuŹkivŹkiYy,ŹkizŹki|Źki_|K5=Źkit}Źki(,ŹkiŹki,ŹkiŹkiŹkiŹkiŹkiŹki9=ŹkiŹkiŹkiŹki ŹkiɖŹkiŹkiŹkiŹki*L6==ŹkibŹkiŹki,ŹkiΣŹkiץŹkiϧŹkiŹkizŹki۫Źki,ŹkiŹkiŹkiŹkiN:==ŹkiŹkiؾŹkiZŹkiŹkiŹkiŹkizŹkiŹki2ŹkiŹkiŹki)ŹkiŹki}ŹkiŹki#ŹkiŹki\ŹkibŹkiŹkiŹkiŹki,ŹkiVŹkiŹkiŹkiXŹkiŹkiŹki,ŹkiŹkicŹki Źki ŹkiZŹkiŹki>ŹkiŹki ŹkiYŹki,Źki Źki=!<65Źki>"Źki$N _You now have 965 gold pieces (gained 13).Źki~'3Źki(ŹkiD   #..#.....#   #..#.....#   #........#### #  #...........######  #...........#.....  #.......(...#.....  #...........#.....  #....#.....  #@..........#.....  #...........).....  #...........#.....  #...........#.....  #...........#.....  #...........######  #...........#  #..####.......# [39ŹkiE|;49m #..# #.......#You pick up a parchment of Lee's Rapid Deconstruction and begin reading...561.4 (80.0)2.4 (81 _You add the spell Lee's Rapid Deconstruction to your library.Źki0ŹkiŹkiŹkiŹkiŹki+,ŹkiŹkiŹki`ŹkiWŹkifŹkiŹki6ŹkifŹki ŹkinŹkiŹkiŹkiŹkiŹki0ŹkiŹkiŹkiŹki1ŹkiŹkiŹkiy Źki Źki= ŹkiH Źki^ Źki ŹkiŹki/ŹkiŹkiŹkijŹkiŹki ŹkiLŹki;ŹkiŹkiŹkigŹkiŹki*ŹkiW!Źki!Źki(nŹki(ŹkiM+,Źki,Źki.Źki11Źkiq1Źki52Źki%4ŹkiM6Źki6ŹkiY7Źki8Źki;Źki:;Źki;Źki{=Źki@,ŹkiN@ŹkiAŹkiDŹkiDŹkiEŹki)GŹkiZIŹkiIŹkijJŹkiLŹkiNŹki.OŹkiOŹkiQŹki~TŹkiTŹkiUŹki_WŹki] #.......#  #.......+  #.......# #.......#Źki^P #.......# #...###.# #.......#Źki/^ #.......#######  #......@. 84.4 (22ŹkiR^u #........  #......Źkip^S  #...... Źki^p #...... #......Źki^G #......Źki^o #......<.......Źki^ Źki8eŹkiMg+5.4 (23ŹkiEjŹkim9 _Found a stone staircase leading up.ǹkiOǹkiTPǹkiQǹkiXǹkifYǹki\,ǹki]ǹkiaǹki bǹkibǹkidǹkigǹkihǹki9iǹkijǹkimǹkitnǹkigoǹkipǹkisǹkitǹkitǹkirvǹkiT|Xǹki~ǹkijǹkiǹki,ǹkiǹkiǹkiǹkiǹki6ǹkiǹkiuǹki ǹki]ǹkiǹkiǹkiPǹki}ǹkiΤǹki ǹkiǹkiS .....# .....+ .....# .....# .....# .###.# ǹki.....# .....################ ................@...+ 96.4 (11 ............#####..!# ............# ............# ....### ............# ..>.# ............#  ǹki............# ....<.......# ǹkiǹki+7.4 (12ǹkiNǹki+; _Found a stone staircase leading down.ǹkiǹkivǹkiǹkiǹki1 ǹki- Bǹki ǹki ǹki ǹki ǹki ǹkil ǹkiY ǹki ǹki  ǹki ǹki i _M - 4 potions of mutation (gained 1)ǹki, ǹki ǹki? ǹki ǹkiZ# ǹki# ǹkib$ ǹkiB' ǹki* ǹkiE+ ǹki0, ǹki_.  ǹki. @_You reach down and open the door.ǹki1 ǹki1 ǹki2 ǹki6 @  There is an open door here.ǹki: ǹki:  _ǹki; ǹkig= ǹki!@ ǹki@ ǹkioA ǹkiB ǹkipE ǹkiE ǹkiF ǹkiI ǹkiL ǹkiL ǹkiM ǹkiO ǹkiR ǹki S ǹkiS ǹkiU ǹkiX ǹkiY ǹkilZ ǹkii\ ǹki_ ǹkiH` ǹki9a ǹki!d ǹkif ǹki5g ǹkih ǹkij ǹkil ǹkiam ǹki8n ǹkip ǹkiws ǹkis ǹkit ǹkiv ǹki,y ǹkiy ǹkiz ǹki{ ǹki~ ǹki7 ǹki ǹki= ǹki ǹki ǹkiׅ ǹki ǹki3 ǹkiu ǹki/ ǹki` F _You reach down and open the door.ǹki ǹki ǹki ǹki ǹki ǹkiu ǹki) ǹki ǹki ,ǹkiH ǹki ǹkiХ ǹkix ǹki8 ,ǹki ǹki ǹki׻ ǹkic ǹki ǹki ǹki ǹki ǹki ǹki1 ǹki Bǹki* ǹki ǹki, ǹki ǹki ǹki ǹki^ ǹki ǹki3 ǹki ǹkiz ǹki. ǹki ǹki4 ǹki ǹkis ǹki ǹki ǹki ǹki ǹki Bǹki ǹki ǹkiH ǹki ǹki ǹki ǹki ǹki ǹki0 ǹki ǹki ǹkiq ǹki ǹkiM ǹkiZ ǹki ǹki ǹki ǹkic  ǹki H You reach down and open the door.  ǹki >You encounter a yak.ǹki )#.........#ǹkiI #.........# #.Y.############ #...## ǹki #...#### #........# #....# ǹki t...# ##'####ǹki # ##.@##'## ##### #.......##ǹki  #........# ǹki0  #........###########ǹkiP  #...................ǹkip  ǹki )#.......##....###### Y   yak (asleep) ǹki ########.......##....# ǹki .........##....#...............##....#ǹkim$ .640.4 (43ǹki% *1.4 (44 ǹki% _ǹkiZ* ǹkiA, ǹki2 H #.Y.#ǹki"3  #...# #...###  #.....  #.... ... ##'####  ##.@##'##  #.......##  ǹkiH3 N#........#  #........# #.............ǹkik3  #.......##.... ǹki3 %#.......##....#  ǹki3 $........#  ǹki3 3. ǹki  #.Y.# #...# #...###  #.....  #.... ... ##'####  ##.@##'##  #.......##  #........#  #........# #............. #.......##.... #.......##.... ........# .ǹki$ ǹkig ǹki Z _A yak is nearby!ȹkiȹki  Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft4% 1b - HailstormConjuration/Ice6% 3  c - Launch Clockwork BeeForgecraftȹki|16% 3  d - Sigil of BindingHexes16% 3  e - Curse of AgonyNecromancy77% 5  f - Lee's Rapid Deconstruction Earth77% 5  g - Diamond SawbladesForgecraftȹki100% 7 3 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitɹki m ɹki[r ..#.........#ludeguy the Toxicologist ..#.........# #.Y.#Octopode of Gozag Gold: 965 ..########### #...#ɹki4s HP: 70/70 (71) ======================== ....##...###MP: 16/16======================== ....##.....AC: 3Str: 13 ....##....EV: 15Int: 20 ....#...SH: 0Dex: 21 ....#ɹki2t ##'####XL: 10 Next: 11% Place: Dungeon:10 ....###.@##'##Noise: ---------  Time: 8641.4 (0.0) ######.......##c) +0 dagger (protect)#........#Cast: Poisonous Vapours#........########### Fly Drain#...................#.......##....###### Y   yak (asleep)########.......##....#ɹkiht ...............##....#...............##....# _You reach down and open the door. ɹkit r_There is an open door here. _You reach down and open the door.  You reach down and open the door. ɹkit f_You encounter a yak. _A yak is nearby!ɹkit ɹki%y P  Okay, then.ɹkiy ɹkix} ɹki7 . _ʹki!#..........# #.Y########### ######.....#.................. ##@#### ....##..##'## #####....##......# .......###########.................. #..##############..ʹkiʹki12.4 (1 _ʹki[ʹkiQ _There is an open door here.ʹki ).#..........# #.Y########### #######.@....... ##'######. ....##..##'## ######.......#....#...###########.............. .###############ʹkiNʹki,3 _ʹkiʹkiʹki) J  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ʹki ʹkib ʹki ʹki _You can't see any susceptible monsters within range! (Use Z to cast anyway.)˹ki#).##....#..........# #.Y########### ######........ ##'######. ....#..##'## ######.##........# #........###########.............. ######4 _˹ki˹kiM˹ki..#..........#ludeguy the Toxicologist ..)..........##....Octopode of Gozag Gold: 965 ..#.........###...#HP: 70/70 (71) ======================== ..#.........# #...#MP: 14/16=====================--- ˹ki/r..#.........# #.Y.#AC: 3Str: 13 ..########### #.*.#EV: 15Int: 20 ....##.*.######SH: 0Dex: 21 ....#˹ki#.*.......XL: 10 Next: 11% Place: Dungeon:10 ....##.@.......Noise: ---------  Time: 8644.4 (0.0) ....##.........˹kic) +0 dagger (protect) ....###'######.Cast: Poisonous Vapours ....###..##'##Fly Drain ######.......###........#Y   yak#........###########˹ki!a#...................#.......##....######˹ki>+Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.˹ki_Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line˹kiAim: a yak (asleep, chance to weaken: 64%)  You feel a surge of power! The glob of mercury hits the yak!!˹ki#QG.Y˹kiW&..˹ki>Y&==˹ki|Y)5.4 (1Poisonous Vapours˹ki_˹kibvonfirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a yak (asleep, chance to weaken: 64%)  ˹ki^bYou feel a surge of power! The glob of mercury hits the yak!! _The yak is severely wounded.˹kie )#....####...# ########## #.Y..# #...######......#'########..##'## ####.......## #..#........############.....................##....##############˹ki D.Y˹kir ˹ki .--6˹ki ˹kiR ˹kiJ####...# #########..# #.Y.######........##@######.˹kii##..##'## #####.......## #............###########................##....######˹ki3#######.#˹kiZ#........˹kiCD.Y˹ki˹ki]@--7˹ki˹kiQ _There is an open door here.̹ki-S  #########..# #####Y...............#.........#'######.##.@##'## #####.......## #........#...###########.............##....##############........8Poisonous Vapours _̹kiY̹kiZ̹ki8 u#.........########### ..######Y.......#.................. ##@######. ....##..##'## #####...##...# ..###########............ ##############̹ki; D.Y̹ki%C 8 ̹kiC A9Poisonous Vapours̹kiM g _There is an open door here.̹kipd..#.........###...# ludeguy the Toxicologist ..#.........# #...# Octopode of Gozag Gold: 965 ..#.........# #...# HP: 70/70 (71) ======================== ..########### #...# MP: 13/16===================----- ....# #...######  AC: 3̹ki3eStr: 13 ....# #.........  EV: 15Int: 20 ....# #.........  SH: 0Dex: 21 ....# #.Y.......  XL: 10 Next: 11% Place: Dungeon:10 ....# ##@######.  Noise: ---------  Time: 8649.4 (0.0) ....# ##..##'##  c) +0 dagger (protect) ##### #.......##  Cast: Poisonous Vapours ̹ki]eU#........#  Fly Drain #........########### #................... Y   yak̹kie^ #.......##....###### ########.......##....#  ̹kie...............##....# Casting: Mercury Arrow (safe; 1% risk of failure)  ̹kieMConfirm with . or Enter, or press ? or * to list all spells.̹kif]Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a yak (heavily wounded)  You feel a surge of power! Poisonous fumes billow around the yak!̹ki m #...# #...# #...# #...######  #.........  #.........  #.Y.......  ##@#  ##..##'##  #  #  #...... #.......  yak (poisoned) #.......# ̹kimt#.......# ̹kimb4===50.4 (1̹ki{q̹kiDsonfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a yak (heavily wounded)  You feel a surge of power! Poisonous fumes billow around the yak! _The yak is poisoned.͹ki4..#.........###...#ludeguy the Toxicologist ..#.........# #...#Octopode of Gozag Gold: 965 ..#.........# #...#HP: 70/70 (71) ======================== ..########### #...#MP: 13/16===================----- ....#͹ki#...######AC: 3Str: 13 ....##.........EV: 15Int: 20 ....##.........SH: 0Dex: 21 ....##.Y.......XL: 10 Next: 11% Place: Dungeon:10 ....#͹ki4##@######.Noise: =--------  Time: 8650.4 (0.0) ....###..##'##c) +0 dagger (protect) #####͹kih@#.......##Cast: Poisonous Vapours#........#Fly Drain#........###########͹kij#................... Y   yak (very poisoned)#.......##....##############.......##....#...............##....#Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.͹kiAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target͹kiAim: a yak (severely wounded, poisoned)  You feel a surge of power! Poisonous fumes billow around the yak!͹ki*1.4 (1͹ki$͹ki9onfirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a yak (severely wounded, poisoned)  You feel a surge of power! Poisonous fumes billow around the yak! _The yak looks even sicker. The yak misses you.͹kin #########..# #####...........#.Y.......#'######.##.@##'## #####.......## #........#...###########.............͹ki##....##############........͹ki .Y-2͹kie ͹ki ͹ki4 #########..# #####......#.....#....##Y########..##'## #####..@....## ͹ki4 5.###########...........##....##############....# ...........͹ki 6 D'Y͹ki? ͹kig@ ]66--=3͹kiKE ͹kiG ( _The yak gores you.͹kiV;n#########..# ######.........#....##'########.Y##'## ####.......## .###########...........##....##############....#.............Y͹ki>8 ͹ki?a5-----=͹ki?4ιkia _The yak attacks as it pursues you! The yak gores you!ιki ..# ######.........##'########..##'## ####..Y....## ιkiog#........##########...........##....##############....# ............ιki[.. ##############ιkiιkiC^7-----5ιkiIιkiLιkisw......##'########..##'## ####..Y....## #.........##########...........ιki&xQ##....##############....# ................... ##############. .............+ιkiUzD.Yιki|A.Yιki܄ιki@--6ιkitιkiҎιkik##'########..##'## ####.......## #........Y##########ιkiA.................##....##############....# ................ ############## .............+#####...#'############ιkilD.Yιki=ιkilT4==7ιki#ιkiˢιki ]  You barely miss the yak.ιki܇ -8=ιki 8.3 (0.9ιki ιki W _The yak is almost dead.ιki  You hit the yak but do no damage.Your weapon exudes an aura of protection.  The yak is almost dead.ιki] 2--10 9.1 (0.8ιkix ιki ( _The yak gores you.Ϲkim $You closely miss the yak. You squeeze the yak.Ϲki+$(Ϲki,H 965 ϹkiN-ealth: 52/71 --agic: 14/16==5Ϲkiu-19Poisonous VapoursϹki-B _You kill the yak!Ϲki-PYour life force feels restored.ϹkiO6Ϲki: Ϲki/:L_Your Stealth skill increases to level 7!ϹkiP:Ϲki@-M#........ ##'######. ....#..##'## #####.....#. ......###########............ #....##############..................##....#+..........ϹkiHϹkiI5-60.9 (1.0 _Ϲki1OϹkiVϹkiWw823-1.9 (2Ϲki[ϹkiV^ Ϲkiv^9_You now have 982 gold pieces (gained 17).Ϲki` .# #..# #..........# ##'######..#..##'## ###### #.......## #........# #........########## #........... ###....#############.##....#  ........##....# ......##....# ...........# .......# ###############....# ..............+....######...#'#############Ϲki Ϲki = 3 2.9 (1ϹkiN Ϲki йkiLN.# #..# ##'######..#..##'## ####### #.......## #  #........# # #........######### # #.......... + ###....#### #########.##....# # ........##....# # ......##....# # ..........# # .....# ################.....# ...............+.....######...#'#############.# #............йkiƢS5=3йkiйkiݪйki,[.# ##'######..#йkiˁ5..##'## ####### #.......## .#  #........# .# #........######## .# #......... .+ ###....### .#йkiw########.##....# .# ........##....# .# .##....# .# .......# .# .# .################......# йki................+......######...#'#############.# #............йkiY.# #....######..йkiߋйkiLS4=4йkiйkiѹki.g Iѹkin ѹkiq ѹkiv Bѹkiuy ѹkiy ѹkiz ѹkiv} ѹki ѹkiǁ g5==ѹki ѹki ѹki ѹki ѹki2  _You reach down and open the door.6==  There is an open door here.6 _9827===8=9  #.......# ..............  #.......# ..............  #...###.# ..............  #.......# .............. ѹki5  #.......################......  #......................'  #..............#####...#'##  #..............# #..........  #.....# #....######817.0)  #.....# #..>.#  #.....# #......  #.....# #.  #......<.......# #. .......... ... ########## #### ҹki+ҹkiÐҹkiҹkiTҹkinҹki,ҹkii _Found a parchment of Curse of Agony.ҹkiYҹki¦L60=ҹkiҹkiթҹkiҹkiRҹkiҹkiҹkiҹkiҹki ҹkiҹkiҹki]ҹkiҹki#ҹkiҹkiU1=ҹki_ҹki)0  #.......################  #......................'  #..............#####...# ҹki #..............# #  #..............# #  #......# #..>ҹki  #.......# #.... ҹki #........# #ҹki  #.......# #....7.9 (6ҹki(.0) ҹkiK #....:............ ..... ҹkims ######################## ҹki=  ҹki` ҹki"ҹkiҹkiҹkia _There is a stone staircase leading up here.ӹki  #................  ######...  #.# #...  #.# #  #...# #..>  #....# #..  #.....# #ӹki3  #<.......# #  #....:@...........   #######################     ӹkit%  ӹkiYӹki18.9 (1 _ӹkix#ӹki$ӹkin x  #  #.#####  #.# #  #.# #  #.# #..  #.# #  #.# #ӹkin   #......<.# #  #.....          ӹkiv ӹkiw %9ӹki| ӹki% _You see here a parchment of Curse of Agony.Թki# #. #.#####. #.# #. #.# #. #.# #..>ԹkiH #.# #. #.# #. #......<.# #. #....: . #Թki2    Թki  Թki Թki Թki%2Թki390 _ԹkiԹkihԹki #.################ #........' #.#####...# #.# #. #.Թki# #.... #.# #..> #.# #. #..Թki*W# #. #......# # #....:............ .....ԹkiNx ########################   Թki   ԹkiԹki.%1ԹkiԹki$a _There is a stone staircase leading up here.ԹkiF Թki Թki Թki  Թki ,2 _Թki_ Թki H 9  You fly upwards.Թki  ...###  ....# Թki?  .  .#  .## Թkiq E .)#..  Թki H#S  Թki 9# Թki D ############## Թki  Թki3  Թki` S   water moccasin (asleep) Թki ԹkiZ3=4.4 (2.5Թki!Թki"J _You encounter a water moccasin.Թki"*Found a short sword.ԹkiV$c _There is a stone staircase leading down here.ֹkiy'.###..#...#.###.).#.. #S. #....@>. ֹki#z(#ֹkiuֹki݃35.4 (1.0 _ֹkiֹkicֹkiM2  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ֹkiZֹkiֹkiֹkiu _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ֹkiO .###.#.....#...##.## #.).#.. #S.ֹkiԃ  #...@.>. #ֹkib ֹki^ ,6 _ֹki- ֹkic ֹkiZludeguy the Toxicologist.....###.........Octopode of Gozag Gold: 982#.....#..........Health: 63/71 =====================---................Magic: 14/16 =====================---..............#AC: 3Str: 13#............##EV: 15Int: 20#.)..........#..SH: 0Dex: 21#S*............XL: 10 Next: 15% Place: Dungeon:9#.**@.>.......Noise: ---------  Time: 8696.4 (0.0)##############c) +0 dagger (protect)Cast: Poisonous VapoursFly ֹkixS   water moccasin (weak)Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (asleep, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the water moccasin.  The water moccasin looks weaker.  The water moccasin is lightly wounded.ֹkie.S..ֹki;4==7.4 (1ֹkiֹkik  Aim: a water moccasin (asleep, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the water moccasin.water moccasin looks weaker.is lightly wounded. _hisses angrily.عkiRludeguy the Toxicologist.....###.........Octopode of Gozag Gold: 982#.....#..........Health: 64/71 =====================---................Magic: 12/16 ==================------..............#AC: 3Str: 13#............##عki EV: 15Int: 20#.)..........#..SH: 0Dex: 21#.S*...........XL: 10 Next: 15% Place: Dungeon:9#..*@.>.......Noise: ==-------  Time: 8697.4 (0.0)##############c) +0 dagger (protect)Cast: Poisonous VapoursFly S   water moccasin (weak)عkiAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (lightly wounded, weak, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the water moccasin.  The water moccasin looks even weaker.عkibG.Sعki=.Sعki.عki.*8.4 (1عkixعkiMPress: ? - help, Shift-Dir - straight line: a water moccasin (lightly wounded, weak, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the water moccasin.  The water moccasin looks even weaker. _The water moccasin is moderately wounded.عkiv  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.عkip? عki? عkiF عkilH _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ٹkitcJConfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  You closely miss the water moccasin. You grab the water moccasin.  The water moccasin is moderately wounded.  You constrict the water moccasin! The water moccasin bites you.  You are poisoned.ٹki:d2====--9.3 (0.9Pois Fly ٹkilٹkiKm5 _The water moccasin poisons you!ٹkiZ?$ _The water moccasin poisons you!  You hit  Your weapon exudes an aura of protection.squeeze the water moccasin!  The water moccasin is almost dead.  You constrict the water moccasin.ٹkiNi  You kill the water moccasin!ٹki6 982 0-10 9-700.1 (0.8 _You feel very sick.ٹkiٹki"h _Your Dodging skill increases to level 5!ٹki .....###.#.....#.#.#.# #.## #.).#.. #. #..@..>. #ٹkiMٹkic58--1.1 (1.0ٹki ٹkic _You feel sick.  You now have 987 gold pieces (gained 5).ٹki76---2.1 (2ٹki ٹki $ _You feel sick.ٹki_  .....###. ##.....#. #. #.# #.## #.).#.. #. #.@...>. #ٹkif ٹkig 4-3=3.1 (1ٹkiJl ٹkin $ _You feel sick.ڹkimڹki?nڹkioڹkiqڹkiuF 3 ڹkiyv3 _You feel sick.ڹkiOwK3-ڹkiCxڹki\{3 _You feel sick.ڹki{K2-ڹki|ڹki3 _You feel sick.ڹki 9=ڹkiWڹki3 _You feel sick.ڹki29871ڹkiڹkiljd  50-ڹki@Fly ڹkiڹkij _You are no longer poisoned.ڹki'}51=4==ڹki<ڹkiڹkilڹkigڹki-,ڹkiXڹki,ڹkiW2=ڹkiqڹkiڹki:==ڹkiڹkiڹkiڹkiўڹkia5=ڹkiڹkiڹki%3ڹkiڹkiBڹkiQ,ڹki>ڹkiڹki g4==ڹki'ڹkiY,ڹki}ڹki8ڹkiڹkiڹkiڹkig5=6==ڹkiKڹki4 _Magic restored.ڹkiڹkiڹki,ڹkiڹkiXڹki%6ڹkiڹkiڹkin:==ڹkiiڹki-,ڹki&ڹkiڹkiwK7=ڹkikڹki,ڹkiڹki|ڹkiڹkiڹkifڹkiڹki{ڹkiڹkizU8=ڹkimڹkiڹkiڹkiڹki,ڹkiڹki5ڹki%9ڹkiڹkiڹkiڹkiڹki^ڹkiڹkiڹki!ڹkiL60=ڹkiڹkieڹkiڹkiڹkiCڹki}ڹkiڹkiڹkiAU1=ڹkiUڹkiڹkiNڹki0ڹkiGڹkiڹkixڹki+ڹkiwڹki]ڹkiڹkid%2ڹkiڹkiڹkiڹkiڹki,ڹki ڹkim ڹki K3=ڹki ڹki.,ڹkiڹkiڹkiڹkiDڹki ڹkijU4=ڹkizڹkij,ڹkiڹki~,ڹkiڹki;ڹki|%5ڹkiDڹki!,ڹkiR*ڹki,,ڹki-ڹki/ڹki*0K6=ڹki/1ڹki\4,ڹkib5ڹki7ڹki<8ڹki9ڹki:ڹki-;ڹkif=ڹki>ڹki=?U7=ڹkiO@ڹkiBڹkibBڹki6CڹkiKF,ڹki[GڹkiIڹkiI%8ڹkiJڹkiGLڹkiLڹkiMڹkiNڹki0Oڹki!PڹkicRڹkiRK9=ڹkiSڹkiUڹkiUڹkiVڹkiXڹkiYڹkiYڹki[ڹki\O70=ڹki\ڹki^ڹki,_ڹki`ڹkigb,ڹkiVcڹkidڹki>eڹkiCfڹki@hڹkihK1=ڹkiiڹkil1 _HP restored.ڹkin3ڹkipڹkisڹkiu,ڹkivڹkitC  You see here a +0 short sword.ڹkiڹkii _ڹkiqڹkilڹkiڹkiu9=ڹkilڹkiڹki3ڹkiuڹkiNڹkiڹkiƔڹkiڹki'ڹkiڹkiڹkiAڹkioڹkinڹkiDڹkiڹkiڹkiWڹkiڹki'ڹkiڹkiڹki,ڹkiڹki/ڹki,ڹkiڹkiٶڹkiڹki,ڹki8ڹkiڹkieڹkiڹkiڹkif>1003ڹkiڹki7O _You now have 1003 gold pieces (gained 16).ڹki$ڹkihڹkiڹkiڹkiaڹkiڹkiڹkiڹkiڹkiOڹkiڹkiڹki,ڹkiڹkiڹkiڹkiڹkirڹkiڹkif&17ڹki ڹki-O _You now have 1017 gold pieces (gained 14).ڹkieڹkiڹkiڹkiڹki^ڹkiڹkiڹki.,ڹki>ڹki/x _p - 3 glowing amethyst potions (gained 2)ڹki3ڹkiڹkiڹkiڹkiڹkiڹki ڹki ڹkig ڹki ڹkiRڹkiڹkiFڹki[ڹki1ڹkiڹkiڹkiڹkiڹkixڹkiڹkiڹki#w....... ....... ....#....... ....#....... ......###........ ...........#...## ##..........##...## ##...........#.#...@.###............#.......#.............##....................##...................ڹkio$5##..............#...##............####..........####........## # ##........## #. ڹki)2804.1 (101.0)ڹkiu*+52ڹki.ڹkiw6- _c - a wand of roots (4)ڹkiڹkiڹkiڹki2ڹkiS ڹki ڹki,ڹkiڹkiiڹki"ڹkiڹki`ڹkiڹkilڹkiڹkiڹkiLڹkiڹkibڹkiڹkiPڹkiڹki !ڹki"ڹkiI#ڹki$ڹki%ڹki5'ڹki'ڹkiM(ڹki+ڹki,,ڹki-ڹki/ڹki*1ڹki1ڹki-2ڹkiE5ڹki8l  You encounter a steam dragon.ڹki>........#.................#...........D ............ ............. .................... .................... ...................# ...........#@......# ڹki?..........###......###.... .........## #......# ...#...## ##...........# #. ##...## ##.....#.#.....###........D   steam dragon (wandering)#.......#...............##......................##.....................ڹki@114.1 (9.0)ڹki2Fڹki+G55.1 (10.0) _ڹkiKڹkiMڹkiJ^    .................#  ..................D  ...................  ....................  ....................  ....................  ...................#  ..#@......#  ..###......#  .## #......  .## ##.....  ڹki_ #. ##...## ##......  .....  ...  ...   ڹki    .................#  ..................D  ...................  ....................  ....................  ....................  ...................#  ..#@......#  ..###......#  .## #......  .## ##.....  #. ##...## ##...... .....  ... ... ڹkiY ڹki ڹkiN ڹkiO c _A steam dragon is nearby!۹ki  !..۹ki] .#..D......۹ki ..................# ...........#.# .۹ki  ##۹kiH ###.....## ......##...## #۹ki W# #. ##...## ##.. #.....###........#..... #.............۹ki 8#....۹kiU @.D۹kij ۹kib 76.0) _۹kiA& ۹ki( ۹ki} V..D........ ..# .## .#####.....۹ki} ## ......##...## # #. ###.. #.....###... ...........#.....۹ki~ ..................#....## .۹ki ۹ki؆ %7۹ki ۹ki ܹki,|# .D.....  .....  ......#  .#.......#  .#..@...###....  ......##..# ...#...## ##.# #. ##...## ##.. #.###.......#.......#.... D   steam dragon (wandering)##.........##...........##......ܹkik@.DܹkiVܹki%8ܹki'ܹkiܹki# ###..  .D .... ... .....ܹki?# .#....@..# .##......###.... ......##......#  ...#...## ###  #. ##...## ##....ܹki.#.###. #.......#.....##...........##...ܹki7D.ܹki%ܹkiC&%9ܹki+ܹki.ܹki d## ...###.D .<..........# .#.......# ##......###.... .....##............# ...#...## ##.....# #. ##...## .....  #.###.ܹki ....#.......###.ܹki5 7D.ܹkiފ ܹki8 &20ܹki ܹki 9 _Found a stone staircase leading up.ݹkix/0 ## ...## ..D###.<.......###....#.......# . ##......###.... .##....... ..#...## ##...........# . ##...## ....... #.##......  #.......#.Dݹki/%1ݹki4ݹki6ݹkiS ...# ## ...### ....###..D.<....###...........# ....#......###....#.##............# #...## ##...........#  ##...## .. .###ݹkiUK.Dݹki\\ݹki\%2ݹkibݹkicݹki5 E ...# . ...#  ## ....#### .###...D.<....###.........# ......#......###....#.##............# #...## ##...........# ##...## .Dݹkiu ݹki %3ݹki0 ݹki ޹ki>ludeguy the Toxicologist##... ...#Octopode of Gozag Gold: 1017##..... ...#Health: 71/71 ========================##......# ....##Magic: 14/16 =====================--- .......#.......# ......AC: 3Str: 13 ...............###......EV: 15޹kiInt: 20 ...................*D...SH: 0Dex: 21 .................**.....XL: 10 Next: 19% Place: Dungeon:9 ................@...<...Noise: ---------  Time: 8823.1 (0.0) ........................c) +0 dagger (protect) ........................޹ki(Cast: Poisonous Vapours ...............###......Fly .......#.......# ...... ......###......###....##D   steam dragon (weak) ޹kiO .....## ##............# #...## ##...........# ޹kiu##...## ##.............Press: ? - help, Shift-Dir - straight line޹kiAim: a steam dragon (wandering, hasn't noticed you, chance to weaken: 100%)  You feel a surge of power!  ޹kiThe glob of mercury hits the steam dragon!  The steam dragon looks weaker.  The steam dragon is heavily wounded.޹kitjAim: a steam dragon (wandering, hasn't noticed you, chance to weaken: 100%)  You feel a surge of power!  The glob of mercury hits the steam dragon!steam dragon looks weaker.  The steam dragon is heavily wounded.The steam dragon hisses angrily.޹ki9u1D.޹ki|..j   gnoll (wandering)޹ki|O==4.1 (1Poisonous Vapours޹kiC޹kiq _You encounter a gnoll. It is wielding a +0 flail.޹ki -  ludeguy the Toxicologist ##... ...#  Octopode of Gozag Gold: 1017 ##..... ...#  Health: 71/71 ======================== ##......# ....##  Magic: 12/16 ==================------ .......#.......# ......  AC: 3Str: 13 ...............###......  EV: 15޹ki Int: 20 ...................$....  SH: 0Dex: 21 .......................j  XL: 10 Next: 19% Place: Dungeon:9 ................@...<...  Noise: ==-------  Time: 8824.1 (0.0) ........................  c) +0 dagger (protect) ........................  Cast: Poisonous Vapours ...............###......  Fly .......#.......# ...... ......###......###....##  D   steam dragon (weak) .....## ##............#  j   gnoll (wandering) #...## ##...........# ##...## ##............. Aiming: Mercury Arrow (safe; 1% risk of failure)  ޹ki\ <Press: ? - help, Shift-Dir - straight lineAim: a steam dragon (heavily wounded, weak, chance to weaken: 100%)  You feel a surge of power!  The glob of mercury hits the steam dragon!  The steam dragon looks even weaker.޹ki  ##... ...#  ##..... ...#  ޹kix ##......# ....## ......# ...... ...... ...... ........**....j ...... ...... ...... ...... ......# ............###....## j   gnoll (wandering) ##............# ##...........# ޹kip 3j.޹ki[w "..޹ki& Y1017 235.1 (1Poisonous Vapours  Press: ? - help, Shift-Dir - straight line  Aim: a steam dragon (heavily wounded, weak, chance to weaken: 100%)  You feel a surge of power!  The glob of mercury hits the steam dragon!steam dragon looks even weaker. _You kill the steam dragon!߹ki=]##... ....# ##..... ....# ##......# ....##.# .###.$..j.<.###.#.# .###......###....### ##............# ...## ##...........# ߹kiu>1j.߹kiPF߹kiG.--6߹kiM߹kiBO߹ki9_ o  ludeguy the Toxicologist ##... ....#  Octopode of Gozag Gold: 1017  ߹ki_ ##..... ....#  Health: 71/71 ======================== ##......# ....###  Magic: 10/16 ===============--------- ......#.......# .......  AC: 3Str: 13 ..............###.......  EV: 15Int: 20 ߹ki'` ..................$.$...  SH: 0Dex: 21 ........................  XL: 10 Next: 23% Place: Dungeon:9 ................@..<....  Noise: ---------  Time: 8826.1 (0.0) ߹ki` ........................  c) +0 dagger (protect) ........................  Cast: Poisonous Vapours ..............###.......  Fly ......#.......# ....... .....###......###....###  j   gnoll (wandering) ....## ##............# ...## ##...........# #...## ##............. Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a gnoll, wielding a +0 flail (wandering, hasn't noticed you, chance to  weaken: 100%)  You feel a surge of power! The glob of mercury hits the gnoll!  ߹kia The gnoll looks weaker.߹kiEe  ##... ....#  ߹kie ##..... ....#  ##......# ....### .....# ....... ...... ...*$... ........**..... ߹kie =...... ...... ߹kie >...... ...... ߹kif .....# ............###....### ##............# ##...........# ߹ki )...߹ki 3==7.1 (1߹ki ߹ki  Press: ? - help, Shift-Dir - straight line  Aim: a gnoll, wielding a +0 flail (wandering, hasn't noticed you, chance to  ߹ki- |weaken: 100%)  You feel a surge of power! The glob of mercury hits the gnoll!  The gnoll looks weaker. ߹kiV >_You kill the gnoll!ki  ...... ... .....# .... .....#  ##......# #....####.# #.###.....ki $.$.<....###........# #........#......###....###.##............# ..## #kiki4.--8kikikik... .......  ......# ... .....#  ##......# #....####.......# #.###.....$....j.....#kidmH<.....##....###.j   gnoll (polearm, asleep).......# #........#......###....###..##.ki}ki~@--9kikil _You encounter a gnoll. It is wielding a +0 halberd.kiR _You see here 15 gold pieces.kiV ... .. ##... ......# .##..... .....# .##......# #....###.#.# #.###.j$@$....j.#<.....# # ###.j   gnoll bouda (asleep)#.......# #.j   gnoll (polearm, asleep)###......###....###. ki` kia V1=30kih kik v _You encounter a gnoll bouda. It is wielding a +0 club.ki .. .. .##... .......# .##..... ......# ..j##......# #....###...j#.# #.###.j.$.@....j.j#<.....# #  ###.#.......# #.jjj 4 gnolls (1 polearm, asleep) .ki: e###......###....###. kiQ j.  You encounter 3 gnolls.A gnoll is wielding a +1 flail of protection.ki 0j.ki~ Q.jki H.jkif jjwandering)jjjj3 wandering, 1…)The gnoll shouts!ki /===1ki9 ki a _The gnoll is distracted by your dazzling golden aura.  Things that are here:ki O _6 gold pieces; a +0 flailki.......... .. .##... .# .... ......# ..j.# #....###.... ....# #.........j....###........$.$...jjj...@.....###<.....# ki{.......#...###..#.# #.##......###....###.... 3 gnolls (1 polearm, 2 wandering) ##............#  ##.#ki 6j.ki!;.jki!ki"Jjjki,#ki#1j.ki+Uj1ki,--2ki4ki~7' _The gnoll shouts!kik  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki. ..............# ......# ..#....###...#........j...###...............$.$....j.ki.......@...j.#.......<.....#.............#.................###............# #..........j  poisoned)#....###...jpoisoned)ki<.....# ...ki?qYou feel a surge of power! You begin to radiate toxic energy.  The gnoll bouda shouts!kio :..............# ......# ..#....###...#........j...###...............$.$....j........@...j.#.......<.....#.............#.................###............# #..........#....###........# ...kit .jThe gnoll bouda is poisoned. The gnoll is poisoned. x3kiu Y.jkiHv S.jki/w 3j.kiހ J2 poisoned, 1 v…)ki 7/16 ------=3Poisonous VapoursToxic Fly ki2 kij 2 _The gnoll looks even sicker.kiz  .##... .# ..##..... ....j##......# #....###.... ...#.................##j....$.$....jkiU ....j.j###...# ...###.#.# ###......###....##### ##............# ... ## ##...... .## ##..ki w $The gnoll bouda looks even sicker.ki  j.  You kill the gnoll!Your toxic aura wanes.The gnoll is distracted by your dazzling golden aura.kiQ jjjunaware, dazed, very poi…)jj 2 gnolls (1 unaware, 1 dazed, poisonedki ---4Poisonous VapoursFly ki kio J _The gnoll bouda is distracted by your dazzling golden aura.kiX a _There is a stone staircase leading up here.ki   ki! Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiX$Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.  You feel a surge of power! You begin to radiate toxic energy.  The gnoll bouda snaps out of its daze.  The gnoll bouda shouts!  The gnoll looks even sicker.ki......# .......# ...#....###.....# #............###......j.........$.$....j...........$.$#.......@.....#.............#ki?.................###............# #..........#....###...jvery poisoned).....# ...j   gnoll (very......# ..ki"......# .......# ...#....###.....# #............###......j.........$.$....j...........$.$#.......@.....#.............#kit.................###............# #..........#....###........# .........# ..ki]/$ki.jki j j  wandering, swift)You kill the gnoll! x2ki3------------4===5Toxic Fly kiTki"ki% kil%V_The gnoll picks up the pace!kiN Y j.  ki The gnoll shouts!kiF ;j.ki 1j.ki j  swift, poisoned)ki9 ^4==-----6kia B _The gnoll is poisoned.kiO1 j.  The gnoll bouda gazes fiercely through you!ki11j.ki98 ki9---7Weak Toxic Fly ki0:kihAkiCb _You feel your attacks grow feeble.kimGN--kiQNkiX0$ki` jj   gnoll (swift, unaware, dazed, very po…)  You kill the gnoll bouda!kiNayThe gnoll looks even sicker.  Your toxic aura wanes.kie==58Fly kiɍkid _The gnoll is distracted by your dazzling golden aura.  You fly upwards.  You hear the solemn chanting of funerary rites.ki/  --more--ki% %8ki6 #.#  #.#  ##.##  ##...##  ..ß..  #. .[. ##  #...##.##...#  ##  #.....<..#  ##  #........#  kip3+........# #........ .........$# ......^...# kig:10179.6 (2.5kiB8<ki  There is an entrance to the Necropolis on this level. Hurry and find it before _the portal closes!  Found a ring mail and 11 gold pieces. Found a stone staircase leading up.kic _There is a stone staircase leading down here.kiM #.#  ##.## ###...### ...ß... #. #.[.# ###...##@##...#><#........#.......^...#kiki^440.6 (1.0 _kikiTkiI #.  #.#  #.#  .#   ##.##  #####...#####.. #.....ß.......ßkiJ #. #.[@# ##  #...##.##...# #.....>..#  #.....<..#  #........#  #........# kiL  +........#   #..#   ...$#   ki[kiY]%1ki=ekiikiz ki| sRead which item? Scrolls ki|  a - 3 scrolls of enchant armourW - a scroll of brand weapon  V - 2 scrolls of vulnerability ki} [!] read|quaff|evoke[?] describe selectedkiC#ki)ki1   ludeguy the Toxicologist#.  Octopode of Gozag Gold: 1017#.#  Health: 71/71 ========================#.#  Magic: 4/16======------------------#.#  AC: 3Str: 13##.##  EV: 15Int: 20#####...#####..  SH: 0Dex: 21kiv3#.....ß.......ß  XL: 10 Next: 25% Place: Dungeon:8#. #.[@# ##  Noise: ---------  Time: 8841.6 (0.0)#...##.##...#  c) +0 dagger (protect)#.....>..#  Cast: Poisonous Vapours#.....<..#  Weak Fly #........# #........#  +........#  #........#  .........$#  You fly upwards.  You hear the solemn chanting of funerary rites.There is an entrance to the Necropolis on this level. Hurry and find it before _the portal closes!  Found a ring mail and 11 gold pieces. Found a stone staircase leading up. _There is a stone staircase leading down here.ki9P  Okay, then.ki7;ki@kiC. _kiyRkiVDrink which item? Potions  c - 7 potions of curing  g - a potion of magicb - a potion of brilliance  e - 5 potions of enlightenment  B - a potion of berserk rage  M - 4 potions of mutation  j - 3 potions of moonshine  d - a silvery potion ki3Wf k - a sapphire potion  n - 2 bubbling amethyst potions  o - 2 murky coppery potions  p - 3 glowing amethyst potions [!] read|quaff|evoke[?] describe selectedkikiki  ludeguy the Toxicologist#.  Octopode of Gozag Gold: 1017#.#  Health: 71/71 ========================#.#  Magic: 4/16kiy======------------------#.#  AC: 3Str: 13##.##  EV: 15Int: 20#####...#####..  SH: 0Dex: 21#.....ß.......ß  XL: 10 Next: 25% Place: Dungeon:8ki#. #.[@# ##  Noise: ---------  Time: 8841.6 (0.0)#...##.##...#  c) +0 dagger (protect)ki#.....>..#  Cast: Poisonous Vapours#.....<..#  Weak Fly #........# #........#  +........#  #........#  .........$#  You hear the solemn chanting of funerary rites.There is an entrance to the Necropolis on this level. Hurry and find it before _the portal closes!  kiFound a ring mail and 11 gold pieces. Found a stone staircase leading up. _There is a stone staircase leading down here. _Okay, then.ki8P  Okay, then.kikiki. _ki{=   #.  #.#  #.#  .#   ##.##  #####...#####... #.....ß.@.....ß. ki>$#...#.[.#####... #...##.##...# #.....>..#  #.....<..#  #........#  #........#  +........#  ##  kiHkikI12.6 (1 _kiNkiqRkim   #.  #.#  #.#  #.#  ##.## # #####...#####...# ki5 #.....ß.ß. #...#.[.#####...# #...##.##...# # #.....>..#  #.....<..#  #........#  #........#  +........#  #.#  ki] ki [5=3ki ki] ki,  #.  #.#  #.#  #.#  ##.## ##  #####...#####...# #.....ß.ß..#  #...#.[.#####...# #...##.##...# ##  #.....>..# ki&._ #.....<..#  #........#  #........#  +.#  #.#  kil7ki8%4ki=ki@kiQ   #.  #.#  #.#  #.# # ##.## .##  #####...#####...##  #.....ß.ß..#  ki #...#.[.#####...##  #...##.##...# .##  #.....>..# # #.....<..#  #.#  #.#  +.#  #.#  kikibf5Fly kiki f _Your attacks no longer feel as feeble.ki0}%  #.  #.#  #.# # #.# .#  ki}##.## #.##  #####...#####...##  #.....ß.ß..#  ki~#...#.[.#####...##  #...##.##...##.##  #.....>..# .#  #.....<..# # #.#  #.#  +.#  #.#  kikki%6ki֍kiki .. #. ?# #.# .# #.# .#  #.# .#  ##.## ##.##  ki#####...#####...##  #.....ß.ß..#  #...#.[.#####...##  #...##.##...##.##  #.....>..# .#  #.....<..# ##  #.#  #.#  +.#  #.#  kikiA=7kiki5e _Found a scroll labelled CUEPRO YTRIV.kix .. #.#?#  #.# #.#  #.# #.#  #.# #.#  ##.## ##.# #####...#####.. #.....ß.......ß..#  #...#.[.#####.@.##  ki #...##.##...##.##  #.....>..# ..#  #.....<..# ####  #........#  #.#  +.#  #.#  ...$#  kip ki; %8ki ki kikikikiki[kiKkiAkikiJW ..  #. #?#  #.# #.#  #.# #.#  #.# #.  ##.## ##  #####...#####...##  #.....ß......@ß..#  #...#.[.#####...##  #...##.##...##.##  #.....>..# ..#  #.....<..# ####  #.#  #.#  +.#  #..# ki!ki"Y6==9kid'ki*ki Mß .. ? #.# #.#  ##.## ##.## ####...#####@..##..ß.......ß...[.#####...####.##...##.###.....>..# ..# kiE ki4 &50ki! kiP$ ki  ...  .ß.   ...  #. #?#  #.# #.#  #.# #.#  .# #.#   ##.## ##@##  #####...#####...##  #.....ß.......ß..#  #...#.[.#####.. #...##.##...##.# #.....>..# ..#  #.....<..# #### ki` #.#  #.#  ki< ki< %1ki ki! ki&!VM##.##.ß ... ? #.# #@#  ##.## ##.## ####...#####...###.....ß.......ß..#   Fly #ki)ki*%2ki0kiZ3kiM ### ##.###...#ß ... ? #.# #.#  ##.## ##.## #####...#####...##   Fly ..ß..##...## ###kikikiy8==3kiokikiSBM ### #.###...##..ß.. ... ?kiT #.# #.# ##.## ##.##  Fly #...#..#kiA^kiQ`%4kiJdkigki~M ###  ##.## ###...##...ß..# #...#ki! #.# #.#  Fly ##.##ki1;5kiki.ki;^7=6.6 (2kikib _c - a scroll labelled CUEPRO YTRIVki M ###  ##.## .#####...#.......ß..# #.@.# ##.###.# #.# ...ki ki *7.6 (1ki̐ ki^ ki/ki0ki|1ki6ki&:,ki@kiAki~AkiDki`E9=kiEki]HkiHki~IkimLkiMkidMki;OkiOj8==kiQki"RkiORkiaTkiTkiTkiXkiQXkiXki=\ki\:==ki]ki(ckickickigkihM9=kihkilkiTmkimkiokiOpkipkiskiskimtkixkiTy9=kiyki{kiS|,kiC,kikiki,R10/16==kiskikikikiki]ki/ki{==kikikkiٛkiki'kiskiۡki7M1=kikikikikiBki-ki~kiɱkiܳki9=kiki+kikiιki _You hear the lone wailing of a very distant funeral chant.kiN2==kiki,kiki,ki|kikikikilki:==kikirkikikikiki6kikiK3=ki-ki-kir=kiu[4==kiki{kikir,ki;kixkikikiki.:==ki ki ki ki5=ki kilkiki~ki,kiBki?ki9=kiJki,kiBki( ,kix ki^"ki"b6==ki{$4 _Magic restored.ki(3kiS(ki)kiG+,ki.,ki1Xki63ki3:==ki3ki4ki6ki7kiy7ki9ki<ki[<ki=ki>kiCA,kiAkiBkiDki+EkiEkiKGkiI,kiIkiJkiLkiCMkiMkiQkiQkiJRkiVo _d - 2 silvery potions (gained 1)ki4Z3ki[ki-\ki^ki^ki _ki_ki~d,kiKekifkiikijkiLjkiWkkiUnkinkiokipki skicskiskiAukiykizkiwzki|ki9kiki-kinkimkikiZkikikiKkikiki2kiki΍kiki),kiki( _You hear the lone wailing of a distant funeral chant.ki9kikiakikikiZki9ki0kixkikikiOki.kiki^kikiųki,kiki׸,kikiMki,kikiki6kikikikikiDkiki"kiLF _You reach down and open the door.kikikiki@  There is an open door here.kip###### ##....# #..##.## #.##...## #.#..ß...kinp #.##...##################.###.## .'..........#.# .......@#..........#.# 949.6 (92.0) ........#..........#.#  #....##.########..##.##  #...kiJ#####...## #.. ... #.....ß... #. ... #...#.[.## + ... #...##.##.ki ##.). #.....>..# #.....<..#kiki,50.6 (93kiki$ _Found a flail.ki ki< ,Read which item? Scrolls  a - 3 scrolls of enchant armourW - a scroll of brand weapon  V - 2 scrolls of vulnerability  c - a scroll labelled CUEPRO YTRIV [!] read|quaff|evoke[?] describe selectedki>kiki#######ludeguy the Toxicologist##....#Octopode of Gozag Gold: 1017#..##.## Health: 71/71 ========================#.##...## Magic: 16/16 ========================kio$#.#..ß... AC: 3Str: 13#.##...## EV: 15Int: 20################.###.## SH: 0Dex: 21........'..........#.#XL: 10 Next: 25% Place: Dungeon:8kif%.......@#..........#.#Noise: ---------  Time: 8950.6 (0.0)........#..........#.#c) +0 dagger (protect)#....##.########..##.## Cast: Poisonous Vapours#... #.# #####...## Fly #.. ... #.....ß...#. ... #...#.[.## + ... #...##.##. ##.). #.....>..# #.....<..#  _Magic restored. ki%_d - 2 silvery potions (gained 1) _You hear the lone wailing of a distant funeral chant. _You reach down and open the door.  There is an open door here. ki%_Found a flail.ki&,P  Okay, then.ki$1ki2ki5. _kidy....# #..##.## #.##...# #.#..ß..kiyl #.##...##################.###........'..........#.#.#..........#.#+.#.#.###....##.########..##.## #... #.# #####...# #.. ... #.....ß.. #. .... #...#.[.#kiwz + ....< #...## ##.)... #.....>. (..... #.....<.. #........ki8<kiD*1.6 (1kikiQ _Found 4 poisoned darts. Found a stone staircase leading up.ki kid ki ki ki  ##....# #..##. #.##... #.#..ß #.##... ######.###. #.'...#.# #.#ki ].#.# +.#.#.# ##....##.##..##. #.... #.# #####... #.... ... #.....ß #.... .... #...#.[. +.... ....< #...##.#....##.)... #.....>#.... (..... #.....< #ki ki %2ki ki8 kiQ ##.... #..##. #.## #.#..ßkiܾ #.## #####.###. #.'....#. #.#.#. +.#.#. ##....##.##..##. #....##.# ##### #........ #.....ß #......... #...#.[ +.........< #...##.kio #....##.)... #.....> #....# (..... #.....< #kiki2%3kikiLki,Vg #..## # #. #.##.#################.### #........'..........# #kiV.#...# +.#.# ##..@.##.########..## #....##.# ### #........ #... #......... #...#. +.........< #...## #....##.)... #.... #....# (..... #..... .....# ... #..... #kis`kia%4kifkieikin # #. #.###################.## #........'.......... #.#.. +ki0 .#. ##....##.######## #.@..##.# ### #......... #... #......... #...# +..< #...# #....##.)... #.... #....# (..... # .....# ... # .....# # +ki? ki! %5kif ki ki^u  .#################........'..........#.+.###....##.########..# #.## ####..... #....#+<Fly ......##.... kiw ki x 6ki} ki\ ki& #.##################. #........'......... #.# +.# ##....##.######## #....##.## ### #......... #... #. #ki +.< #... #....##.)... #... #....# (..... #ki@& .....# ... # .....# #......# +kig ....?.# #.kikiC%7ki'ki ` _Found a scroll of teleportation.ki!......'.....#.#........kikiu%8kinkiX7 _You reach down and open the door.ki*e kiGf kin kiut ki:#################...... #........'............. #..#...#..+..#......##....##.########.#....##....##.## ###.......#......... #..∩......#. #........< #ki).....##....##.)... #..#.. #....# (..... # ... .....# ... # .....# #......# +kiˑ# ....?.# # ....#.ki kikiœ%9kikia* _Found a phantasmal passage.kiQ _There is an open door here.ki1 #.......#........'.....#........#.#..+........#.....##....##.#kiXi..#....##....##.## ........#.. #.∩......#. #..'.< #ki#......##....##.)... #.#... #....# (..... #. ..... .....# ... #...#. .....# #.............# +.#.. ......?.# #... .. ....#ki?%  kiki-60 _ki kiki ........#.'........#........#.#..+........##.......##....##....#....##....##.## #........#... ##.∩......#kiP. ##......@.'.< #.#......##....##.)... #....#...##....# (..... #kiyW.............# ... #......#.......#kiߴ  #..............# +#.#.........?.# ##.......##....#  kiki(%1kikiki ........#........'...........#.#..#..+.##.......##....##.######....#....##....##.##  #........#.........  #.∩......#..  #..'ki b.<  .#....@.##....##.)... ....#...##....# (..... #..............# ... ......#.......# ...............##.#.........?.# #.......##....#ki . #..... .# ....  ki kil %2ki ki; ki.#.#..#..+.##.#.......##....##.#####kimA ....#....##....##.##  #........#......... #.∩......#. #.kiS.'.........< .#......##....##.).......#@..##....# (..... #..............# ... ki........#.......# ...............##.#.........?ki7.# #.......##...ki`x.# #.......# ...ki. #...P..PP ..kikiw%3kikiJki03kiޘkiϛki  .#.'#.........#.#........#..+........#...#.#.......##....##.####....#....##....##.## #..#... #.∩......#... #..'.........< .#..@...##....##.).......#...##....# (....#.......# .......#.#...............#..#.#.........?.#i5 10H...#.......##....#.. #.......# ....#...P..PP ..ki ki¥ %4ki ki ki d ############.##........#.'#.........#.#........#..+........#..#.#.......##....##.###....#....##....##.## #..#.. #.∩......#ki4 Q. #..'.........<..#......##....##.)......#...##....# (.....#......kio k.# ... .........#...# ........ki ..#.#.#......ki 1?.#ki ..#.......##....#.. #.......#....ki kiki%5kiki kim ##.#.## ###########.##........#.'#.........#.#........#..+........#.#.#.......##....##.##....#....##....##.## #..#. #.@......#. #..'....... .....#......##....##.) ........#...##....# (....#.......# ........ki.....#....#................#...#.#......?.#..#.##....#kiki%6kikioY _There is a phantasmal passage here.kiIkiYki,7 _kiki Fa Necropolis _There is an open door here. _There is a phantasmal passage here.  The world spins around you as you enter the gateway.  You enter an ornate necropolis!  You learned that your 2 murky coppery potions are actually 2 potions of  lignification.ki" H ≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈ ≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈ ≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈ ≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈ ≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈ ≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈≈≈≈≈≈≈≈ ≈≈≈≈≈▓▓############▓▓≈≈≈#≈≈≈≈≈≈≈≈ ≈≈≈≈▓▓##..........##▓▓≈≈≈≈≈≈≈≈≈≈≈ ≈≈≈▓▓##..∩......@..##▓▓≈≈≈≈≈≈≈≈≈≈ ≈≈≈▓##..............##▓≈≈≈≈≈≈≈≈≈≈ ≈≈▓▓#................#▓▓▓▓▓▓▓▓▓▓▓ ki?# ▓▓▓########++++################## ▓###........................... ▓#...............................  ##...............................  #...........♣...♣♣........♣♣.ß.ß.  #.............♣♣..♣♣.......♣.P.P. ki>t ,9.1 (2.5kix ki} 2 _o -> L - 2 potions of lignificationki` c _There is an empty arch of ancient stone here.ki?9≈#≈≈#≈▓▓▓▓≈≈≈≈z≈▓▓#####▓▓≈≈≈#≈▓▓##ki9|.##▓▓≈▓▓##..∩∩..##▓▓≈▓##.##▓≈▓▓#.# ≈▓▓▓#++++ki9B# ≈▓###▓# ▓## ▓#ki?:j.♣...♣♣.♣♣.ß.ß ▓#.♣♣..♣♣.♣.P.PkiJJ70.1 (1.0 _kiPkiS≈#≈≈#≈▓▓▓▓≈≈≈≈z≈▓▓#####▓▓≈≈≈#≈▓▓##.##▓▓≈▓▓##..∩....@.∩..##▓▓≈▓##.##▓≈▓▓#.#≈▓▓▓#++++#≈▓### ≈▓▓# kiT≈▓## ≈▓#.♣...♣♣.♣♣.ß. ≈▓#.♣♣..♣♣.♣.P.kiX_ki2`%1kihfkiohki% d#≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z▓############▓▓≈≈≈###..........##▓▓≈≈#..∩∩..##▓▓≈▓##...kiШ .....##▓▓..#▓▓▓▓▓▓▓▓▓▓▓########++++###############≈▓###..........................▓#.≈▓##≈▓♣...♣♣♣♣.ß≈▓#...♣♣..♣♣.......♣.P≈▓#...♣♣......♣....ki ki %2ki kiF ki8#≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z############▓▓≈≈≈#▓##..........##▓▓≈≈#..∩∩..##▓▓≈▓##........##▓▓..#▓▓▓▓▓▓▓ki▓▓▓########++++##############≈▓###.........................▓#.≈▓##≈▓♣...♣♣♣♣≈▓#...♣♣..♣♣.......♣.≈▓#kiZ...♣♣......♣....≈▓#♣♣........♣ki{ki%3kiki0ki3/''''............................................♣...♣♣...........♣♣...........ki=ki>%4kiDkiG< _You reach down and open the huge gate.ki#≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z############▓▓≈≈≈#▓▓##..........##▓▓≈≈#..∩∩..##▓▓≈▓##........##▓▓..#▓▓▓▓▓▓▓▓▓########@'''#############≈▓###........................▓#........≈▓##....≈▓♣...♣♣♣♣≈▓#...♣♣..♣♣.......♣≈▓#.....♣♣......♣..≈▓#kil♣♣........♣≈▓#P....P...♣.♣.♣kiki\%5ki@kiU _There is a huge open gate here.kiBeI≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z▓▓############▓▓≈≈≈#▓▓##..........##▓▓≈≈##..∩......∩..##▓▓≈▓##..............##▓▓#........#▓▓▓▓▓▓▓▓########''''############≈▓###......@................▓#.≈▓##≈▓♣...♣♣♣≈▓#...♣♣..♣♣.......≈▓#kie%...♣♣......♣..≈▓#♣♣........♣≈▓#..P....P...♣.♣≈▓#♣.♣♣...ß.♣♣.ß....♣..kidqkis,6 _kixki{ki / ▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z▓▓############▓▓≈≈≈#▓▓##..........##▓▓≈≈≈▓▓##..∩∩..##▓▓##........##▓▓#..#▓▓▓▓▓▓▓▓########''''###############.......................▓▓#..#.♣...♣♣♣.Fly ........♣.♣♣...ß. ≈≈≈≈≈▓##......................... ki kiz %7kig ki ki6 ▓▓############▓▓≈≈≈#▓▓##..........##▓▓≈≈≈▓▓##..∩∩..##▓▓##........##▓▓#.....#▓▓▓▓▓▓▓▓########''''###############.......................▓▓#..#.♣...♣♣♣..♣♣..♣♣...Fly .....ki............... ≈≈≈≈≈▓▓#......................... kidki%8kikikiN   ▓▓##..........##▓▓≈≈≈▓▓##..∩∩..##▓▓##........##▓▓#.....#▓▓▓▓▓ki ▓▓▓########''''###############.......................▓▓#..#.♣...♣♣♣ki ..♣♣..♣♣...♣♣......♣Fly ki ............. ≈≈≈≈≈≈▓###....................... ki kiki%9kiPBPki ki<"∩∩..##▓▓≈▓##..............##▓▓...#▓▓▓▓▓▓▓########''''###########≈▓###......................▓#.≈▓##.≈▓♣...♣♣≈▓#ki"...♣♣..♣♣......≈▓#...♣♣......♣≈▓#♣♣........♣≈▓#..P....P...♣.♣≈▓#ki#@♣.♣♣...ß.♣♣.ß...≈▓##......................≈▓▓#...............≈≈▓###.............≈▓▓########################kig3ki4&80ki=&Pkij@kid#≈▓##........##▓ #▓...#▓▓▓ #▓▓▓########''''########## #≈▓###..................... #▓#. #≈≈≈≈≈≈▓##. #≈≈≈≈≈≈▓♣...♣♣ #≈≈≈≈≈≈▓#...♣♣..♣♣ #≈≈≈≈≈≈▓#...♣♣......♣ #≈≈≈≈≈≈▓#♣♣........♣ #≈≈≈≈≈≈▓#..P....P...♣ #≈≈≈≈≈≈▓#♣.♣♣...ß.♣♣.ß... #≈≈≈≈≈≈▓##...................... #≈≈≈≈≈≈▓▓#.. #≈≈≈≈≈≈≈▓###...... #≈▓▓####################### #................####⌠.ki ekiqki'r%1kiykiK{kit l #▓..#▓▓  #▓▓▓########''''#########  #≈▓###....................  #▓#.  #≈≈≈≈≈≈▓##  #≈≈≈≈≈≈▓#♣...♣♣  #≈≈≈≈≈≈▓#...♣♣..♣♣  #≈≈≈≈≈≈▓#...♣♣.  #≈≈≈≈≈≈▓#♣♣........♣  #≈≈≈≈≈≈▓#..P....P...♣  #≈≈≈≈≈≈▓#♣.♣♣...ß.♣♣.ß...  #≈≈≈≈≈≈▓##......................  #≈≈≈≈≈≈▓▓#......... kit D #≈≈≈≈≈≈≈▓###........  #≈▓▓######################  ##................####⌠  #≈≈≈≈≈≈..##.ki ki %2ki? ki؇ kiin  ▓▓▓########''''############....................▓▓#..##.♣...♣♣..♣♣..♣♣#..♣♣..♣♣........♣.♣#♣♣..P....P..♣.♣♣...ß.♣♣.ß....##..................▓......##  #≈≈≈≈≈≈▓#....................#.. kiz ki{{ %3ki ki ki#≈▓###..................... #≈≈≈≈≈≈▓▓#... #≈≈≈≈≈≈▓##. #≈≈≈≈≈≈▓#..♣...♣♣ #≈≈≈≈≈≈▓#..♣♣..♣♣ #≈≈≈≈≈≈▓#....♣♣......♣ #≈≈≈≈≈≈▓#.♣♣........♣.♣ #≈≈≈≈≈≈▓#.♣♣..P....P...♣. #≈≈≈≈≈≈▓#......♣@♣♣...ß.♣♣.ß. #≈≈≈≈≈≈▓##............. #≈≈≈≈≈≈▓▓#.............. #≈###............ #≈▓▓####################### #≈≈≈≈≈≈▓▓##................####⌠. #≈≈≈≈≈≈▓##..... #≈≈≈≈≈≈▓#... #≈≈≈≈≈≈▓#.#.kik%ki%%4ki+ki-kib% ▓▓#..##...♣...♣♣...♣♣..♣♣.....♣♣......♣......♣♣........♣.♣.....♣♣..P....P..♣.♣♣...ß.♣♣.ß....♣#......@................▓≈▓###Fly  #≈≈≈≈≈≈▓#..ß.♣..........♣.ß..+...kiD kiki%5kix ki ki2≈≈≈≈≈≈▓##. ≈≈≈≈≈≈▓#.....♣...♣♣ ≈≈≈≈≈≈▓#......♣♣..♣♣ ≈≈≈≈≈≈▓#........♣♣......♣ ≈≈≈≈≈≈▓#...♣♣........♣.♣.. ≈≈≈≈≈≈▓#..♣♣..P....P...♣.♣ ≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß. ≈≈≈≈≈≈▓#.................. kiN3≈≈≈≈≈≈▓▓#. ≈### ≈▓▓######################## ≈≈≈≈≈≈▓▓##................####⌠.. ≈≈≈≈≈≈▓##..... ≈≈≈≈≈≈▓#... ≈≈≈≈≈≈▓#.#. ≈≈≈≈≈≈▓#..ß.♣ki3W♣.ß..+. ≈≈≈≈≈≈▓#...♣....+.ki:ki2<%6ki?ki@ki▓#..♣...♣♣♣▓#.......♣♣..♣♣▓#.........♣♣......♣▓#...♣♣........♣.♣..▓#..♣♣..P....P...♣.♣▓#......♣.♣♣...ß.♣♣.ß....♣..▓#..................▓▓#.###▓▓#########################▓▓##................####⌠...▓##.....▓#..ki.▓#.#.▓#..ß.♣♣.ß..+.▓#...♣....+.▓#........#.kiSkiӰ%7kiԷkiBki ▓#.♣...♣♣.♣▓#.............♣♣..♣♣.♣▓#...............♣♣......♣.▓#..........♣♣.♣.♣.▓#.........♣♣..P....P...♣.♣.♣▓#......♣.♣♣...ß.♣♣.ß....♣..♣▓##.▓▓#.▓###.▓▓#+▓▓##.####⌠.▓##.##.▓#.#.▓#.#.▓#..ß.♣.♣.ß..+.▓#...♣.♣...+.▓#.#.ki/ ki %8ki ki/ kim▓#.♣...♣♣.♣♣.▓#.............♣♣..♣♣.♣.▓#...............♣♣......♣.▓#..........♣♣........♣.♣.▓#...♣♣..P....P...♣.♣.♣P▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß▓##.▓▓#.▓###.▓▓#+▓▓##.####⌠.▓##.##.▓#.#.▓#.#.▓#..ß.♣.♣.ß..+.▓#...♣.♣...+.▓#.#.kiki%9ki0kiki▓#.♣...♣♣.♣♣.ß▓#...♣♣..♣♣.♣.P▓#...............♣♣......♣.▓#..........♣♣........♣.♣.▓#...♣♣..P....P...♣.♣.♣P.kiAk▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.▓##.▓▓#.▓###.▓▓#++#▓▓##.####⌠.▓##.##.▓#.#.▓#.#.kiko♣▓#..ß.♣.♣.ß..+.ß▓#...♣.♣...+.▓#.#.kikiki&90kiZki kiL96▓#.♣...♣♣.ki|9r♣♣.ß.▓#...♣♣..♣♣.♣.P.▓#.ki9B....♣♣......♣.ki9\▓#..........♣♣........♣.♣.▓#.ki9..♣♣..P....P...♣.♣.♣P.Pki9▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß▓##.▓▓#.ki:▓###.▓▓#ki5:8++#▓▓##.####⌠.▓##.kiS:-##.▓#.#.▓#.ki:'#.♣.▓#..ß.♣.ki:;♣.ß..+.ßP▓#...♣.♣...+.ki:,▓#.#.kiDkiE%1ki-LkiNkij▓#.♣...♣♣.♣♣.ß.ß ▓#....♣♣..♣♣.......♣.P.P ▓#.....♣♣......♣. ▓#.♣♣........♣.♣. ▓#.ki..♣♣..P....P...♣.♣.♣P.P. ▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß. ▓##. ▓▓#.▓###.▓▓#++# ▓▓##.####⌠. ▓##.kic##. ▓#.#. ▓#.#.♣.♣ ▓#..ß.♣.♣.ß..+.ki)bßP. ▓#...♣.♣...+.♣ ▓#.#.kiWki%2ki kiZki!#.♣...♣♣.♣♣.ß.ß. #....♣♣..♣♣.......♣.P.P. #.....♣♣......♣. #.♣♣........♣.♣. #.♣♣..P....P...♣.♣.♣P.P.P #......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß ##.#. ▓###. ▓▓#++###.####⌠. ##.##. #.#. #.#.♣.♣ #..ß.♣.♣.ß..+.ßP. #...♣.♣...+.♣ #.#.ki_ki%3kiki@ki޺.♣...♣♣.♣♣.ß.ß.ß ....♣♣..♣♣.......♣.P.P.P ki.....♣♣......♣. .♣♣........♣.♣. .kiHE♣♣..P....P...♣.♣.♣P.P.P. ......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß. #kiq!. #. ###.#ki#++# ##.####⌠. #ki,.##. .#. .ki8#.♣.♣♣. ..ß.♣.♣.ß..+.kiJ`ßP..P ...♣.♣...+.♣♣. .#.ki;4kikikiZ$♣...♣♣.ki♣♣.ß.ß.ß.kiЧe...♣♣..♣♣.......♣.P.P.P.kiD.....♣♣......♣.kic♣♣........♣.♣..ki♣♣..P....P...♣.♣.♣P.P.P.Pki/♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß kig.ki.#kiީ. kix #ki++# #.####⌠. .##.#.#.♣.♣♣.♣ .ß.♣.♣.ß..+.ßP..PßkiJ♣.♣...+.♣♣.#.kiki%5kizAPki♣...♣♣.♣♣.ß.ß.ß.ß..♣♣..♣♣.......♣.P.P.P.P...♣♣......♣..♣♣........♣.♣..♣♣..P....P...♣.♣.♣P.P.P.P.♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß. #.++######+ .####⌠.kiV##.#.#.♣.♣♣.♣. ß.♣.♣.ß..+.ßP..Pß. .♣.♣...+.♣♣.#.ki8ki-%6ki8bP....Pki/kie♣...♣♣.♣♣.ß.ß.ß.ß♣♣♣..♣♣.......♣.P.P.P.P♣...♣♣......♣..♣♣........♣.♣..ki♣♣..P....P...♣.♣.♣P.P.P.P.♣♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣ .++######+####⌠.##.#.#.ki 1♣.♣♣.♣. .♣.♣.ß..+.ki):ßP..Pß. ♣.♣...+.♣♣.kiG#.kiqki%7kiWki♣...♣♣.♣♣.ß.ß.ß.ß♣.♣♣..♣♣.......♣.P.P.P.P♣...♣♣......♣...♣♣........♣.♣...ki`♣♣..P....P...♣.♣.♣P.P.P.P.♣.♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣++######++#####⌠.##.#.#.ki♣.♣♣.♣. ♣.♣.ß..+.ßP..Pß. .♣...+.♣♣.#.kiCki$%8kiki=ki♣...♣♣.♣♣.ß.ß.ß.ß♣.♣♣..♣♣.......♣.P.P.P.P♣.♣kiP♣♣......♣....♣♣........♣.♣......♣♣..P....P...♣.♣.♣P.P.P.P.♣. .ki♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#ki:x####⌠.##.#.#.♣.♣♣.♣. .♣.ß..+.ßP..Pß.♣...+.kiY.♣♣.#.kikiz%9ki%Pki$ki1u♣...♣♣.♣♣.ß.ß.ß.ß♣..♣♣♣..♣♣.......♣.P.P.P.P♣.♣.♣♣......♣......♣♣.♣.♣.......ki♣♣♣..P....P...♣.♣.♣P.P.P.P.♣. ♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#ki#####⌠.##.#.kiN#.♣.♣♣.♣.♣.ß..+.ßP..Pß.♣...+.ki.♣♣.#.kiki%(9000kiAPkikiR♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣♣♣......♣.......♣ki]♣♣.♣.♣.......♣.♣♣..P....P...♣.♣.♣P.P.P.P.♣. ki.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#####⌠.⌠ki##.#.#.kiF♣.♣♣.♣.♣.ß..+.ßP..Pß.♣...+.ki.♣♣.#.kiki%1ki\PPkiykic♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣.......♣.♣♣.♣.♣.......♣. .♣♣..P....P...♣.♣.♣P.P.P.P.♣. ♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#####⌠.⌠#kic##.#.#.♣.♣♣.♣.♣.ß..+.ßP..Pß.♣...+.♣♣.#.kioki p%2kiP|,PkiC♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣......kiR♣.♣ .♣♣.♣.♣......♣. ♣♣..P....P...♣.♣.♣P.P.P.P.♣.kiA...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#####⌠.⌠###.#ki.#.##.♣.♣♣.♣.ki9=#♣.ß..+.ßP..Pß.+♣...+.kiY@♣♣.+#.#ki/ki%3kiHPPkikiM w♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣.....♣.♣. kiEN -♣♣.♣.♣....♣...P....P...♣.♣.♣P.P.P.P.♣. kikN ...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#kiN :####⌠.⌠###.##.kiN %#.#.♣.♣♣.♣.kiN /#.♣.ß..+.ßP..Pß.+.kiO <♣...+.♣♣.+.#.#.ki$O kiZ ki[ %4kia ,PPkic ki` ♣...♣♣.♣♣.ß.ß.ß.ß♣..♣....ß♣♣..♣♣.......♣.P.P.P.P♣.♣.♣...P♣♣......♣....♣.♣..♣.♣.....♣. kia 3..P....P...♣.♣.♣P.P.P.P.♣.♣ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#####⌠.⌠###.ki6a &##.#.#.#.kiZa :♣.♣♣.♣.#.♣.ß..+.ßP..Pß.kiva 2+.♣...+.♣♣.+.kia )#.#.kim kin %5kiu APki}  ...♣♣.♣♣.ß.ß.ß.ß♣..♣....ß. .♣♣..♣♣.......♣.P.P.P.P♣.♣.♣...P.♣♣......♣...♣.♣. .♣.♣...♣. .P....P...♣.♣.♣P.P.P.P.♣.♣ .ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.++######++#####⌠.⌠####.##.##.#.#.#.♣.♣♣.♣.#.ki2~ }♣.ß..+.ßP..Pß.+..#♣...+.♣♣.+..##.#..#kis ki %6ki) P.P.P.PP.P.Pki ki''........................................ki ki%7kiP.P.PP.Pki& kiL/_You reach down and open the large door.kiy2♣♣..♣♣.......♣.P.P.P.P♣.♣.♣...P ....♣♣......♣...............♣.♣. ♣........♣.♣...ki2wP....P...♣.♣.♣P.P.P.P.♣.......♣ ..ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣....... ......................... ###############'@######++######## ki.3w.......####⌠................⌠..##......................#...............#.♣.♣♣.♣.......#kiW3♣.ß..+.ßP..Pß.......+..♣...+ki}3...♣♣.........+.......#.....#..ki3+.#.#..ki>AkiHB%8kiHBPki)KV _There is a large open door here.ki...♣♣......♣...............♣.♣. ♣♣........♣.♣.....P....P...♣.♣.♣P.P.P.P.♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.................................................... ################''######++####### ........####⌠...@............⌠..##......#ki8..#♣.♣♣.♣.#♣.ß..+.ßP..Pß.+..♣...+...♣♣..kifu.+.....#...#.#ki`..# #####.♣...##⌠⌠##kiki ,9 _kiP.P.P.PPkiki̲ ♣♣........♣.P....P...♣.♣.♣P.P.P.P.♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣........................................... #################''######++###### .........####⌠................⌠..##......#..#♣.♣♣.♣.#♣.ß..+.ßP..Pß.+..♣...+...♣♣..+.....#...#.#....# ######.♣...##⌠...⌠## W[####..♣..##########++##########ki ki &10kin P.P.Pkiu ki  ♣♣..P....P...♣.♣.♣P.P.P.P.♣......ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣ ................................. #################''######++###### .........####⌠................⌠kiZ %.##.....♣.♣♣.♣♣.ß..+ßP..Pß+.Fly ki~ #########++# ?$#:.#.♣...##..................## ki ki %1ki kiy ki3 kiz...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣ .............................ki"L. #################''######++###### ki@.........####⌠................⌠.##..ki]0...♣.♣♣.♣kiy[♣.ß..+ßP..Pßki+.♣.kiL..♣♣...kiGFly  ki..$.##♣♣...#..........#####.....# kikih*;2ki2BPki4ki_.............................. ##################''######++##### ..........####⌠................⌠..##......#..#♣.♣♣.♣kif`.♣.ß..+.ßP..Pß...♣...+...♣♣.......#....#. #######.♣...##⌠ki`v⌠ #W[####..♣..##########++####### ki`l#?$#:.#.♣...##.................. ki`u$..$.##♣♣...#####.....ki`>....#.♣...#..##......#...#..PP.kilki_m%3kitkiwki)J. ###################''######++#### ...........####⌠................⌠..##.....#.#kiv*♣.♣♣.♣♣.ß..+.ßP..Pß..♣...+...♣♣......#ki<...# kiP########.♣...##⌠⌠kilW[####..♣..##########++####### ki$#?$#:.#.♣...##.................. $$..$.##♣♣...ki9#####.... .......#.♣...#..##......#...#..PPki;9#..♣..#..#..''..###.###.PPkiOki8%4ki%Pkiki....######''######++.####⌠..##.#ki *.#.♣.♣♣.♣.♣.ß..+.ßP..Pß.♣...+.♣♣.#kiEh.##.♣...##⌠kihE.#W[####..♣..#ki#++ Z$#?$#:.#.♣...## #$$..$.##♣♣...#.#####.#.♣...#..##......#...#.. #......##..♣..#..#..''..###.###.kiki%5kiAPkikia ....######''######++.####⌠.##.#.#.♣.♣♣.♣.♣.ß..+.ßP..Pß.♣...+.♣♣.#.#ki y#.♣...##⌠#W[####..♣..###++ #Z$#?$#:.#.♣...## ##$$..$.##♣♣...#.##### ki f#.#.♣...#..##......#...#.. ##......##..♣..#..#..''..###.###.ki ki %6ki ki7 ki`T/####....#.................♣.ß..'♣...'kiT...........#.♣.#..#.#ki*`ki`%7ki8lkin= _You reach down and open the large door.ki0F ....##########''######++#.####⌠..##..#.#.♣.♣♣.♣.♣.ß..'.ßP..Pß.kiF ♣...'.♣♣.#...#..♣...##⌠.W[####..♣..###++# kiF Z$#?$#:.#.♣...##. #kiF s$$..$.##♣♣...#.#####. kiF P.#.♣...#..##......#...#..P #......##..♣..#..#..''..###.###.Pki G kiS ;8kiZ kiV] kiJ....##########''######++#..####⌠.⌠..##..#.#.♣.♣♣.♣.♣.ß..'.ßP..Pß.♣...'.♣♣.#.kiO...#..♣...##⌠.⌠W[####..♣..##++# $#?$#:.#.♣...##. $$..$.##♣♣...#.#####.#.♣...#..##......#...#..P ......##..♣..#..#..''..###.###.PkikiU%9ki kiT#kiJN....#####''######++#####⌠.⌠#..##...#...#.kiCKW♣.♣♣.♣.♣.ß..'.ßP..Pß.♣...'.♣♣.#....#.kipK.♣...##⌠.⌠# #W[####..♣..##++# kiKe#?$#:.#.♣...##.#ki Lp..$.##♣♣...#.#####.#.♣...#..##......#...#..PP.ki/L;##..♣..#..#..''..###.###.PP.kiXkiY&20kiOakickiW....#####''######++#####⌠.⌠###..#..#..##.♣.♣♣.♣.#♣.ß..'.ßP..Pß.+♣...'.♣♣.+#.##.#kiW.♣...##⌠.⌠# W[####..♣..##++# ?$#:.#.♣...##.# ..$.##♣♣...#.#####.....##.♣...#..##......#...#..PP.###..♣..#..#..''..###.###.PP.#kicki7d%1kihAPkijkim) ################''######++####### ........####⌠................⌠#.....#.#..#.ki)♣.♣♣.♣#.♣.ß..'.ßP..Pß.+.ki)..'..♣♣...+....#....ki*Q#..#.#. ki4*E#####.♣...##⌠⌠##. kiR*[####..♣..##########++##########. $#:.#.♣...##..................##. kiq*?.$.##♣♣...#..ki*#####.ki*'..#.♣...#..###...#..PP.#.ki*x##..♣..#..#..''..###.###.PP.#.Z#..♣..#.....'#..#.._..#....#.ki76ki6%2ki>NP_ki@kiLJ ###############''######++######## .......####⌠................⌠#.......##.#.....#..#.♣.♣♣.♣.#.♣.ß..'.ßP..Pß.+...'..♣♣...+....#...kiG 5#.#.#. ####.♣...##⌠⌠##...♣..##########++##########. #:.#.♣...##..................##..##♣♣...#..#####ki V. ...#.♣...#..###...#..PP.#.##..♣..#..#..''..###.###.PP.#.ki Z#..♣..#.....'#..#.._..#....#. +###.♣...#.........###'###....#.ki kic %3ki ki _ki+ ki ki *......####⌠................⌠####...............##........#..#.♣.♣♣.♣#.♣.ß..'.ßP..Pß.......+..#..'..♣♣...+..#...#...#..##.#. ###.♣...##⌠⌠##...♣..##########++##########. :.#.♣...##..................##..# .##♣♣...#..#####..# ..#.♣...#..###...#..PP.#..# .##..♣..#..#..''..###.###.PP.#..# .Z#..♣..#.....'#..#.._..#....#. ###.♣...#.........###'###....#. ........#...###....#...#..'..#.ki ki %4ki 8_kiٹ kilR####⌠.⌠####.##.............##.#.............#.#.♣.♣♣.♣.#.♣.ß..'.ßP..Pß.+..#♣...'.♣♣.+..#♣#.#..##.#..♣...##⌠.⌠##...♣..#++#. .#.♣...##.##..# ##♣♣...#.#####.....#..#. .#.♣...#..##......#...#..PP.#..#. ##..♣..#..#..''..###.###.PP.#..# Z#..♣..#.....'#..#.._..#....#..♣...#.###'###....#.#...###....#...#..'..#.ki~UkiNV%5ki\8_ki_kiYA''......#####.#...####.##.##ki`ki`%6ki=g:_kij= _You reach down and open the large door.ki .....##..............#..#.♣.♣♣.♣.#. .♣.ß..'.ßP..Pß.+..##ki= ..'..♣♣...+..#♣....#...#..##.#.#..... #.♣...##⌠⌠##. #..♣..##########@'##########. #ki_ L.♣...##..................##..## #♣♣...#..........#####.....#..#.. #.♣...#..##......#...#..PP.#..#. ki '#..♣..#..#..''..###.###.PP.#..# #..♣..#.....'#..#..§..#....#..... ki #.♣...#.........###'###....#. ......#...###....#...#..'..#.#.###z###..##'##.....#..##ki" ki %7kiW UP§ki5 / _Found a shimmering altar of Xom.ki V _There is a large open door here.kiŋb####⌠⌠####............##.......#. .....#.♣.♣♣.♣.#..... ♣.ß..'.ßP..Pß+..##. .♣...'.♣♣+..#♣.#.#..## .....#....#. .♣...##⌠........@.......⌠##. ..♣..##########''##########..... .♣...##..................##..# ♣♣...#..........#####.....#..#. .♣...#..##......#...#..PP.#..#.. ..♣..#..#..''..###.###.PP.#..## ..♣..#.....'#..#..§..#....#. .♣...#.........###'###....#.#...###....#...#..'..#.....kiki,8 _kiYP§kirki##########''######++#################⌠..........⌠####............##..............#. ....#.♣.♣♣.♣.#..... .ß..'.ßP..Pß+..##. ♣...'.♣♣+..#♣.#.#..##..# ....#....#......# ♣...##⌠................⌠##......###########''##########......#...#.............##..##..+ ♣...#..........#####.....#..#...+ ♣...#..##......#...#..PP.#..#...+♣..#..#..''..###.###.PP.#..##..+#.....'#..#..§..#....#......# ♣...#.........###'###....#......#ki#kiP%9kikikiOO................................. #########''######++############## .####⌠.........⌠####.....##..............#. ...#.......♣.♣♣.♣.#..... ß..'.......ßP..Pß+..##.'.♣♣+..#♣....#.#..##..# ...#....#......#. ...##⌠................⌠##......#.##########''##########......#. ...#........##..##..+. ...#..........#####.....#..#...+. ...#..##......#...#..PP.#..#...+. ♣..#..#..''..###.###.PP.#..##..+.#.....'#..#..§..#....#......#.kigkiD&30kiokiki! o ................................. ########''######++############### ####⌠..........⌠####........##.......#. ..#.♣.♣♣.♣.#.....'.ßP..Pß+..##.kiu" x'.........♣♣+..#♣.....#.#..##..####....#......#.ß ..##⌠................⌠##......#.W##########''##########......#.#........##..##..+.#..........#####.....#..#...+. ..#..##......#...#..PP.#..#...+. ki" c..#..#..''..###.###.PP.#..##..+.ki`- ki3. %1ki3 ki5 kiC  .................................###''######++################ ###⌠................⌠### ##..## .#.ki6D .......#. .#.♣.♣♣.♣.#..... .'.kiWD dßP..Pß+..##. .'.ki|D L♣♣+..#♣...... .#.kiD #..##..#### .#....#......#.ß?kiD ##⌠................⌠##......#.W .##########''##########......#. .#kiD ?........##..##..+. .kiCE #..........#####.....#..#...+. .#..##......#...#..PP.#..#...+.kiP kiQ %2kiiX rP..PkiRZ kil6~''######++######⌠.⌠####. #...##. #...#. #.♣.♣♣.♣.#. ki7'.ßP..Pß.+..##. '.♣♣.+..#♣. #.#..##..# #.#......#.ß?$ ##⌠.⌠##......#.W. #''#kiV7m#......#...W ##..##..##..+. #.kiz7#####.....#..#...+. #..##......#...#..PP.#..#...+.ki@kiGA%3kiAG%Pki{Iki ''######++###### #⌠.⌠####. .##. ...#. .♣.♣♣.♣.#. .ßP..Pß.+..##. .♣♣.+..#♣. .#..##..# .#......#.ß?$# #⌠.⌠##......#.W..ßki .''##......#...W. #...##..##..+. ..#####.....#..#...+. ..##......#...#..PP.#..#...+.ki kiO %4ki% ki7( ki5 ''######++###### ⌠.⌠####.##.#.ki"6 ♣.♣♣.♣.#.ßP..Pß.+..##.♣♣.kiJ6 f+..#♣.#..##..######.kio6 #......#.ß?$# ⌠.⌠##......#.W..ß#''#ki6 P#......#...W.) ..ki6 ##..##..+.....♣#####.....#..#...+. .ki{7 e##......#...#..PP.#..#...+.....⌠ki@ ki_A %5kiJ kiM ''######++###### .⌠####.##.#.♣.♣♣.♣.#.ßP..Pß.+..##.♣♣.+..#♣.#..##..######.kiM #......#.ß?$##. .⌠##......#.W..ß#''##......#...W.)###..##..+.....♣######.....#..#...+......# ##......#...#..PP.#..#...+.....⌠#kiY kiZ %6ki` ki_c ki ''######++######⌠####.##.#.♣.♣♣.♣.#.ßP..Pß.+..##.♣♣.+..#♣.#..##..######.#......#.ß?$##.⌠##......#.W..ß##.''###......#...W.)#.##..##..+.....♣#.#####.....#..#...+......#. #......#...#..PP.#..#...+.....⌠#.ki ki %7ki ki` kiw# ^##..................ki# '..#'..#..#..............##....ki/. kiB/ %8ki{5 kik8 = _You reach down and open the large door.ki i''######++###########⌠####..##..#..♣.♣♣.♣.#.ßP..Pß...##.♣♣.'..#♣.#..##..######.ki #......#.ß?$##.⌠##......#.W..ß##.''###......#...W.)#.##..##..+.....♣#.#####.....#..#...+......#. kib e......#...#..PP.#..#...+.....⌠#.kiM ki %9ki ki+ 3 _Found a huge runed translucent gate.kib V _There is a large open door here.kiW} ''######++####################### ki.............⌠####................##..#........kiL♣.♣♣.♣#........kitßP..Pß.'..##....#.♣♣...kiݹm'@.#♣.♣..ki#..##..######....#.#......#.ß?$kiT⌠##......#.W..ß ki3####''##########......#...W.)#. kiO5..............##..##..+.....♣#..######.....#..#...+......#.kis#...#..PP.#..#...+.....⌠#. ''..###.###.PP.#..##..+.....♣#..#kikiL-40 _kiki ki # '######++######################## ............⌠####.................##........#......... .♣.♣♣.♣#....... .ßP..Pß.'..##.##.♣♣...ki؍'..#♣.♣..........#.@##..######....##.....#......#.ß?$....⌠##......#.W..ß ki###''##########......#...W.)#. .............##..##..+.....♣#..#######.....#..#...+......#.kic^W   jimo's ghost (dormant)#...#..PP.#..#...+.....⌠#...# '..###.###.PP.#..##..+.....♣#..## #..#..§..#....#......#...W..#....kieki%1kikiP[ _You encounter jimo's ghost.ki ######++######################## ...........⌠####.................##.........#.......... ♣.♣♣.♣#.......... ßP..Pß.'..##......## ..♣♣.........'..#♣.....♣#...........#..##..######....##.#..@...#.ß?$..⌠##......#.W..ß ##''##########......#...W.)#. ............##..##..+.....♣#..#######.....#..#...+......#...#.#...#..PP.#..#...+.....⌠#...#.###.###.PP.#..##..+.....♣#..##. ..#..§..#....#......#...W..#..... ..###'###....#......#.W..ß##.ki ki, %2ki ki ki\ ............⌠####.....................##........#...♣.♣♣.♣.......#... .ßP..Pß.......'..#### ...♣♣.........'..#♣.♣#.....#..##..######....##.#......#.ß?$##....⌠##.@....#.W..ß## ###''##########......#...W.)# .............##..##..+.....♣#..#######.....#..#...+......#...#.#...#..PP.#..#...+.....⌠#...# '..###.###.PP.#..##..+.....♣#..## ki"^ /#..#..§..#....#......#...W..#....###'###....#......#.W..ß##..#...#..'..#......#[ß?)kik kiSl %3ki4t kiv ki/u........#...♣.♣♣.♣.......#....ßP..Pß.......'..### ....♣♣...'..#♣.♣...#..##..######.....#......#.ß?$##....⌠##......#.W..ß## ####''##########@.....#...W.)# ..............##..##..+.....♣#..######.....#..#...+......#....#...#..PP.#..#...+.....⌠#... ''..###.###.PP.#..##..+.....♣# '#..#..§..#....#......#...W..#... ....###'###....#......#.W..ß##...kivO  #....#...#..'..#......#[ß?)  ###..##'##.....#..##..##### kiki%4kikiki[+ .♣.♣♣.♣..ßP..Pß'..##...#..♣♣..♣..♣..#..##..######....#....#.ß?$##....⌠##.W..ß## ####''########..W.) ki+..............##@.##..+.....♣#..######.....#..#...+......#......#..PP.....⌠Fly .#..##. #!#............#..#♣............♣ ki9kiA:%5kiAkiCki!VM ♣.♣♣.♣ßP..Pß'..##..#..♣♣..♣.♣..#..##..######....#....#.ß?$##....⌠##.W..ß## ####''########..#...W.) kiV..............##..##..+.....♣#..######.....#@.#..#......#..PP⌠ ''..###.####♣#..#Fly ..kiV #..#♣... +(+......###...#..##............# kibki8c%6ki;jkilki: 6 ßP..Pß'..###..♣♣..♣....♣..#..##..######....#....#.ß?$##....⌠##......#.W..ß## ####''##########......#...W.) ..............##..##..+.....♣#..######.....#..#..#......#..PP⌠ ''..###.###ki #♣#..# '#..#..§..#....#......#...W..#.....Fly .##.#..##.... #)#....###.###.#................. ki ki} %7ki ki" ki  ..♣♣..♣♣..#..##..######....#....#.ß?$##....⌠##......#.W..ß## ####''##########......#...W.) ..............##..##..+.....♣#..######.....#..#..#......#..PP⌠ ''..###.####♣#..# '#..#..§..#....#......#...W..#... ....###'##kiY 1..#.W..ß#Fly #........ ###....#.#.#.#.#................. ki ki %8ki} ki I _Found a scale mail. kip  ..#..##..######....#....#.ß?$##....⌠##......#.W..ß## ####''##########......#...W.) ..............##..##..+.....♣#..######.....#..#..#......#..PP.....⌠ ''..###.####..+.....♣#..# ' kipA#..#..§..#....#@.....#...W..#... ....###'##W..ß# #....#...#..'#[ß?)##.Fly ...#... #......'.'_..'.##................  ki+z kiqz%9 ki+:_ ki ki7  kiy The Necropolis∩∩∩∩_____(Press ? for help)#≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##########.♣...##⌠................⌠##......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..$.##♣♣...#..........#####.....#..#...+......#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..' kiҎ '..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#@.....#...W..#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_+(+......###...#..##............##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓▓##................###............#.#.#.#.###................##▓▓≈≈≈≈≈≈##≈≈≈≈≈≈≈▓▓##################▓#.....##'##..###.###.#▓##################▓▓≈≈≈≈≈≈≈##≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓#..'..#...#....###...#▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈≈≈≈≈[?7l#[?7h ki L@. kiI:.. ki^:.# ki:#. ki:.. ki:.. kim:.. ki:.. ki[5.. kia D.. kiA.. kiRfA.. kiA.. kiA#. ki A)# ki# A.) ki AW. kiTu AnthonyDPS's ghost. The apparition of AnthonyDPS the the Slicer, a novice Kobold Enchanter of Ru. Max HP: 47 Will: ++ AC: + EV: +++  kiu  rF: ...  rC: +.. rPois: ∞ rNeg: ∞ rElec: . Threat: Lethal Class: Undead Size: Medium Int: Human  kiov You have about 98% to hit with your +0 dagger of protection and 100% to hit withyour grab and squeeze (while incapacitated). It has about 63% to hit you. Attack Max Damage Hit 6  kiv It has a 12% chance to notice you each turn. It is immune to torment; and resistant to miasma and drowning. It is insubstantial and immune to ensnarement. It can fly. It can open doors.  ki:w [!]: Description|StatuseskiThe Necropolis∩∩∩∩_____(Press ? for help)#≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##########.♣...##⌠................⌠##......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..$.##♣♣...#..........#####.....#..#...+......#...#..#▓≈≈≈≈≈≈#ki#≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..''..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#@.....#...W..#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈#ki9|#≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_+(+......###...#..##............##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈#kib #≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈#ki#≈≈≈≈≈≈▓▓##................###............#.#.#.#.###................##▓▓≈≈≈≈≈≈##≈≈≈≈≈≈≈▓▓##################▓#.....##'##..###.###.#▓##################▓▓≈≈≈≈≈≈≈#ki#≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓#..'..#...#....###...#▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈≈≈≈≈[?7l#[?7hkiE<W.kiI=.ßkijB=ß#ki<#.ki<..kiey<..ki7..ki 7..ki& 7..ki{u 7..ki' 7#.kiaC 7.#ki7#.kin7##kiϚ7##ki7.#kikC7#.ki/7##kiW7##kinf7.#ki7..ki57..kiO7..kiki? #.kiki67)#kiA#)kiV7!#ki<!#kiA##ki A[#kiR N[[ki>Kz[kiL kic ...............#..##..######....# ludeguy the Toxicologist ...............#......#.ß?$##.... Octopode of Gozag Gold: 1017 .............⌠##......#.W..ß##... Health: 71/71 ======================== ####''##########......#...W.)#... Magic: 16/16 ======================== ..............##..##..+.....♣#..# AC: 3Str: 13 kiź U.....#####.....#..#...+......#... EV: 15Int: 20 .....#...#..PP.#..#...+.....⌠#... SH: 0Dex: 21 ''..###.###.PP.#..##..+.....♣#..# XL: 10 Next: 25% Place: a Necropolis ki7 o'#..#..§..#....#@.....#...W..#... Noise: ---------  Time: 9049.1 (0.0) ....###'###....#......#.W..ß##... c) +0 dagger (protect) #....#...#..'..#......#[ß?)##.... Cast: Poisonous Vapours ###..##'##.....#..##..######....# Fly #!#............#..#♣............♣ kia +(+......###...#..##............#  ki #)#....###.###.#.................  ###....#.#.#.#.#.................ki   #......'.'_..'.##................  _There is a large open door here. ki _You reach down and open the large door. _Found a huge runed translucent gate. _There is a large open door here. ki 6_You encounter jimo's ghost. ki# Q_Found a scale mail.ki8 kij ki ki˺ }....#.ß?$##....⌠##......#.W..ß## ####''########..W.) ..............##..##..+.....♣#..#ki 9#####.....#..#...+......#......#..PP.+.....⌠ ''..###.####..♣#..# 'ki> #..#..§..#....#......#...W..#... ....###'##W..ß# ki #....#...#..'#[ß?)##. #ki S##..##'##.....#..##..######....# #!#.......♣............♣ +(+####...# ki p#)#....###.###.#........ki. . ##ki@ .#.#.. #kie n......'.'_..'.##... .kiw (#.#.#.#.###kiJ ki +50.1 (1ki) 8_kia kia  ⌠#W..ß## ####''########..W.) ..............##..##..+.....♣#..######.....#..#...+......#......#..PP.⌠ ''..###.###ki%2kiFkiHkiE\MP.P.P.P.♣.♣♣..♣♣.. ♣ß.ß.ß.ß.♣♣♣♣...♣ ................................. ''######++#######################⌠#####......♣.♣♣.♣.......#.....ßP..Pß.......'..##...# ....♣♣.........'..#♣............♣ Fly ....ki\#... ...##..##.kih;3ki-okiqkiRki#SkiYkibki1ckiikirkirkiyki{ki8ki9kin@kilBki<...........♣......♣♣... P.P.P.P.♣.......♣♣..♣♣... ß.ß.ß.ß.♣♣♣♣...♣ ................................ '######++########################⌠###......#.ki♣.♣♣.♣.#...... .ßP..Pß'..##..##♣♣'..#♣............♣#..##..######....##kiCk.#......#.ß?$##.. ............⌠##......#.W..ß##. ###''##########......#...W.)#....kiki%4ki$kiSkiJ ♣P.P.P.P.♣.......♣♣..♣♣ ♣ß.ß.ß.ß.♣♣........♣♣...♣ ................ ''######++###################### .............⌠####...................♣.♣♣.♣.#.ßP..Pß.'..### ....♣♣..'..#♣..♣...#..##..######.....#......#.ß?$##....⌠##......#.W..ß## kiK ####''##########......#...W.)# ..............##..##..+.....♣#..#ki(#''######++.####⌠.......⌠.##......##.#....#.#.♣.♣♣.♣.#.♣.ß..'.ßP..Pß.'.♣...'.♣♣.'.#.#.#.##.♣...##⌠.⌠## [####..♣..##''# $#:.#.♣...##..## .$.##♣♣...#.#####.....#.#.♣...#..##......#...#..PP.#.##..♣..#..#..''..###.###.PP.#.Z#..♣..#.....'#..#..§..#....#+###.♣...#.###'###....#"kiK"kiZL%2"kiT"kiV"kiL #''######++.####⌠.......⌠.##........#"kiVL ....#.#.♣.♣♣.♣.#"kiL :.♣.ß..'.ßP..Pß.'.♣...'.♣♣.'.#.#.#"kiL T.##.♣...##⌠.⌠## "kiL nW[####..♣..##''# "kiM [?$#:.#.♣...##"ki,M N...## ..$.##♣♣...#"kizM .#####.....#.#.♣...#..##......#...#..PP.#.##..♣..#..#..''..###.###.PP.#.Z#..♣..#.....'#..#..§..#....#+###.♣...#.###'###....#"kiM "ki\ ;3"ki e rP..P"kig "ki= E#''######++.####⌠..⌠..##....#.....#"ki 8.♣.♣♣.♣..♣.ß..'.ßP..Pß..♣...'.♣♣."ki .#..#.#.♣...##⌠"kiۧ G.⌠ #W[####..♣..#"ki #'' #?$#:.#.♣...##."ki0 . $..$.##♣♣...#.#####......#.♣...#..##......#...#..PP."kiX .##..♣..#..#..''..###.###.PP..Z#..♣..#.....'#..#..§..#....+###.♣...#.###'###...."kiw "kid ;4"ki %P"kig #ki?:#''######++..####⌠..⌠..##...#..#.♣.♣♣.♣.♣.ß..'.ßP..Pß.♣...'.♣♣#ki.#.##.♣...##⌠.⌠ ##W[####..♣..##'' $#?$#:.#.♣...##.$..$.##♣♣...#.#####.#.♣...#..##......#...#..PP.##..♣..#..#..''..###.###.PP.Z#..♣..#.....'#..#..§..# #++++###.♣...#.###'###5#kii##''######++.####⌠..##.#.#.♣.♣♣.♣.♣.ß..'.ßP..Pß.♣...'.♣♣.#.##.♣...##⌠.#W[####..♣..##'' Z$#?$#:.#.♣...## #$$..$.##♣♣...#.#####.#.♣...#..##......#...#.. #......##..♣..#..#..''..###.###. Z......Z#..♣..#.....'#..#..§..# ##++++###.♣...#.###'####ki\1#ki2%6#ki9#ki;#ki/#''######++....####⌠.....##......#......#.♣.♣♣.♣.♣.ß..'.ßP..Pß.♣...'.♣♣.#.##.♣...##⌠#W[####..♣..###'' #Z$#?$#:.#.♣...## ##$$..$.##♣♣...#.##### #.#.♣...#..##......#...#.. ##kix0#......##..♣..#..#..''..###.###. #Z......Z#..♣..#.....'#..#..§..##++++###.♣...#.###'####kiO;#ki;%7#kiB#kiD#kiW3#ki?#ki#ki #####################''######++## ludeguy the Toxicologist #ki .............####⌠............... Octopode of Gozag Gold: 1017 ..............##................. Health: 71/71 ======================== ...............#................. Magic: 16/16 ======================== #ki ...............#.......♣.♣♣.♣.... AC: 3Str: 13 #ki ..........♣.ß..'.......ßP..Pß.... EV: 15Int: 20 #ki ...........♣...'.........♣♣...... SH: 0Dex: 21 ...............#................. XL: 10 Next: 25% Place: a Necropolis #ki t...............#@................ Noise: ---------  Time: 9097.1 (0.0) ##########.♣...##⌠............... c) +0 dagger (protect) ####W[####..♣..##########''###### Cast: Poisonous Vapours #ki- #Z$#?$#:.#.♣...##................ Fly ##$$..$.##♣♣...#..........#####.. #........#.♣...#..##......#...#..  ##......##..♣..#..#..''..###.###.#ki[ ~  #Z......Z#..♣..#.....'#..#..§..#.  #ki ###++++###.♣...#.........###'###. Press: ? - help, . - travel#ki KYou can't see that place. _[a stone wall.] #ki _There is a large open door here.  Press: ? - help, v - describe, . - travelThe floor.#kik F#@A stone wall.$ki.#  You can't see that place. _[a stone wall.] _There is a large open door here.  Press: ? - help, . - travel  You can't see that place.  [the floor.]$ki.|7..$kiP7..$kiW7..$ki37..$ki?7..$ki( W.#a stone wall.]$ki] ;##%ki #:, g - get itemStash: the Folio of Malignant Secrets]  %kiL[the floor.]%ki The Folio of Malignant Secrets. A book of magic spells. It is an ancient artefact. %kiC Stash search prefixes: {artefact} {artifact} {book} Menu/colouring prefixes: identified spellbook book  SpellsTypeLevel Known %kie Z a - Grave ClawNecromancy2 no %ki z b - Curse of AgonyNecromancy5 yes %ki GSelect a spell, or (g)o to location.&kiS2Grave Claw Calls forth the spite of the recently dead to skewer a targeted enemy with shards of bone. This spell never misses, and will pin its target in place for several turns, but casting it rapidly consumes the remnants of death that lingerupon the caster. You can stockpile enough malice to cast this spell at most three times, and thiscan only be replenished by causing the death of a sufficient number of living beings. Level: 2 School: Necromancy Fail: 8%  Power: 8% Damage: 2d7 (max 2d14)  Range: 4  Noise: Quiet Miscasting this spell causes magic contamination. This spell would have no effect right now because you can't see any hostile targets that would be affected.'ki  The Folio of Malignant Secrets. A book of magic spells. It is an ancient artefact. Stash search prefixes: {artefact} {artifact} {book} Menu/colouring prefixes: identified spellbook book  SpellsTypeLevelKnown  a - Grave ClawNecromancy2 no  b - Curse of AgonyNecromancy'kiJ W5 yes Select a spell, or (g)o to location.(ki0Curse of Agony Curses a foe, halving their remaining health after each of the next two times that the caster strikes them in melee. Level: 5School: Necromancy(ki0NFail: 77% Power: 4% Range: 3 Noise: A bit loud (ki0Miscasting this spell causes magic contamination and also deals up to 38 draining damage. This spell would have no effect right now because you can't see any hostile (ki1<targets that would be affected. _________________ (ki=1“Unbearable, isn't it? The suffering of strangers, the agony of friends. There  is a secret song at the center of the world, Joey, and its sound is like (ki\1m razors through flesh.”  -Pinhead, _Hellraiser 3: Hell on Earth_. 1992. (ki The Folio of Malignant Secrets. A book of magic spells. It is an ancient artefact. (ki@ Stash search prefixes: {artefact} {artifact} {book} Menu/colouring prefixes: identified spellbook book  Spells Type(kii ELevelKnown  a - Grave Claw(ki *Necromancy2 no (ki \ b - Curse of AgonyNecromancy5 yes (kiƸ GSelect a spell, or (g)o to location.)ki}#####################''######++## ludeguy the Toxicologist .............####⌠............... Octopode of Gozag Gold: 1017 ..............##................. Health: 71/71 ======================== ...............#................. Magic: 16/16 ======================== ...............#.......♣.♣♣.♣.... AC: 3Str: 13 ..........♣.ß..'.......ßP..Pß.... EV: 15Int: 20 ...........♣...'.........♣♣...... SH: 0)ki$Dex: 21 ...............#................. XL: 10 Next: 25% Place: a Necropolis ...............#@................ Noise: ---------  Time: 9097.1 (0.0) ##########.♣...##⌠............... c) +0 dagger (protect) ####W[####..♣..##########''###### Cast: Poisonous Vapours #Z$#?$#:.#.♣...##................ Fly ##$$..$.##♣♣...#..........#####.. #........#.♣...#..##......#...#..)kiL  ##......##..♣..#..#..''..###.###.  #Z......Z#..♣..#.....'#..#..§..#.)kio  ###++++###.♣...#.........###'###.  _[a stone wall.] )ki_There is a large open door here.  Press: ? - help, . - travel, g - get itemYou can't see that place.  [Stash: the Folio of Malignant Secrets]  )ki[the floor.]*ki#####################''######++## ludeguy the Toxicologist .............####⌠............... Octopode of Gozag Gold: 1017 ..............##................. Health: 71/71 ======================== *ki...............#................. Magic: 16/16 ======================== ...............#.......♣.♣♣.♣.... AC: 3Str: 13 ..........♣.ß..'.......ßP..Pß.... EV: 15Int: 20 ...........♣...'.........♣♣...... SH: 0Dex: 21 *kiŬ...............#................. XL: 10 Next: 25% Place: a Necropolis *ki...............#@................ Noise: ---------  Time: 9097.1 (0.0) ##########.♣...##⌠............... c) +0 dagger (protect) *ki####W[####..♣..##########''###### Cast: Poisonous Vapours *kiOy#Z$#?$#:.#.♣...##................ Fly ##$$..$.##♣♣...#..........#####.. #........#.♣...#..##......#...#..*kiz  ##......##..♣..#..#..''..###.###.  #Z......Z#..♣..#.....'#..#..§..#.*ki  ###++++###.♣...#.........###'###.  *kiT_[a stone wall.] _There is a large open door here.  *ki߭pPress: ? - help, . - travel, g - get itemYou can't see that place.  *ki:[Stash: the Folio of Malignant Secrets]  [the floor.]*ki*kiӺD _*ki[]3*ki`*kib*ki*kiD*ki%*ki 3*kiY +kihG#####################''######++## ludeguy the Toxicologist .............####⌠............... Octopode of Gozag Gold: 1017 ..............##................. Health: 71/71 ======================== ...............#................. Magic: 16/16 ======================== ...............#.......♣.♣♣.♣.... AC: 3Str: 13 ..........♣.ß..'.......ßP..Pß.... EV: 15Int: 20 +kiai...........♣...'.........♣♣...... SH: 0Dex: 21 ...............#................. XL: 10 Next: 25% Place: a Necropolis ...............#@................ Noise: ---------  Time: 9097.1 (0.0) ##########.♣...##⌠............... c) +0 dagger (protect) ####W[####..♣..##########''###### Cast: Poisonous Vapours #Z$#?$#:.#.♣...##................ Fly ##$$..$.##♣♣...#..........#####.. #........#.♣...#..##......#...#..  ##......##..♣..#..#..''..###.###.+kiie  #Z......Z#..♣..#.....'#..#..§..#.  ###++++###.♣...#.........###'###. Press: ? - help, . - travel, g - get itemYou can't see that place.  +kiia[Stash: the Folio of Malignant Secrets] _[the floor.]  +kijaPress: ? - help, v - describe, . - travelThe floor.+kiEF#@A stone wall.,ki.#  You can't see that place.  [Stash: the Folio of Malignant Secrets] _[the floor.,ki]  Press: ? - help, . - travelYou can't see that place.  [the floor.],ki%7..,kiE7..,ki7..,kix7..,kis7..,kia7..,kic7..,ki"7..,kiV.#a stone wall.],kiQ;##,ki ;##-ki2 #$, g - get itemStash: 15 gold pieces]  [the floor.]-ki( .$the floor.]-kiq $., g - get itemStash: 15 gold pieces]  [the floor.].kin?$a scroll labelled JAPLUIM XUZXY].kiF: #?a stone wall.].ki#$, g - get itemStash: 12 gold pieces]  [the floor.]/kiO$$1/ki [$$90kiS#####################''######++## ludeguy the Toxicologist .............####⌠............... Octopode of Gozag Gold: 1017 ..............##................. Health: 71/71 ======================== ...............#................. Magic: 16/16 ======================== ...............#.......♣.♣♣.♣.... AC: 3Str: 13 ..........♣.ß..'.......ßP..Pß.... EV: 15Int: 20 ...........♣...'.........♣♣...... SH: 0Dex: 21 ...............#................. XL: 10 Next: 25% Place: a Necropolis ...............#@................ Noise: ---------  Time: 9097.1 (0.0) 0ki##########.♣...##⌠............... c) +0 dagger (protect) ####W[####..♣..##########''###### Cast: Poisonous Vapours #Z$#?$#:.#.♣...##................ Fly ##$$..$.##♣♣...#..........#####.. #........#.♣...#..##......#...#..  ##......##..♣..#..#..''..###.###.  #Z......Z#..♣..#.....'#..#..§..#.  ###++++###.♣...#.........###'###. [Stash: the Folio of Malignant Secrets] _[the floor.]  Press: ? - help, . - travel, g - get item0ki_You can't see that place.  [Stash: 9 gold pieces]  [the floor.]0kir0ki0ki. _0ki l............####⌠................#....#.♣.♣♣.♣♣.ß..'.ßP..Pß...'..♣♣......#...#. #########.♣...#W[####..♣..##########''####### 0kiU Z$#?$#:.#.♣...##................. #$$..$.##♣♣...#..##### ........#.♣...#..###...#..P##..♣..#..#..''..###.###.P Z......Z#..♣..#.....'#..#..§..#. ##++++###.♣...#.........###'###. ..............#...###....#...#..'0kiֺ 0ki2 18.1 (1 _0ki 0ki T _There is a mourning vase here.1ki%[ ####⌠.⌠...##......#......#.♣.♣♣.♣.♣.ß..'.ßP..Pß.1ki[ D♣...'.♣♣.#.#..♣...##⌠⌠W[####..♣..##''# $#?$#:.#.♣...##. $$..$.##♣♣...#.#####.1ki[ #.♣...#..##......#...#..P ......##..♣..#..#..''..###.###.P ......Z#..♣..#.....'#..#..§..#. #++++###.♣...#.###'###.1kiP\ 1#...###....#...#..'.1kiJg 1kith ,9 _1kio AP1kiq 2ki ...........####⌠................⌠ ludeguy the Toxicologist ............##................... Octopode of Gozag Gold: 1017 .............#................... Health: 71/71 ======================== .............#.......♣.♣♣.♣...... Magic: 16/16 ======================== ........♣.ß..'.......ßP..Pß...... AC: 32kij Str: 13 .........♣...'.........♣♣........ EV: 15Int: 20 .............#................... SH: 0Dex: 21 .............#................... XL: 10 Next: 25% Place: a Necropolis 2ki ########.♣...##⌠@...............⌠ Noise: ---------  Time: 9099.1 (0.0) 2ki ##W[####..♣..##########''######## c) +0 dagger (protect) 2ki- $#?$#:.#.♣...##.................. Cast: Poisonous Vapours $$..$.##♣♣...#..........#####.... Fly 2kii .......#.♣...#..##......#...#..PP ......##..♣..#..#..''..###.###.PP  ......Z#..♣..#.....'#..#..§..#...2ki   #++++###.♣...#.........###'###...  .............#...###....#...#..'. 2ki You can't see that place.  [Stash: 9 gold pieces] _[the floor.] _There is a mourning vase here.  2ki aPress: ? - help, v - describe, . - travelThe floor.2ki"...........####⌠................⌠ ludeguy the Toxicologist ............##................... Octopode of Gozag Gold: 1017 .............#................... Health: 71/71 ======================== .............#.......♣.♣♣.♣...... Magic: 16/16 ======================== ........♣.ß..'.......ßP..Pß...... AC: 3Str: 13 2ki.........♣...'.........♣♣........ EV: 15Int: 20 .............#................... SH: 0Dex: 21 .............#................... XL: 10 Next: 25% Place: a Necropolis ########.♣...##⌠@...............⌠ Noise: ---------  Time: 9099.1 (0.0) ##W[####..♣..##########''######## c) +0 dagger (protect) $#?$#:.#.♣...##.................. Cast: Poisonous Vapours $$..$.##♣♣...#..........#####.... Fly .......#.♣...#..##......#...#..PP ......##..♣..#..#..''..###.###.PP  ......Z#..♣..#.....'#..#..§..#...  #++++###.♣...#.........###'###...  .............#...###....#...#..'. You can't see that place.  [Stash: 9 gold pieces] _[the floor.] _There is 2kiva mourning vase here.  Press: ? - help, v - describe, . - travelThe floor.2ki2ki;2ki. _2kic2ki The Necropolis∩∩∩∩_____(Press ? for help)#≈≈≈≈≈≈▓▓#............................................................#▓▓≈z≈≈≈≈##≈≈≈≈≈≈≈▓###........................................................###▓≈≈≈≈≈≈≈##≈≈≈≈≈≈≈▓▓#########################''######++#########################▓▓≈≈≈≈≈≈≈##≈≈≈≈≈≈▓▓##................####⌠................⌠####................##▓▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##....................##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#....................#▓≈≈≈≈z≈##≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈#2kiu#≈≈≈≈≈≈▓#...♣.##########.♣...##⌠@...............⌠##......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..$.##♣♣...#..........#####.....#..#...+......#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..''..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#......#...W..#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_2ki+(+......###...#..##............##..#▓≈≈≈≈≈≈[?7l#[?7h3kiM@#3ki;#.3ki8;..3ki ;.#4ki@;##4ki^;#.4ki{;..4ki;..4ki  .# #≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈[?7l#[?7h4kiAd #z #≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈[?7l#[?7h4ki[  z$ #≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈[?7l#[?7h4kip 20 gold pieces. A pile of glittering gold coins. Stash search prefixes: {gold} Menu/colouring prefixes: identified gold _________________ 4ki˗ “Here it was that the ambassadors of the Samnites, finding him boiling turnips  in the chimney corner, offered him a present of gold; but he sent them away  with this saying; that he, who was content with such a supper, had no need of  gold; and that he thought it more honourable to conquer those who possessed  the gold, than to possess the gold itself.”  -Plutarch, “Marcus Cato”, _Lives_. 75 AD.  trans. John Dryden, 1683. (g)o to location.5ki The Necropolis∩∩∩∩__[40m___(Press ? for help)#≈≈≈≈≈≈▓▓##................####⌠................⌠####................##▓▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##....................##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#....................#▓≈≈≈≈z≈##≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##########.♣...##⌠@...............⌠##......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..i 33m$.##♣♣...#..........#####.....#..#...+......#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..''..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#......#...W..#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_+(+......###...#..##............##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈[?7l#[?7h5ki8 ?$[6ki [# #≈≈≈≈≈≈▓▓##................###............#.#.#.#.###................##▓▓≈≈≈≈≈≈[?7l#[?7h6ki7` 5#!7kiA potion of lignification. A potion which transforms the imbiber into an animated tree with sap for blood and branches capable of holding weapons. Such a tree has minimal evasion but increased health and natural armour, and is resistant to poison, and immune to torment and drowning. However, it is rooted in place while the transformation lasts, and cannot teleport. If you quaff this potion your AC would be 25. 7kiIt is an uncommon potion. Stash search prefixes: {rPois rTorment rDrown} {potion} {resist poison} {poison resistance} Menu/colouring prefixes: identified dangerous_item potion _________________ “Before her prayer was ended, torpor seized  on all her body, and a thin bark closed  around her gentle bosom, and her hair  became as moving leaves; her arms were changed  to waving branches, and her active feet (g)o to location.7kiE The Necropolis∩∩∩∩_____(Press ? for help)#≈≈≈≈≈≈▓##..................##....................##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#....................#▓≈≈≈≈z≈##≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##########.♣...##⌠@...............⌠##......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..$.##♣♣...#..........#####.....#..#...+......#...#..#▓7kiE ≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..''..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#......#...W..#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_+(+......###...#..##............##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓▓##................###............#.#.#.#.###................##▓▓≈≈≈≈≈≈[?7l#[?7h8kiilA_!9ki5_+9ki*?+(9ki ;():ki_The +10 short sword of the Shoals {chaos, *Slow Int+3 Stlth+}. A personal stabbing weapon with a short grip. Base accuracy: +4 Base damage: 5 Base attack delay: 1.0 This weapon's minimum attack delay (0.5) is reached at skill level 10.  Your skill: 3.7  At 100% training you would reach 10.0 in about 0.8 XLs.  At current training (17%) you reach 10.0 in about 3.0 XLs.  Current attack delay: 0.8. Damage rating: 25 (Base 5 x 127% (Dex) x 119% (Skill) + 18 (Ench + Slay)). Chaos: Each hit from it has a different, random effect. *Slow: It may slow you when you take damage. Int+3: It affects your intelligence (+3). Stlth+: It makes you more stealthy. If you switch to wielding this weapon: Your spell failure would improve by up to 1% (press '!' for details). This weapon falls into the 'Short Blades' category. It is good for stabbing (g)o to location.@kiyiThe Necropolis∩∩∩∩_____(Press ? for help)#≈≈≈≈≈≈▓##..................##....................##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#....................#▓≈≈≈≈z≈##≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##########.♣...##⌠@...............⌠##......#.W..ß##......#▓≈≈≈≈≈≈#@ki%#≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..$.##♣♣...#..........#####.....#..#...+......#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..''..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#......#...W..#......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈#@ki\#≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_+(+......###...#..##............##..#▓≈≈≈≈≈≈#@ki#≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈#@ki#≈≈≈≈≈≈▓▓##................###............#.#.#.#.###................##▓▓≈≈≈≈≈≈[?7l#[?7hAki A#)Bki7!#Bki 7#!Cki7W#Cki Aspacedog's ghost. The apparition of aspacedog the the Cleaver, a novice Mountain Dwarf Fighter of Makhleb. Max HP: 93 Will: ++ AC: ++++ EV: ++  rF: ... rC: ... rPois: ∞ rNeg: ∞ rElec: . Threat: Lethal Class: Undead Size: Medium Int: Human CkiS! You have about 98% to hit with your +0 dagger of protection and 100% to hit withyour grab and squeeze (while incapacitated). It has about 65% to hit you. AttackMax Damage Cki! Hit: weapon of electrocution 30 + 20 (elec) It has a 13% chance to notice you each turn. It is immune to torment; and resistant to miasma and drowning. It is insubstantial and immune to ensnarement. Cki! 7It can fly. It can open doors. Cki" [!]: Description|StatusesDkiGThe Necropolis∩∩∩∩_____(Press ? for help)#≈≈≈≈≈≈▓##..................##....................##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#....................#▓≈≈≈≈z≈##≈≈≈≈≈≈▓#....................#.......♣.♣♣.♣.......#....................#▓≈≈≈≈≈≈#DkikH#≈≈≈≈≈≈▓#..ß.♣..........♣.ß..'.......ßP..Pß.......'..##............##..#▓≈≈≈≈≈z##≈≈≈≈≈≈▓#...♣............♣...'.........♣♣.........'..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#..##..######....##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#....................#......#.ß?$##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##########.♣...##⌠@...............⌠##......#.W..ß##......#▓≈≈≈≈≈≈#DkiH#≈≈≈≈≈≈▓#..♣..####W[####..♣..##########''##########......#...W.)#......#▓≈≈≈≈≈≈#Dki2I#≈≈≈≈≈≈▓#..♣..#Z$#?$#:.#.♣...##..................##..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##$$..$.##♣♣...#..........#####.....#..#...+......#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣♣#........#.♣...#..##......#...#..PP.#..#...+.....⌠#...#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#...♣.##......##..♣..#..#..''..###.###.PP.#..##..+.....♣#..##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..♣..#Z......Z#..♣..#.....'#..#..§..#....#......#...W..#......#▓≈≈≈≈≈≈#DkiI#≈≈≈≈≈≈▓#...♣.###++++###.♣...#.........###'###....#......#.W..ß##......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#...###....#...#..'..#......#[ß?)##.......#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###..##'##.....#..##..######....##..#▓≈≈≈≈≈≈#Dki)J#≈≈≈≈≈≈▓#...♣............♣...#.#z#[#!#............#..#♣............♣#..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#..ß.♣..........♣.ß..#.#$[_+(+......###...#..##............##..#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.#W#!#)#....###.###.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓#....................#.###z###....#.#.#.#.#....................#▓≈≈≈≈≈≈##≈≈≈≈≈≈▓##..................##...###......'.'_..'.##..................##▓≈≈≈≈≈≈##≈≈≈≈≈≈▓▓##................###............#.#.#.#.###................##▓▓≈≈≈≈≈≈[?7l#[?7hDkiZ A$WEkiN#$EkiDz#Eki D#zHkiiD.#Hki D..Hki0 D..Hkiˉ D..Hki` D#.Hki%z D.#Iki5..Iki.5..IkiB5..Ikipd5..Iki< 5..Iki 5..Iki 5..Iki 5.#JkiUJkib...........####⌠................⌠ ludeguy the Toxicologist Jki c............##................... Octopode of Gozag Gold: 1017 .............#................... Health: 71/71 ======================== .............#.......♣.♣♣.♣...... Magic: 16/16 ======================== Jkic........♣.ß..'.......ßP..Pß...... AC: 3Str: 13 .........♣...'.........♣♣........ EV: 15Int: 20 .............#................... SH: 0Dex: 21 .............#................... XL: 10 Next: 25% Place: a Necropolis ########.♣...##⌠@...............⌠ Noise: ---------  Time: 9099.1 (0.0) Jkid##W[####..♣..##########''######## c) +0 dagger (protect) $#?$#:.#.♣...##.................. Cast: Poisonous Vapours $$..$.##♣♣...#..........#####.... Fly .......#.♣...#..##......#...#..PP ......##..♣..#..#..''..###.###.PP  ......Z#..♣..#.....'#..#..§..#...  #++++###.♣...#.........###'###...  .............#...###....#...#..'. You can't see that place.  [Stash: 9 gold pieces] _[the floor.] _There is a mourning vase here.  Press: ? - help, v - describe, . - travel _The floor.JkieJki=jJkikJkiYF##################''######++#####.####⌠⌠#.##..#...........#.♣.♣♣.♣.♣.ß..'.ßP..Pß♣...'.♣♣#. ............#....#####.♣...##⌠................⌠ #W[####..♣..##########''######### #?$#:.#.♣...#........# $..$.##♣♣...#..........#####......♣...#..##......#...#..PP.##..♣..#..#..''..###.###.PP .....Z#..♣..#.....'#..#..§..#. ++++###.♣...#.........###'###...JkisJkit3100.1 (1 _Jki%PJkiJkiG!................................. #################''######++#########⌠⌠##.##.#.#.Jki8......#....#.♣.♣♣.♣.#♣.ß..'.ßP..PßJkiW'♣...'.♣♣Jki1'#.Jki:H# ...........#...Jki]. #Jki^#####.♣...##⌠................⌠ JkiW[####..♣..##########''######### ?$#:.#.♣...#Jki&.........##Jkiv$.##♣♣...#..........#####.....#Jki t.♣...#..##......#...#..PP.###..♣..#..#..''..###.###.PP.# ....Z#..♣..#.....'#..#..§..#....#Jki3JkiB Jki%1JkiJkiJki_  ................................. ################''######++#########⌠⌠####..#.#.......#.....#.Jkix` ♣.♣♣.♣.#.♣.ß..'.ßP..Pß'.♣...'.♣♣..'..#.#. ..........#....#. #####.♣...##⌠................⌠##. [####..♣..##########''##########. $#:.#.♣...#..........##. .Jki` $.##♣♣...#..........#####.....#..♣...#..##......#...#..PP.#.##..♣..#..#..''..###.###.PP.#.Jkii Jkiej %2Jkin APJki&p Jki M................................. ################''######++########⌠.⌠##.#............#♣.♣♣.♣#♣.ßßP..Pß♣...'♣♣'. ..........#....................#. Fly ..Jki ;3Jki VP..PJki KkiMß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣. KkiJq................................. ################''######++########⌠.......⌠##....#............#♣.♣♣.♣Kkin#♣.ßßP..PßKkim♣...'♣♣'.Kkip.. ..........#....................#.KkiՀ).###Kki)Kki.%4KkiKKkiM♣..P....P...♣.♣.♣P.P.P.P.♣.ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣Kki.. ................................. ################''######++########⌠⌠###KkiB...........#Kki&[♣.♣♣.♣#♣.ßKkiIßP..Pß♣...'♣♣' Kkik..........#....................#.. Kki ...KkiKki9%5Kki9&PKki_KkigM♣........♣.♣...............♣ Kki ♣..P....P...♣.♣.♣P.P.P.P.♣.ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣........ ................................. ################''######++####Kki&A####⌠⌠##Kkip#...........#♣.♣♣.♣#♣.ßßP..Pß Kki......♣...'.........♣♣.........'....Kki> ..Kki*#########''##Kki$Kki%%6Kki)%PKki;+KkiLgM.....♣♣......♣.♣.♣♣........♣.♣...............♣ ♣..P....P...♣.♣.♣P.P.P.P.♣.Kkigß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣................... ................................. ################''######++########⌠⌠###...... Kkigb..........#.......♣.♣♣.♣.......#. Fly P..Pß. Kkih;..##⌠..........KkipKkiq%7KkixAPKki zKkiM♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.. .....♣♣......♣.♣.♣♣........♣.♣...............♣ ♣..P....P...♣.♣.♣P.P.P.P.♣.ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣...................... ................................. ################@'######++########⌠⌠#Kki=+##...... ..........#.......♣.♣♣.♣.......#.. .♣♣..#..........KkiO$Kki%%8Kki+%PKki.V _There is a large open door here.Kki6TM♣...♣♣..♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.. .....♣♣......♣.♣.♣♣........♣.♣...............♣ KkiTt♣..P....P...♣.♣.♣P.P.P.P.♣.ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣ ................@................ ################''######++########⌠................⌠###.....# ..........#....................#.#. .'...#.........KkixaKki{b,9 _Kki9ivPP.PKki+kKki|'M.................... .♣...♣♣........♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.. .....♣♣......♣Kki.♣.♣♣........♣.♣...............♣ ♣..P....P...♣.♣.♣P.P.P.P.♣.ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣ ................................. ################''######++########⌠.........⌠# Kki}.........##....................##.... Kki8'.....ßKkiQ''.........Kki&10P.P.PPKki?SM............................ .♣...♣♣........♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.. .....♣♣......♣.♣.♣♣........♣.♣...............♣ ♣..P....P...♣.♣.♣P.P.P.P.♣.ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣ ................................. ################''######++####### Fly Kki<@I............ßP.KkidKKkiK%1Kki$RpP.P.PPKkiSKkijKkiKki[KkiKkiG Kki Kki Kki$ KkiA% Kki+* Kki. Kki. Kki3 Kkim4 Kkiט .............. ..♣...♣♣........♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣.......♣.♣ .♣♣Kkir ..♣.♣.......♣♣..P....P...♣.♣.♣P.P.P.P.♣ ♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣#''######++.####⌠.......⌠.##...........#...........#.#.......♣.♣♣.♣.#Kki <.♣.ß..'.ßP..Pß.'KkiϤ Kki %2Kki %PKki Kki..............♣...♣♣........♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣.........♣. ..♣♣..♣.♣.........♣ .♣♣..P....P...♣.♣.♣P.P.P.P.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣#''######++.####⌠........⌠.##............#............Kkil.#.......♣.♣♣.♣..♣.ß..'.ßP..Pß.KkiZKki%3KkidFPPKki,Lkiu[...............♣...♣♣........♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣......♣.♣♣.♣.♣.........♣ ..♣♣..P....P...♣.♣.♣P.P.P.P.♣ .♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣#''######++.####⌠........⌠.##...........#........#.......♣.♣♣.♣.♣.ß..'.ßP..PßLkibLkic%4LkifcP.PLki0hLkit ...............♣...♣♣........♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣..♣♣......♣.......♣♣.♣.♣......♣.♣♣..P....P...♣.♣.♣P.P.P.P.♣ ♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣#''######++.####⌠........Lki u u.##........#...#.♣.♣♣.♣.♣.ß..'.ßP..PßLki| Lki %5Lki APLkiA ^.........♣...♣♣........♣♣.ß.ß.ß.ß♣...♣♣..♣♣.......♣.P.P.P.P♣.♣Lki .♣♣......♣.....♣♣.♣.♣.....Lki .♣♣..P....P...♣.♣.♣P.P.P.P.♣ Lkiˉ .♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣#''######++Lki <.####⌠.....##..#..#Lki L.♣.♣♣.♣.♣.ß..'.ßP..PßLki Lkia %6Lki` %PLki Lki .........♣...♣♣........♣♣.ß.ß.ß.ß♣.♣♣..♣♣.......♣.P.P.P.P♣..♣♣......♣.....♣♣.♣.♣...Lki %.♣♣..P....P...♣.♣.♣P.P.P.P.♣ ..♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣#''######++.####⌠.....##..#.#.♣.♣♣.♣ ♣.♣.ß..'.ßP..PßLki Lki %7Lki Lki Lki ..........♣...♣♣........♣♣.ß.ß.ß.ß♣.♣♣..♣♣.......♣.P.P.P.P♣LkiE .♣♣......♣...♣♣.♣.♣....♣♣..P....P...♣.♣.♣P.P.P.P.♣.♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.#''######++.####⌠.....##.#Lki ].#.♣.♣♣.♣ .♣.♣.ß..'.ßP..PßLki Lki %8LkiԖ Lki} z....♣...♣♣........♣♣.ß.ß.ß.ß.♣♣..♣♣.......♣.P.P.P.P.♣♣......♣...♣♣..♣.♣..Lki .♣♣..P....P...♣.♣.♣P.P.P.P..♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß. ##''######.####⌠.##.#.#.♣.♣♣.♣ ß.♣.♣.ß..'.ßP..PßLki ;9Lki APLki Lki3 z........♣...♣♣........♣♣.ß.ß.ß....♣♣..♣♣.......♣.P.P.P......♣♣......♣.♣♣........♣.♣.♣♣..P....P...♣.♣.♣P.P.P.P.♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß ###''###### #.####⌠.##.#.#.♣.♣♣.♣ .ß.♣.♣.ß..'.ßP..PßLki> Lki{? &20LkiE %PLkiG LkiVl ##........♣...♣♣........♣♣.ß.ß.ß....♣♣..♣♣.......♣.P.P.P.....♣♣......♣.♣♣........♣.♣.♣♣..P....P...♣.♣.♣P.P.P.Lki%m U.♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß. #### ▓#'' ##.####⌠ #.##.#.#.♣.♣♣. ..ß.♣.♣.ß..'.ßP..PLkiv Lkizv %1Lki{ ~P....PLki} Lki 5▓##............... #..♣...♣♣........♣♣.ß.ß. #.....♣♣..♣♣.......♣.P.P. #......♣♣......♣ #.♣♣........♣.♣ #.♣♣..P....P...♣.♣.♣P.P.P #......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß ## ▓# ▓###▓#'' LkiD ▓##.####⌠ ##.## #.# #.#.♣.♣♣ #..ß.♣.♣.ß..'.ßP..Lki$% Lki% %2Lkif) TP....PLki+ Lki Y ▓# ▓##...... ▓#....♣...♣♣........♣♣.ß.ß ▓#.....♣♣..♣♣.......♣.P.P ▓#......♣♣......♣ ▓#.♣♣........♣.♣ ▓#.♣♣..P....P...♣.♣.♣P.P. ▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß. LkiY ▓##▓# ≈▓### ≈▓▓#''▓##.####⌠ ▓##.## ▓#.# ▓#.#.♣. ▓#..ß.♣.♣.ß..'.ßPLkic LkiGd %3Lkiei Lkil LkiU≈▓▓# ≈▓##...... ≈▓#...♣...♣♣........♣♣.ß. ≈▓#....♣♣..♣♣.......♣.P. ≈▓#.....♣♣......♣ ≈▓#.♣♣........♣.♣ ≈▓#LkivV'.♣♣..P....P...♣.♣.♣P.P ≈▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß ≈▓## ≈▓▓#≈▓###≈▓▓#'' ≈▓▓##.####⌠ ≈▓##.## ≈▓#.# ≈▓#.#.♣. ≈▓#..ß.♣.♣.ß..'.ßPLki_Lki>a%4LkieLkinhLkiOu_≈▓▓#≈▓##......≈▓#..♣...♣♣........♣♣.ß≈▓#....♣♣..♣♣.♣.P≈▓#.....♣♣......♣≈▓#.♣♣Lki_v[..♣.♣≈▓#.♣♣..P....P...♣.♣.♣P.≈▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.≈▓##≈▓▓#≈▓###≈▓▓#''≈▓▓##.####⌠≈▓##.##≈▓#.#≈▓#.#.♣≈▓#..ß.♣.♣.ß..'.ßLkiU}Lki~%5LkiLkiLki≈▓▓#≈▓##....≈▓#.♣...♣♣.♣♣.≈▓#...♣♣..♣♣.♣.≈▓#.....♣♣......♣≈▓#.♣♣.♣.♣≈▓#.♣♣..P....P...♣.♣.♣P≈▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß≈▓##≈▓▓#≈▓###≈▓▓#''≈▓▓##.####⌠≈▓##Lki.##≈▓#.#≈▓#.#.≈▓#..ß.♣.♣.ß..'.LkiLki|%6LkiLki Mkir:≈▓▓#≈▓##...≈▓#.♣...♣♣..♣♣≈▓#..♣♣..♣♣.♣≈▓#....♣♣......♣≈▓#.♣♣.♣.♣≈▓#.♣♣..P....P...♣.♣.♣≈▓#......♣.♣♣...ß.♣♣.ß....♣..♣≈▓##≈▓▓#≈▓###≈▓▓#≈▓▓##.####⌠≈▓##.##≈▓#Mki:_.#≈▓#.#≈▓#..ß.♣.♣.ß..'MkikCMkiC%7Mki%GMkiBIMki^≈▓▓#≈▓##.≈▓#....♣...♣♣.≈▓#......♣♣..♣♣.≈▓#.........♣♣......♣≈▓#..........♣♣.♣.♣Mki/≈▓#.........♣♣..P....P...♣.♣.≈▓#......♣.♣♣...ß.♣♣.ß....♣..≈▓##≈▓▓#≈▓###≈▓▓#≈▓▓##.####⌠≈▓##.##≈▓#.#≈▓#.#≈▓#..ß.♣.♣.ß..'MkiMki(%8Mki+MkiMki≈▓▓#≈▓##.......≈▓#...........♣...♣♣.≈▓#.............♣♣..♣♣≈▓#...............♣♣......♣≈▓#..........♣♣.♣.♣≈▓#.........♣♣..P....P...♣.♣≈▓#......♣.♣♣...ß.♣♣.ß....♣≈▓##≈▓▓#≈▓###≈▓▓#≈▓▓##.####⌠≈▓##.##≈▓#.#≈▓#.#≈▓#..ß.♣.♣.ß..'MkiMki:%9MkiMkiiMki7p #≈≈≈≈≈≈▓▓# #≈≈≈≈≈≈▓##....... #≈≈≈≈≈≈▓#...........♣...♣♣ #≈≈≈≈≈≈▓#.............♣♣..♣♣ #≈≈≈≈≈≈▓#...............♣♣......♣ #≈≈≈≈≈≈▓#..........♣♣........♣.♣ #≈≈≈≈≈≈▓#.........♣♣..P....P...♣. #≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß....♣ #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓▓# #≈▓### #≈▓▓# #≈≈≈≈≈≈▓▓##.####⌠ #≈≈≈≈≈≈▓##.## #≈≈≈≈≈≈▓#.# #≈≈≈≈≈≈▓#.# #≈≈≈≈≈≈▓#..ß.♣.♣.ß..'MkizMki[{&30MkiMkiSMki #≈≈≈≈≈≈▓▓#  #≈≈≈≈≈≈▓##.......  #≈≈≈≈≈≈▓#...........♣...♣♣  #≈≈≈≈≈≈▓#.............♣♣..♣♣  #≈≈≈≈≈≈▓#...............♣♣......  #≈≈≈≈≈≈▓#..........♣♣........♣.♣  #≈≈≈≈≈≈▓#.........♣♣..P....P...♣  #≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß....  #≈≈≈≈≈≈▓##  #≈≈≈≈≈≈▓▓#  #≈▓###  #≈▓▓#  #≈≈≈≈≈≈▓▓##.####⌠  #≈≈≈≈≈≈▓##.##  #≈≈≈≈≈≈▓#.#  #≈≈≈≈≈≈▓#.#  #≈≈≈≈≈≈▓#..ß.♣.♣.ß..'MkiMki%1MkiAPMki.Mki)o #≈≈≈≈≈≈▓▓#  #≈≈≈≈≈≈▓##......  #≈≈≈≈≈≈▓#...........♣...♣♣  #≈≈≈≈≈≈▓#.............♣♣..♣♣  Mki)p #≈≈≈≈≈≈▓#...............♣♣  #≈≈≈≈≈≈▓#..........♣♣.♣.  #≈≈≈≈≈≈▓#.........♣♣..P....P...  #≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß  #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓▓# #≈▓### #≈▓▓#  #≈≈≈≈≈≈▓▓##Mkip.####  #≈≈≈≈≈≈▓##.##  #≈≈≈≈≈≈▓#.#  #≈≈≈≈≈≈▓#.#  #≈≈≈≈≈≈▓#..ß.♣.♣.ß..'MkiD{Mki{%2Mki%Mki;Mki #≈≈≈≈≈≈▓▓# #≈≈≈≈≈≈▓##. #≈≈≈≈≈≈▓#.♣...♣♣ #≈≈≈≈≈≈▓#....♣♣..♣♣ #≈≈≈≈≈≈▓#.......♣♣ #≈≈≈≈≈≈▓#...♣♣.♣ #≈≈≈≈≈≈▓#...♣♣..P....PMki_^ #≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓▓# #≈▓### #≈▓▓# #≈≈≈≈≈≈▓▓##. #≈≈≈≈≈≈▓##.## #≈≈≈≈≈≈▓#.# #≈≈≈≈≈≈▓#.# #≈≈≈≈≈≈▓#..ß.♣.♣.ß..'MkiMki]%3MkiMki:Mki #≈≈≈≈≈≈▓▓# #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓#.♣...♣♣ #≈≈≈≈≈≈▓#.♣♣..♣♣ #≈≈≈≈≈≈▓#.♣♣ #≈≈≈≈≈≈▓#.♣♣. #≈≈≈≈≈≈▓#..♣♣..P....P #≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ßMki #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓▓# #≈▓### #≈▓▓# #≈≈≈≈≈≈▓▓##. #≈≈≈≈≈≈▓##. #≈≈≈≈≈≈▓#. #≈≈≈≈≈≈▓#. #≈≈≈≈≈≈▓#..ß.♣.♣.ß..MkiMki%4MkiMki #≈≈≈≈≈≈▓▓# #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓#.♣...♣♣ #≈≈≈≈≈≈▓#.♣♣..♣♣ #≈≈≈≈≈≈▓#.♣♣MkiE #≈≈≈≈≈≈▓#.♣♣ #≈≈≈≈≈≈▓#.♣♣..P....P #≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß #≈≈≈≈≈≈▓## #≈≈≈≈≈≈▓▓# #≈▓### #≈▓▓## #≈≈≈≈≈≈▓▓##Mki. #≈≈≈≈≈≈▓##. #≈≈≈≈≈≈▓# #≈≈≈≈≈≈▓# #≈≈≈≈≈≈▓#..ß.♣.♣.ßMkiMki%5Mki\MkiMkiKRM≈▓###▓##......▓♣...♣♣..#♣♣..♣♣▓.....♣♣#.♣♣..........♣♣..P....PMkiR▓#..@...♣.♣♣...ß.♣♣.ß▓#▓▓#.. #≈≈≈≈≈≈≈▓###................ Fly Mki\Mki]%6MkibMki1eMki8 #≈▓▓▓########''''#######≈▓####≈≈≈≈≈≈▓▓#.#≈≈≈≈≈≈▓##......#≈≈≈≈≈≈▓#.♣...♣♣...#≈≈≈≈≈≈▓#.♣♣..♣♣#≈≈≈≈≈≈▓#.....♣♣#≈≈≈≈≈≈▓#.......#≈≈≈≈≈≈▓#...♣♣..P....P.#≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß#≈≈≈≈≈≈▓##...#≈≈≈≈≈≈▓▓#...#≈▓###.................#≈##################≈≈≈≈≈≈▓###≈≈≈≈≈≈▓###≈≈≈≈≈≈▓#.MkiC MkiD %7MkizK Mki_M NkiەI#≈≈▓▓#................#≈▓▓▓########''''########≈▓####≈≈≈≈≈≈▓▓#.#≈≈≈≈≈≈▓##......#≈≈≈≈≈≈▓#.♣...♣♣...#≈≈≈≈≈≈▓#.♣♣..♣♣#≈≈≈≈≈≈▓#.....♣♣#≈≈≈≈≈≈▓#.......♣#≈≈≈≈≈≈▓#...♣♣..P....P.Nki#≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß#≈≈≈≈≈≈▓##...........#≈≈≈≈≈≈▓▓#........#≈▓###..................#≈##################≈≈≈≈≈≈▓###≈≈≈≈≈≈▓###NkiʡNki٢%8NkiNkiNki#≈###▓#≈≈▓▓#................#▓#≈▓▓▓########''''#########≈Nki####≈≈≈≈≈≈▓▓#.#≈≈≈≈≈≈▓##......#≈≈≈≈≈≈▓#.♣...♣♣...#≈≈≈≈≈≈▓#.♣♣..♣♣#≈≈≈≈≈≈▓#.....♣♣.....#≈≈≈≈≈≈▓#.........♣#≈≈≈≈≈≈▓#...♣♣..P....P.#≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß#≈≈≈≈≈≈▓##....#≈≈≈≈≈≈▓▓#.....#≈▓###...................#≈##################≈≈≈≈≈≈▓##NkiNkiC%9NkiNkiNkiPK#≈▓▓##..∩NkiP∩..##▓▓≈  #≈###▓≈  #≈≈▓▓#................#▓▓  #≈▓▓▓########''''#########  #≈NkiP####≈≈≈≈≈≈▓▓#.#≈≈≈≈≈≈▓##NkiQe......  #≈≈≈≈≈≈▓#.Nki-Q♣...♣♣...  #≈≈≈≈≈≈▓#.♣♣..♣♣  NkiXQ`#≈≈≈≈≈≈▓#.....♣♣.....  NkiQ`#≈≈≈≈≈≈▓#.........♣.♣  NkiQj#≈≈≈≈≈≈▓#...♣♣..P....P...♣  NkiQ#≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß  NkiQg#≈≈≈≈≈≈▓##..........  Nki R#≈≈≈≈≈≈▓▓#...........  #≈▓###....................  #≈NkiDR-################Nkif^Nki_&40NkifNkiGiNkiE#≈..##▓▓≈≈ #≈Nki#N▓▓##..∩......∩..##▓▓≈ #≈###▓≈≈ #≈≈▓▓#................#▓▓▓ #≈▓▓▓########''''########## #≈### NkiU#≈≈≈≈≈≈▓▓#. #≈≈≈≈≈≈▓##...... #≈≈≈≈≈≈▓#.Nki♣...♣♣... #≈≈≈≈≈≈▓#.♣♣..♣♣ #≈≈≈≈≈≈▓#.....♣♣..... Nki#≈≈≈≈≈≈▓#.........♣.♣. #≈≈≈≈≈≈▓#...♣♣..P....P...♣ NkiHd#≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß....♣ #≈≈≈≈≈≈▓##......... #≈≈≈≈≈≈▓▓#.......... #≈▓###.....................NkiNkig%1NkiBPNki1Nki C≈##########▓▓≈≈≈# ≈........##▓▓≈≈ ≈▓▓##..∩......∩..##▓▓≈ NkirC≈#.##▓≈≈≈ ≈≈▓▓#................#▓▓▓▓ ≈▓▓▓########''''########### ≈### NkiC≈≈≈≈≈≈▓▓#. ≈≈≈≈≈≈▓#...... ≈≈≈≈≈≈▓#.NkiCv♣...♣♣... ≈≈≈≈≈≈▓#.♣♣..♣♣...... Nki8D≈≈≈≈≈≈▓#.....♣♣..... ≈≈≈≈≈≈▓#.........♣.♣. ≈≈≈≈≈≈▓#...♣♣..P....P...♣ NkiD ≈≈≈≈≈≈▓#......♣.♣♣...ß.♣♣.ß....♣ ≈≈≈≈≈≈▓##......... ≈≈≈≈≈≈▓▓#...NkiwONki[P%2NkiV&PNkiXNkix▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈##########▓▓≈≈≈#........##▓▓≈≈▓▓##..∩......∩..##▓▓≈#.Nki ##▓≈≈≈≈≈▓▓#................#▓▓▓▓▓▓▓▓########''''###############▓▓#.▓#......▓#.♣...♣♣........♣▓#..♣♣..♣♣......▓#.....♣♣.....▓#.........♣.♣...▓#...♣♣..P....P...♣▓#......♣.♣♣...ß.♣♣.ß....♣▓##.Nki<Nki%3NkiiNki%≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈▓############▓▓≈≈≈##..........##▓▓≈≈▓▓##..∩......∩..##▓▓≈##......##▓≈≈≈≈≈Nki%d≈▓▓#................#▓▓▓▓▓▓▓▓▓########''''################▓▓#.▓#.......▓#.♣...♣♣........♣♣▓#.♣♣..♣♣.......♣▓#.....♣♣.....▓#.......♣.♣...▓#...♣♣..P....P...♣.♣.♣Nki4&L▓#......♣.♣♣...ß.♣♣.ß....♣..♣Nki%1Nki1%4Nki8NkiD;Nki#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈▓▓############▓▓≈≈≈###....##▓▓≈≈▓▓##..∩∩..##▓▓≈##.....##▓≈≈≈≈≈≈≈▓▓#................#▓▓▓▓▓▓▓▓▓▓########'@''#################▓▓#.▓#Nkiä........▓#.♣...♣♣........♣♣.▓#...♣♣..♣♣.......♣▓#.....♣♣.....▓#.........♣.♣.....▓#...♣♣..P....P...♣.♣.♣PNkiNki%5NkieNkiU _There is a huge open gate here.Nki$R≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈▓############▓▓≈≈≈##...NkiR.##▓▓≈≈▓▓##..∩∩..##▓▓≈###▓≈≈≈≈≈≈≈≈▓▓#........@.......#▓▓▓▓▓▓▓▓▓▓▓########''''##################........▓▓#.NkiR..▓#NkiS+........Nki,SY▓#.♣...♣♣........♣♣.ßNki}S▓#..♣♣..♣♣.......♣.P▓#.....♣♣.....▓#.......♣.♣......Nki^Nki<`,6 _NkifNkiiNki|≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈Nki}############▓▓≈≈≈##....##▓▓≈≈▓▓##..∩∩..##▓▓≈###▓≈≈≈≈≈≈≈≈Nki*}≈▓▓#................#▓▓▓▓▓▓▓▓▓▓▓▓########''''###################.....NkiO}(....▓▓#.......Nkiq}▓#..................▓#.♣...♣♣........♣♣.ß.Nki}O▓#.♣♣..♣♣.......♣.P▓#.Nki},....♣♣.....Nki;7NkiNkiNki.>h≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈##########▓▓≈≈≈#..##▓▓≈≈▓▓##..∩∩..##▓▓≈###▓≈≈≈≈≈≈≈≈≈Nki ?≈▓▓#................#▓▓▓▓▓▓▓▓▓▓▓▓▓########''''####################....... ▓▓#.... ▓#.......... ▓#.♣...♣♣........♣♣.ß.ß ▓#.♣♣..♣♣.......♣.P.PNkiiINkiTJ%8NkiPNkiSNki|d≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z≈Nkids##########▓▓≈≈≈#..##▓▓≈≈▓▓##..∩∩..##▓▓≈###▓≈≈≈≈≈≈≈≈≈≈Nkie≈▓▓#................#▓▓▓▓▓▓▓▓▓▓▓ ▓▓▓########''''#####################.NkiXe.. #............ #.♣...♣♣........♣♣.ß.ß.NkipNkiq%9NkiwNkiryNki Nkiu Nki) Nki" OkiK/OkiQ0&50Oki$7Oki;9Oki<#≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z############▓▓≈≈≈#..........##▓▓≈≈∩∩..##▓▓≈▓##........##▓▓..#▓▓▓▓▓▓▓▓▓▓▓▓▓########''''################# ≈▓###............................▓#..#. ▓♣...♣♣♣♣.ß.ß ▓#...♣♣..♣♣.......♣.P.POkiDOkiE%1OkifKOkiMOki<  #≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z▓▓############▓▓≈≈≈#▓▓##..........##▓▓≈≈≈▓▓##..∩∩..##▓▓##........##▓▓#..#▓▓▓▓▓▓▓▓▓▓Oki 7▓▓▓########''''#################.Fly ...... ▓#...............♣♣......♣....... Oki Oki' %2Oki Oki@ Pki#≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈zPki+############▓▓≈≈≈#..........##▓▓≈≈∩∩..##▓▓PkiT≈▓##........##▓▓Pki@..#▓▓▓▓▓▓▓▓▓▓▓▓########''''################≈▓###...........................Pkid:▓#.... ≈▓##Pki.... ≈▓♣...♣♣.♣♣.ß ≈▓#Pki[...♣♣..♣♣.......♣.P. ≈▓#Pkìo...♣♣......♣...... ≈▓#♣♣........♣PkiPkig%3PkiPki4Pki #≈≈#≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈zPki▓▓############▓▓≈≈≈#▓▓##..........##▓▓≈≈≈▓▓##..∩∩..##▓▓##....Pki;....##▓▓#.Pki,.#▓▓▓▓▓▓▓▓▓▓▓▓########'''@################PkiSt###...........................▓▓#........#PkioC........Pki:....Pki....♣♣. ≈▓#.........♣♣..P....P...♣.♣.♣P.P PkiPki[Pki%4PkiPki U _There is a huge open gate here.Pki} Pkiݥ Pki Pki U _There is a huge open gate here.Qki ≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z▓▓############▓▓≈≈≈#▓▓##..........##▓▓≈≈≈▓▓##..∩∩..##▓▓##........##▓▓#......#▓▓▓▓▓▓▓▓▓▓▓▓########''''###################..........@................▓▓#..#Fly .Qki....♣♣.. ≈▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß QkiQki,5 _Qki+QkiQki▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈≈≈z▓▓############▓▓≈≈≈#≈▓▓##..........##▓▓≈≈≈≈▓▓##..∩......∩..#▓##..............##▓≈Qki#▓▓#........#▓▓▓▓▓▓▓▓▓▓▓▓▓########''''#################▓###............................ ▓▓#... QkiJT▓##. ▓#..♣...♣♣♣♣.ß.ß Qki▓#..♣♣..♣♣.P.P ▓#........♣♣......♣...... ▓#.♣♣........♣.♣.. ▓#.♣♣..P....P...♣.♣.♣P.P ▓#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß. ▓#........................QkiQkid%6Qki'QkieQki) ▓≈≈≈≈z≈▓▓############▓▓≈≈≈#≈▓▓##..........##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.......##▓≈▓▓#.......#▓ ▓▓▓#''''# Qki ▓###.#. ##. #.♣...♣♣.♣♣.ß.ß. #.Qki X....♣♣..♣♣.♣.P.P. #.Qki N......♣♣......♣. #.Qki ♣♣..Qki ,♣.♣. #.Qki '♣♣..P....P...♣.♣.♣P.P.P Qki Z#......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß ##.Qki Qki %7QkiH& Qkit( Qki w▓≈≈≈≈z≈▓▓############▓▓≈≈≈#≈▓▓##..........##▓▓≈▓▓##..∩......∩..##▓▓≈▓##........##▓≈▓▓#........#▓#''''# ###. #.. .♣...♣♣.♣♣.ß.ß.ß ....♣♣..♣♣.♣.P.P.P ....♣♣......♣. .♣♣.♣.♣. .♣♣..P....P...♣.♣.♣P.P.P. ......♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß. #.QkiR QkiK %8Qki Qkiͺ Rki|$▓≈≈≈≈z≈▓▓#▓▓≈≈≈#≈▓▓##....##▓▓≈▓▓##..∩......∩..##▓▓≈▓##........##▓≈ ▓▓#..#▓#''''#. ..♣...♣♣.♣♣.ß.ß.ß.Rki$♣♣..♣♣.♣.P.P.P....♣♣......♣.♣♣..♣.♣.♣♣..P....P...♣.♣.♣P.P.P.P♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß .Rki0Rki&1%9Rki6Rki8Rkip▓≈≈≈≈z≈▓▓#▓▓≈≈≈#≈▓▓##.##▓▓≈ ▓▓##..∩......∩..##▓▓≈ ▓##.......##▓≈#...#▓ #''''#.♣...♣♣.♣♣.ß.ß.ß.ß♣♣..♣♣.♣.P.P.P.P...♣♣......♣.♣♣..♣.♣.♣♣..P....P...♣.♣.♣P.P.P.P.♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.RkiRkih&60Rki9RkiRkin` ▓≈≈≈≈z≈▓▓#▓▓≈≈≈#≈ ▓▓##.##▓▓≈##..∩......∩..##▓▓≈ ##.##▓≈ #..#▓''''# .♣...♣♣.♣♣.ß.ß.ß.ß♣♣♣..♣♣.♣.P.P.P.P♣...♣♣......♣.♣♣........♣.♣..Rki` ♣♣..P....P...♣.♣.♣P.P.P.P.♣♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣Rkij Rkik %1Rki:q Rkir Rki ~▓≈≈≈≈z≈ ▓▓#▓▓≈≈≈#≈##.##▓▓≈ ##..∩......∩..##▓▓≈ #.##▓≈ .#▓''''#♣...♣♣.♣♣.ß.ß.ß.ß♣.♣♣..♣♣.♣.P.P.P.P♣...♣♣......♣.♣♣........♣.♣...♣♣..P....P...♣.♣.♣P.P.P.P.♣.RkiP ♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣Rki Rki5 %2Rki &PRki Rki 7▓≈≈≈≈z≈#▓▓≈≈≈#≈ ##.##▓▓≈ #..∩......∩..##▓▓≈ .##▓≈#▓''''#♣...♣♣.♣♣.ß.ß.ß.ß♣.♣♣..♣♣.♣.P.P.P.P♣.♣♣♣......♣.....Rki{ ♣♣........♣.♣.♣♣..P....P...♣.♣.♣P.P.P.P.♣. .♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rki RkiK %3Rki Rki Rki o≈≈≈≈z≈ #▓▓≈≈≈#≈# #.##▓▓≈ Rki̫ ..∩......∩..##▓▓≈##▓≈#▓''''#♣...♣♣.Rki ♣♣.ß.ß.ß.ß♣..♣♣♣..♣♣.♣.P.P.P.P♣.♣.Rki ♣♣......♣.....♣♣........♣.♣.......♣RkiT ♣♣..P....P...♣.♣.♣P.P.P.P.♣. ♣.♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rki ;4RkiZ Rki߽ Rki ≈≈≈≈z≈▓▓≈≈≈#≈#≈ .##▓▓≈ .∩......∩..##▓▓≈##▓≈#▓''''#♣...♣♣.Rki X♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.♣.P.P.P.P♣.♣.♣♣♣......♣.......♣♣♣........♣.♣.......♣.♣♣..P....P...♣.♣.♣P.P.P.P.♣. .♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rki Rkiy %5Rki BPRki Rkiw H≈≈≈≈z≈▓▓≈≈≈#≈#≈##▓▓≈ ∩......∩..##▓▓≈▓##▓≈▓#▓''''#♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.♣.P.P.P.P♣.♣.♣.♣♣......♣.......♣.♣♣.♣.♣.........♣. .♣♣..P....P...♣.♣.♣P.P.P.P.♣. ♣♣...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rki= Rki %6Rki &PRki Rkiu ≈≈≈≈z≈▓▓≈≈≈#≈#≈##▓▓≈▓ ......∩..##▓▓≈▓##▓≈▓##▓# #''''#♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣......♣.♣ .♣♣.♣.♣........♣. Rki ♣♣..P....P...♣.♣.♣P.P.P.P.♣....ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rki Rki %7Rki# PPP.PRki) Rki ≈≈≈≈z≈▓▓≈≈≈#≈#≈≈≈▓##▓▓≈▓∩..##▓▓≈▓▓###▓≈▓##▓#. ''''# .♣...♣♣.♣♣.ß.ß.ß.ß♣..♣.♣♣..♣♣.......♣.P.P.P.P♣.♣.♣.♣♣......♣.....♣.♣. ♣♣.♣.♣......♣...P....P...♣.♣.♣P.P.P.P.♣. ...ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rkij Rki9 %8Rki@ xP.P.PRkio ≈≈≈≈z≈▓▓▓≈≈≈#≈#≈≈≈▓##▓▓≈▓▓#∩..##▓▓≈▓▓###▓≈Rki 9▓##.#▓#.# ♣...♣♣.Rki ♣♣.ß.ß.ß.ß♣..♣....ßRki l♣♣..♣♣.......♣.P.P.P.P♣.♣.♣...P♣♣......♣....♣.♣..♣.♣.....Rki ♣. ..P....P...♣.♣.♣P.P.P.P.♣.♣ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.Rki# Rki %9Rki BPRki RkiE <≈≈≈≈z≈▓▓▓≈≈≈#≈#≈≈≈▓▓###▓▓≈▓▓#∩..##▓▓≈▓▓##.##▓≈▓##.#▓#.# ...♣♣.♣♣.ß.ß.ß.ß♣..♣....ß. .♣♣..♣♣.......♣.P.P.P.P♣.♣.♣...P.♣♣......♣...♣.♣. .♣.♣....♣. .RkiZF P....P...♣.♣.♣P.P.P.P.♣.♣ .ß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.RkiP RkiJQ &70Rki@U 'P.P.PP.P.P.PRkiV RkiU0≈≈≈≈z≈▓▓▓≈≈≈#≈#≈≈≈▓▓###▓▓≈▓▓##.∩..##▓▓≈▓▓##.##▓≈▓##.#▓#. '#♣♣.♣♣.ß.ß.ß.ß♣..♣....ß.♣ ♣♣..♣♣.......♣.P.P.P.P♣.♣.♣...P.♣♣......♣...♣.♣.♣.♣...♣......♣ P....P...♣.♣.♣P.P.P.P.♣.♣♣. Rki\Vß.♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.♣Rki_Rki<`%1Rki&d&PRkikE≈≈≈≈z≈▓▓▓≈≈≈#≈#≈≈≈▓▓###▓▓≈▓▓##. .∩..##▓▓≈▓▓##..∩##▓≈▓##.#▓#. #♣♣.♣♣.ß.ß.ß.ß♣..♣....ß.♣..♣♣.......♣.P.P.P.P♣.♣.♣...P. .♣♣......♣.....♣.♣.♣.♣...♣......♣ ....P...♣.♣.♣P.P.P.P.♣.♣♣. .♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.♣RkiBtRkit%2RkizHPPRkis|RkiS4≈≈≈≈z≈▓▓▓≈≈≈#≈#≈≈≈▓▓###▓▓≈▓▓##. ∩..##▓▓≈▓▓##..∩.##▓≈▓##.#▓#. ♣♣.Rki!♣♣.ß.ß.ß.ß♣..♣....ß.♣♣. ..♣♣.♣.P.P.P.P♣.♣.♣...P. ♣♣......♣....♣.♣.♣.♣..♣......♣♣.RkiP...♣.♣.♣P.P.P.P.♣.Rki0♣♣..♣ ♣♣.ß....♣..♣ß.ß.ß.ß.♣♣.♣♣.Rki'Rki(%3RkiQ/rPP.PRki7≈≈≈≈z≈▓▓▓≈≈≈#≈#≈≈≈▓▓# .##▓▓≈▓▓##. ..##▓▓≈▓▓##..∩.##▓≈▓##.#▓#.Rki8+.♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß .♣♣.Rki(8♣.P.P.P.P♣.♣.♣...P....PRki@8I......♣.....♣.♣.♣.♣.RkiU8.♣......♣♣.Rkix8P...♣.♣.♣P.P.P.P.♣.......♣♣..♣.ß....♣..♣ß.ß.ß.ß.♣♣........♣♣.SkiSki$%4Ski JPPSkiSkiK≈≈≈≈z≈▓ #▓▓≈≈≈#≈#≈≈≈▓▓# ##▓▓≈▓▓##. .##▓▓≈▓▓##..∩.##▓≈▓##.#▓#.+ .SkiK♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß. ♣♣.♣.P.P.P.P♣.♣.♣...P....P. ......♣....♣.♣.♣.♣..♣......♣♣. .P...♣.♣.♣P.P.P.P.♣.......♣♣..♣♣. .ß....♣..♣ß.ß.ß.ß.♣♣........♣♣.SkiF5PP.P.PSki≈≈≈≈z≈▓ ▓▓≈≈≈#≈#≈≈≈▓▓# #▓▓≈▓▓##. ##▓▓≈▓▓##..∩. .##▓≈▓##.#▓Ski^y#.+♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß..♣.P.P.P.P♣.♣.♣...P....P.♣....♣.♣.♣♣.♣...♣......♣♣. SkiP...♣.♣.♣P.P.P.P.♣.......♣♣..♣♣. ß....♣..♣ß.ß.ß.ß.♣♣........♣♣...♣SkiSki%6SkiP.P.PPSkiSki 9≈≈≈≈z≈▓≈≈≈#≈#≈≈≈▓▓# ▓▓≈▓▓##. #▓▓≈▓▓##..∩. ##▓≈▓##. .#▓Skig9-#.+♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß. .♣.P.P.P.P♣.♣.♣...P....P..♣♣.....♣.♣.Ski9e♣ .♣.♣....♣......♣♣. Ski9...♣.♣.♣P.P.P.P.♣.......♣♣..♣♣. ....♣..♣ß.ß.ß.ß.♣♣........♣♣...♣.SkibCSki(D%7SkiIP.P.PP.P.PSkiKSkiz≈▓ ≈≈≈#≈#≈≈≈▓▓#≈▓▓##. ▓▓≈▓▓##..∩. #▓≈▓##. #▓#.Ski++++#♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.P.P.P.P♣.♣.♣...P....P..♣♣......♣.♣.♣♣. ♣.♣.....♣......♣♣.Ski4k♣.♣.♣P.P.P.P.♣.......♣♣..♣♣.♣..♣ß.ß.ß.ß.♣♣........♣♣...♣.SkiSkiX%8Ski!PPP.PSki)z≈▓#≈#≈≈≈▓▓# ≈▓▓##.≈▓▓##..∩......∩ ▓≈▓##. ▓Skiq)<#.++++#♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.P.P.P.P♣.♣.♣...P....P..♣♣.♣.......♣.♣.Ski)♣♣. .♣.......♣......♣♣. .♣.♣.♣P.P.P.P.♣.......♣♣..♣♣.♣..♣ß.ß.ß.ß.♣♣........♣♣...♣.Ski2Ski(3%9Ski 8{P.PPSki:Skiz≈▓#≈#≈≈≈▓▓#▓▓##. ≈▓▓##..∩......∩. ≈▓##.Ski#.++++#♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣.P.P.P.P♣.♣.♣...P....P..♣♣. .♣........♣.♣.Ski!h♣♣. ♣........♣......♣♣. ♣.♣.♣P.P.P.P.♣.......♣♣..♣♣. .♣..♣ß.ß.ß.ß.♣♣........♣♣...♣.SkiWSkiSki&80Ski˓SkiוSkiFmz≈▓ #≈#≈≈≈▓▓#▓▓##.#▓▓##..∩......∩.▓##.#.++++#♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣♣.P.P.P.P♣.♣.♣...P....P..♣♣. SkiHG!♣........♣.♣.♣♣. ......♣......♣♣. .♣.♣P.P.P.P.♣.......♣♣..♣♣. ♣..♣ß.ß.ß.ß.♣♣........♣♣...♣.SkiQSki5R%1Ski0X&PSki ZSki%(≈▓ ≈#≈≈≈▓▓#▓▓▓##.#▓▓##..∩......∩..#▓##.#.++++# .♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣.♣.P.P.P.P♣.♣.♣...P....P..♣♣. ......♣.♣.♣♣......♣......♣♣. ♣.♣P.P.P.P.♣.......♣♣..♣♣. ..♣ß.ß.ß.ß.♣♣........♣♣...♣.SkiSkiy%2Ski۱BPSkiSki}▓≈#≈≈≈▓▓#▓▓▓##.##▓▓▓##..∩......∩..#▓##.##.++++# ♣♣.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣. .♣.P.P.P.P♣.♣.♣...P....P..♣♣.Ski....♣.♣.♣♣.....♣......♣♣. .♣P.P.P.P.♣.......♣♣..♣♣. .♣ß.ß.ß.ß.♣♣........♣♣...♣.SkiNSkiʜ%3SkiGSki3▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓▓##..∩......∩..##▓▓##.##.#++++#SkiЩ.ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣. ♣.P.P.P.P♣.♣.♣...P....P..♣♣....♣.♣........♣♣.Ski...♣......♣♣. ♣P.P.P.P.♣.......♣♣..♣♣. ♣ß.ß.ß.ß.♣♣........♣♣...♣.SkiSki^%4SkiISkiNSki▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓##.##▓#.#▓++++## .ß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣. .P.P.P.P♣.♣.♣...P....P..♣♣....♣.♣........♣♣..♣......♣♣.... P.P.P.P.♣.......♣♣..♣♣.. ß.ß.ß.ß.♣♣........♣♣...♣.SkiSki%5SkiISkiSkiUi ▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.##▓≈Skii>#.#▓++++#Skii▓# Skiiß.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣. SkijP.P.P.P♣.♣.♣...P....P..♣♣..♣.♣........♣♣..♣......♣♣..... .P.P.P.♣.......♣♣..♣♣... Ski:j`.ß.ß.ß.♣♣........♣♣...♣.Skix;6Ski"{BPSkiD}Skij▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.##▓≈#.#▓▓≈++++#▓#.## Skij.ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣. .P.P.P♣.♣.♣...P....P..♣♣..♣.♣........♣♣.♣......♣♣...... SkiP.P.P.♣.......♣♣..♣♣... ß.ß.ß.♣♣........♣♣...♣..#SkiSkiSkiz%7SkimP....PSkiSkis▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.##▓≈#.#▓▓≈++++#▓###▓#▓# Skiqß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣......# P.P.P♣.♣.♣...P....P..♣♣.#♣.♣........♣♣.#♣......♣♣......# .P.P.♣.......♣♣..♣♣.....# .ß.ß.♣♣........♣♣...♣...##SkiSki%8SkiSki "▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.##▓≈#.#▓▓≈Ski c++++#▓▓▓≈###▓≈#▓##▓ Ski W.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓ .P.P♣.♣.♣...P....P..♣♣.#▓Ski] !♣.♣........♣♣.#▓♣......♣♣.....#▓ P.P.♣.......♣♣..♣♣....#▓ Ski ß.ß.♣♣........♣♣...♣...#▓##▓SkiSki%9SkiSkiSkiP▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.##▓≈#.#▓▓≈++++#▓▓▓≈###▓≈#▓▓≈##▓≈ SkiPß.ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓≈ P.P♣.♣.♣...P....P..♣♣.#▓≈♣.♣........♣♣.#▓≈♣......♣♣.....#▓≈ .P.♣.......♣♣..♣♣....#▓≈ .ß.♣♣.♣♣...♣...#▓≈##▓≈Ski`YSkiY&90Ski']&PSkir^Ski<?▓≈#≈≈≈▓▓#▓▓≈▓▓##.##▓▓≈▓▓##..∩......∩..##▓▓≈▓##.##▓≈#.#▓▓≈++++#▓▓▓≈###▓≈#▓▓≈##▓≈ .ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓≈ .P♣.♣.♣...P....P..♣♣.#▓≈♣.♣........♣♣.#▓≈♣......♣♣.....#▓≈ P.♣.......♣♣..♣♣...#▓≈ ß.♣♣.♣♣...♣..#▓≈##▓≈Ski,ESkiE%1SkiKBPSkiMSkiK ≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈≈###########▓▓≈≈..##▓▓≈≈▓▓##..∩∩..##▓▓≈ ≈≈≈≈≈≈▓###▓≈≈ ▓▓▓▓▓▓▓#................#▓▓≈≈≈ ##############++++########▓▓▓≈###▓≈≈#▓▓≈≈z ...........................##▓≈ ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓≈ P♣.♣.♣...P....P.......#▓≈♣........♣♣..........#▓≈ ....♣......♣♣...............#▓≈ .♣.......♣♣..♣♣...#▓≈ .♣♣♣♣...♣▓≈SkiW Skip R2PSkiҽ ▓▓▓▓▓▓▓############▓▓##..........###..∩......∩..#......................''''Ski_ Ski %3Ski# BPSki 5 _You reach down and open the huge gate.Ski e _Found two gates leading back out of this place.Ski}M#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓▓▓≈#≈≈≈▓▓############▓▓≈≈▓▓##..Ski..##▓▓≈▓##..∩∩..##▓ ≈≈≈≈≈≈▓##.....##▓≈ ▓▓▓▓▓▓▓#................#▓▓≈≈ ##############''@'########▓▓###▓≈≈≈≈▓▓≈≈z Skivf...........................##▓≈≈≈ Fly .. .....♣♣.SkiESki`,4 _Skib&PSkiU _There is a huge open gate here.TkiZ≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓#≈≈≈▓▓############▓≈≈▓▓##....#TkiZ ≈▓▓##..∩∩..##▓▓ ≈≈≈≈≈≈≈▓### ▓▓▓▓▓▓▓▓#.......@........#▓▓≈ ###############''''########▓▓▓........###▓≈≈≈...#▓▓ ......................#▓ Tki[.ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓ .P♣.♣.♣...P....P..♣♣.#▓..♣.♣........♣♣.#▓ .....♣......♣♣..#▓Tki2pTkiq,5 _TkixBPTkiTki≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓#≈≈≈▓▓############≈≈▓▓##....#≈▓▓##..∩∩..##▓▓ ≈≈≈≈≈≈≈≈▓### ▓▓▓▓▓▓▓▓▓#................#▓▓≈ ################''''########▓▓▓.........###.......#▓▓ .......................#▓ ß.ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓ P.P♣.♣.♣...P....P..♣♣.#▓..♣.♣........♣♣.#▓TkiTki^%6TkiTki,Tki* :z≈≈≈≈#≈≈#≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈≈▓▓▓▓▓▓▓▓▓▓▓▓#≈≈≈▓▓##########≈≈▓▓##..≈▓▓##..∩∩..##▓▓ ≈≈≈≈≈≈≈≈≈▓### ▓▓▓▓▓▓▓▓▓▓#................#▓▓≈ #################''''########▓▓▓.......###....#▓▓ z   weeping skull (wandering) ........................#▓ .ß.ß♣..♣....ß.♣♣.ß...♣♣.♣......#▓P.P♣.♣.♣...P....P..♣♣.#▓Tkik3 2≈Tki: zYou encounter a weeping skull.Tki4; %7Tki@ TkiTC : _The weeping skull leaves your sight.Tki7 X≈z≈#≈≈#≈▓▓▓▓≈#≈≈≈▓▓#####▓▓≈▓▓##.##▓▓≈▓▓##...∩..##▓▓≈▓##.##▓▓#.#▓▓##''''#▓▓▓............###▓..#...## ß.ß.ß♣..♣....ß.♣♣.ß...♣♣.♣......# P.P.P♣.♣.♣...P....P..♣♣.#TkiD 2zTkiNQ ≈z   weeping skull (wandering)TkiQ TkiR %8Tki^ Tkig j _There is a gate leading back out of this place here.UkisUkiUkiUkiڔ2≈Uki)UzUkiA,9 _UkiOUki U 0Dungeon:8Uki\ ) .. ##.#.## ########### ...##........#........'. ..#.........#........#. ........#..+........#. #.#.......##....##.## ....#....##....##.## #........#......... #.@......#......... #........'.........Uki] w .....#......##....##.). ........#...##....# (.. ....#..............# .. ...........#.......# ...................# .....#.#.........?.# ....#.......##....#UkiN .200.6 (2.5Ukiz Uki + _Welcome back to the Dungeon!UkiC Y _There is a collapsed entrance here.Vki#Vki$Vki*Vki. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)VkiVkihVki&VkiJ _You can't see any susceptible monsters within range! (Use Z to cast anyway.)Vki Vki VkiԸ Vki VkiN Vki | _Vki; Vki Vki5 Vki VkiG Vki VkiM VkiL Vkif Vki Vki Vki Vki Vki Vki i  You encounter an elephant.Vki ....#....##....##.## ###........#......... #.#........#......... ##........'.........< .....#......##....##.)... ........#...##....# (..... #.....#..............# ... #............#.......# #.............@.....# +.....#.#.........?.# #....#.......##....# .... #.......#kil 37m ....# .#...P..PP ...##$......P P..# Y   elephant (trample, asleep)+....PP.. ..#.PP.Y ..# Vki" -5.6 (5.0Vki 16.6 (6 _Vki Wkik   #........#.........  #........#.........  #........'.........<  .....##....##.)...  ........#...##....# (.....  .............# ... Wkiؘ .....#.......#  .......@.....#  .#.........?.#  ....#.......##....#  .. #.......# ....#  #...P..PP ...# Wki #$......P P..#  +....PP.. ..#  ...PP.Y ..# Wki".   #........#.........  #........#.........  #........'.........<  .....##....##.)...  ........#...##....# (.....  .............# ...  .....#.......#  .......@.....#  .#.........?.#  ....#.......##....#  .. #.......# ....#  #...P..PWki.$P ...# #$......P P..#  +....PP.. ..# ...PP.Y ..# WkiS6Wki6Wki=WkiA` _An elephant is nearby!Wki U   #........#.........  Wki6#........#.........  #........'.........<  .....##....##.)...  ........#...##....# (.....  WkiVF.............# ...  .....#.......#  Wkiw.......@.....#  .#.........?.#  ....#.......##....#  .. #.......# ....#  Wki#...P..PP ...#  #$......P P..#  +....PP.. ..#  ...PP.Y ..# WkiJ   #........#.........  #........#.........  #........'.........<  .....##....##.)...  ........#...##....# (.....  .............# ...  Wki E.....#.......#  .......@.....#  .#.........?.#  ....#.......##....#  .. #.......# ....#  #...P..PP ...# #$......P P..#  WkiF+....PP.. ..# ...PP.Y ..# Wki;WkiҕWkiWki` _An elephant is nearby!Wki  #........#......... #.............'.<WkieB.....#......##....##.)......#...##....# (.........#.......... ... .......# .......+#.#.?Wki# ......##..... .. # .Wki 6 #...P..PP . $......P P.+....PP.. .. ...PP.Y ..#..PPWkiWki17.6 (1 _WkiWki(Wki  #.#. # #........'.< #.....#......##....##.)... # ........#...##....# (..... ##..............# ... # ...........#.# # ......# + .....#.#?.# # ....#.##....#. .. #.# ....#  #...P..PP ...#Wki< [39;49m  #$......PP P..# +....PP..P. ..# #...PP.Y.lP...#P.....PP.P... l   komodo dragon (asleep)P..####...P.Wki. ;8WkiW Wki ^ _You encounter a komodo dragon.Wki,!'WkiX<.....#......##....##.)...Wki....#...##....# (.........#..............# ... .......#.......# ..............#+Wki#.#.........?.## ......##....#WkiMf.. ..   #...P..PP.....# $......PPPP..#+....PP..P.P..##...PP.Y.lP...#Wki|P.....PP.P....#..P..####...P.#... ......Wki;9Wki6WkiXkirR Xki[  Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d + Olgreb's Toxic Radiance Alchemy1% 4 e - Sticky FlameFire/Alchemy2%4 Select a spell to describe [?] help [!]/[I] toggle spell headersYki1oYkiwYki#........'.........< # ludeguy the Toxicologist.....#......##....##.)... # Octopode of Gozag Gold: 1017........#...##....# (..... # Health: 71/71 ========================Yki o....#..............# ... # Magic: 16/16 ========================...........#.......## AC: 3Str: 13...................#+ EV: 15Int: 20.....#.#.........?.## SH: 0Dex: 21Yki....#.......##....#.. XL: 10 Next: 25% Place: Dungeon:8.. #......@# ....#.. Noise: ---------  Time: 9209.6 (0.0)#...P..PP.....#c) +0 dagger (protect)#$......PPPP..#Cast: Poisonous Vapours+....PP..P.P..#Fly YkiF#...PP.Y.lP...#P.....PP.P....#YkiY   elephant (trample, asleep)..P..####...P.#Ykil   komodo dragon (asleep)..... ...... Yki_You can't see any susceptible monsters within range! (Use Z to cast anyway.) Yki?_You can't see any susceptible monsters within range! (Use Z to cast anyway.) _You encounter an elephant. Ykib_An elephant is nearby! _An elephant is nearby! _You encounter a komodo dragon.YkiYkiNYki]Yki!Yki.  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Zki).#......##........#...##.....................#..............#.#......#.......##......@##...P..PP.....##$......PPPP..#+....PP..P.P..##...PP.Y.lP...#.....PP.P....#Ypoisoned)..P..####...P.#lpoisoned)..... ......  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.  You feel a surge of power! You begin to radiate toxic energy.  The elephant trumpets!  The elephant is poisoned.  The komodo dragon hisses angrily.ZkiZ .#......##........#...##.....................#..............#.#......#.......##......@##...P..PP.....##$......PPPP..#+....PP..P.P..##...PP.Y.lP...#.....PP.P....#..P..####...P.#..... ......Zkin l.  The komodo dragon is poisoned. The elephant looks even sicker.Zkio6Y.Zki7{I very poisoned)Zki |i2------===10.6 (1Zki/|iPoisonous VapoursToxic Fly ZkimZki' _You hear a shout!Zki #  #........'.........< .#......##....##.)...  ........#...##....# (.....#..............# .........#.......##..............#+.#.........?.# #....#.. #.......# ....#.....P..PP.....##$......PPPP..#+....PPYlP.P..##...PP....P...#Zki P.....PP.P....#P..####...P.#..... ......Zkiu 6l.Zkig 5Y.Zki 8l.Zki 9 Zki /---1Zkij% Zki}( 5 _The elephant looks even sicker.[kiD3#..#.  #........'.........< [ki.#......##....##.)...  ........#...##(.....#................##.....+.....#.#....@....?.# #....#....#.. #.......# ....#.....P.lPP.....##$....Y.PPP+....PP..P.P#...PP....P..P.....PP.P....P..####...P.#[ki* Y.  The komodo dragon looks even sicker.[kia8l.[kiHvery poisoned)[ki---2Fly [kiR[kiV _Your toxic aura wanes.[ki9 ....#....##....##.## ##........#.. #.#........#.. #. #........'.........< #......#......##....##.)... #.....#...##....# (..... #.....#........# ... #......## #...........# +......#.#...?.# #....#.##....# ... #......l# ....# ...#...PY.PP..[ki B...##$......PPPP..# +....PP..P.P..# #...PP....P...#P.....PP.P....#[ki 8Y.[ki/ :l.[ki|[kiM%3[kiM [ki \ki#.#.......##....##.########.....#....##....##.## ####........#.. #.#........#. #. #........'.........< #......#......##....##.)... #.....#...##....# (..... #.....#.# ... #......## #...........# +......#.#.........?.# #....#......l##....# .\kij.. #.....Y.# ....# ....#...P..PP.....# #$......PPPP..# +....PP..P.P..##...PP....P...#\ki8Y.\ki$l\ki.\ki\ki&------\ki4\ki\kiN\ki ........#..+........#........#.#.......##....##.########......#....##....##.## #####........#. #.#........#... #. #........'.........< #.\ki{ .....#......##....##.)... #.....#...##....# (..... #.....#........# ... #..## #....................# +......#.#.....l...?.# \kiE #....#.....Y.##....# ... #.......##....# .....#...P..PP.....# #$......PPPP..#+.P.P..#\ki& 9Y.\ki ;l.\ki \kid %5\kiI \kiV ]kir..#..#.#.........#..+........#........#.#.......##....##.########......#....##....##.## ######........#.]kia #.#........#... #...# #........'.........< #...#.....#......##....##.)... #.....#...##.@..# (..... #. ....#.# ... #. .#.......# #. ..............l....# +. ]kiŰ.....#.#....Y....?.# #....#.##....# ... #.......##....# ]ki......#...P..PP.....##$......PPPP..#]ki9Y.]ki ;l.]ki]kiS3=6]ki]ki9]kiT?  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.]ki ? ..#.........#........#.......... ludeguy the Toxicologist  ........#..+........#.......... Octopode of Gozag Gold: 1017  #.#.......##....##.########..# Health: 71/71 ========================  ....#....##....##.## ##### Magic: 10/16 ===============--------- #........#......... #.... AC: 3Str: 13 #........#......... #...# EV: 15Int: 20 #........'.........< #...# SH: 0Dex: 21  .....#......##....##.)... #.... XL: 10 Next: 25% Place: Dungeon:8 ]ki  ........#...##.@..# (..... #.... Noise: ---------  Time: 9216.6 (0.0) ....#.........***..# ... #.... c) +0 dagger (protect) ...........#..*l*..# #.... Cast: Poisonous Vapours .............Y***..# +.... Fly .....#.#.........?.# #....  ....#.......##....# ...... Y   elephant (trample, very poisoned)  .. #.......##....# ...... l   komodo dragon (very poisoned) #...P..PP.....#  #$......PPPP..# _Your toxic aura wanes.Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: [39;4]ki 9ma komodo dragon (heavily wounded, very poisoned, chance to affect: 62%)^ki *@*l...^ki.@*l***Aim: a komodo dragon (heavily wounded, very poisoned, chance to affect: 62%)^kiB ***.**l.Y**._ki: ..#.........#........#.......... ludeguy the Toxicologist........#..+........#.......... Octopode of Gozag Gold: 1017#.#.......##....##.########..# Health: 71/71 ========================....#....##....##.## ##### Magic: 10/16 ===============---------#........#......... #.... AC: 3Str: 13#........#......... #...# EV: 15Int: 20#........'.........< #...# SH: 0Dex: 21  .....#......##....##.)... #.... XL: 10 Next: 25% Place: [39;4_ki99mDungeon:8  ........#...##.@..# (..... #.... Noise: ---------  Time: 9216.6 (0.0) ....#........###...# ... #.... c) +0 dagger (protect) ...........#.###...##.... Cast: Poisonous Vapours .............###...#+.... Fly .....#.#.........?.##........#.......##....#...... Y   elephant (trample, very poisoned).. #.......##....#...... l   komodo dragon (very poisoned)#...P..PP.....##$......PPPP..#[3_ki6mConfirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineYou feel a surge of power!  The flask of dizzying concoctions shatters into a vile cloud!  The elephant is lightly wounded._kiW_ki!Y.  Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  You feel a surge of power!  The flask of dizzying concoctions shatters into a vile cloud!elephant is lightly wounded.  The komodo dragon is heavily wounded._kiu oYou hear a shout! x3_kiI;l._ki§§.§☼§o   orc=======7.6 (1_kiG_kiv _You encounter an orc. It is wielding a +0 short sword.`kiJB..##.'.# ..#...#........#.#........#..+........#........#.#.......##....##.########......#....##....##.##. ######........#.#.....#........#... #...#. #........'.........< #...## .....#......##..@.##.)... #.....#...##....# (..... #.#........§§.l..# ... #..#.§Y....# #.........☼§...# +. ....#.#...?.# # ....#.##....# ... #.......##....#`kiC ......^#...P.oPP.....#`ki|C ○YThe elephant is engulfed in noxious fumes.`kiD3o`kiE;l.`kiP °Y  confused, very poi…)`kiQo   orc.The elephant appears confused.  The komodo dragon attacks as it pursues you!`kiPRS=------8`kiZ`ki\^ _The komodo dragon completely misses you.akio* Y.  You barely miss the komodo dragon. Your squeeze misses the komodo dragon.o.akioo;☼○aki^pK------9.4 (0.8akiwaki,{e _The komodo dragon is heavily wounded.bki   Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.bkix..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================  #.#.......##....##.########..## Magic: 6/16=========---------------  ....#....##....##.##. #####. AC: 3Str: 13  #........#.......... #..... EV: 15Int: 20  #........#.......... #...#. SH: 0Dex: 21  #........'.........< #...## XL: 10 Next: 25% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: =--------  Time: 9219.4 (0.0) ........#...##..l.# (..... #..... c) +0 dagger (protect) bki...#........§☼.Y..# ... #..... Cast: Poisonous Vapours ..........#.§°....# #..... Fly .............○§...# +..... ....#.#.........?.# #..... Y   elephant (trample, confused, very poi…)....#......o##....# ....... l   komodo dragon (poisoned)  .. #.......##....# ......^ o   orc  #...P..PP.....# _The komodo dragon is heavily wounded.Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a komodo dragon (heavily wounded, poisoned)bkin M..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================#.#.......##....##.########..## Magic: 6/16bkio =========---------------....#....##....##.##. #####. AC: 3Str: 13#........#.......... #..... EV: 15Int: 20#........#.......... #...#. SH: 0Dex: 21#........'.........< #...## XL: 10 Next: 25% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: =--------  Time: 9219.4 (0.0) ........#...##..l.# (..... #..... c) +0 dagger (protect) bkio -...#........§☼.Y..# ... #..... Cast: Poisonous Vapours bkio 1..........#.§°....##..... Fly .............○§...#bkip {+..... ....#.#.........?.#bkiAp 8#..... Y   elephant (trample, confused, very poi…)....#......o##....#bkicp ....... l   komodo dragon (burning, poisoned)bkip 7.. #.......##....#......^ o   orcbkip #...P..PP.....#Aiming: Sticky Flame (dangerous; 2% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a komodo dragon (heavily wounded, poisoned)  You feel a surge of power!  bkip The sticky flame hits the komodo dragon!  The komodo dragon is severely wounded.bkiT D$: a komodo dragon (heavily wounded, poisoned)  You feel a surge of power!  The sticky flame hits the komodo dragon!  The komodo dragon is severely wounded.bki hkomodo dragon is covered in liquid fire!  The komodo dragon burns!bki H.Ybki ;o.bki{ .o   orcbkiU 1017 7-33==bki P20.4 (1 _You kill the komodo dragon!bkiC bkil k _Your Fire Magic skill increases to level 3!cki ckiy Z Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  cki  d - Olgreb's Toxic RadianceAlchemy1%4  e + Sticky FlameFire/Alchemy2% 4 Select a spell to describe [?] help [!]/[I] toggle spell headersdkidkidkik..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017 ........#..+........#..........# Health: 71/71 ========================#.#.......##....##.########..## Magic: 6/17dkiGE========----------------....#....##....##.##. #####. AC: 3Str: 13#........#.......... #..... EV: 15Int: 20dkiP#........#.......... #...#. SH: 0Dex: 21#........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: ===------  Time: 9220.4 (0.0) dki<........#...##..$.# (..... #..... c) +0 dagger (protect) dki ...#........§☼....# ... #..... Cast: Poisonous Vapours ..........#.§...Y.#dki1#..... Fly .............○§...#+..... dkiWA....#.#.....o...?.##..... Y   elephant (trample, confused, very poi…)dkiz....#.......##....#....... o   orcdki.. #.......##....#......^dkim#...P..PP.....#The sticky flame hits the komodo dragon!  dkiThe komodo dragon is severely wounded.The komodo dragon is covered in liquid fire!  The komodo dragon burns! dki_You kill the komodo dragon! _Your Fire Magic skill increases to level 3!dki dkidkidkiddkiJ  Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.dkiG ..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================  #.#.......##....##.########..## Magic: 5/17=======-----------------  ....#....##....##.##. #####. AC: 3Str: 13  #........#.......... #..... EV: 15Int: 20  #........#.......... #...#. SH: 0Dex: 21  #........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: ===------  Time: 9220.4 (0.0) ........#...##..$.# (..... #..... c) +0 dagger (protect) ...#........§dki ☼....# ... #..... Cast: Poisonous Vapours ..........#.§...Y.# #..... Fly .............○§...# +..... ....#.#.....o...?.# #..... Y   elephant (trample, confused, very poi…)....#.......##....# ....... o   orc  .. #.......##....# ......^  #...P..PP.....# _Your Fire Magic skill increases to level 3!Casting: Sticky Flame (dangerous; 2% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an elephant (moderately wounded, confused, very poisoned)dki/ ..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================  #.#.......##....##.########..## Magic: 5/17=======-----------------  ....#....##....##.##. #####. AC: 3Str: 13  #........#.......... #..... EV: 15dki0 0Int: 20  #........#.......... #...#. SH: 0Dex: 21  #........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: ===------  Time: 9220.4 (0.0) ........#...##..$.# (..... #..... c) +0 dagger (protect) ...#........§☼....# ... #..... Cast: Poisonous Vapours ..........#.§.....# #..... Fly .............○§..Y# +..... ....#.#.....o...?.# #..... Y   elephant (trample, confused, very poi…)....#.......##....# ....... o   orc  .. #.......##....# ......^  #...P..PP.....#dki0 Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an elephant (moderately wounded, confused, very poisoned)  You feel a surge of power!  dki1 3Poisonous fumes billow around the elephant!dki;3 :o.dki= 6#......  ........#  #....##.#  ...##....##.##.  #........#....  #........#....  #...........< #..@.##.)... #..$.# (..... .☼○....# ... #.§.....# ...o°☼..Y# .......?.# ...##....#  .. #.......##....# ^  dki> q--1.4 (1Poisonous VapoursdkiG dkiMK   Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an elephant (moderately wounded, confused, very poisoned)  You feel a surge of power!  Poisonous fumes billow around the elephant! _The elephant looks even sicker.fki..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017 ........#..+........#..........# Health: 71/71 ========================#.#.......##....##.########..## Magic: 3/17====--------------------fki1....#....##....##.##. #####. AC: 3Str: 13#........#.......... #..... EV: 15Int: 20#........#.......... #...#. SH: 0Dex: 21#........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 fkiʚ.....#......##..@.##.)... #..... Noise: =--------  Time: 9221.4 (0.0) ........#...##..*.# (..... #..... c) +0 dagger (protect) ...#........☼○..*.# ... #..... Cast: Poisonous Vapours ..........#.§....*##..... Fly ............o°☼..Y#fki +..... ....#.#.........?.##..... Y   elephant (trample, confused, very poi…)....#.......##....#fki`....... o   orc.. #.......##....#......^#...P..PP.....#Confirm with . or Enter, or press ? or * to list all spells.fkiXAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an elephant (moderately wounded, confused, very poisoned, chance to  weaken: 40%)  fki՛AYou feel a surge of power! The glob of mercury hits the elephant.fkiWI.Yfki;o.fki %H$..fkiJ&z4==2.4 (1Poisonous Vapoursfki -fki.1  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: an elephant (moderately wounded, confused, very poisoned, chance to  weaken: 40%)  You feel a surge of power! The glob of mercury hits the elephant. _The elephant is moderately wounded.gkim $gkin ..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================  #.#.......##....##.########..## Magic: 3/17====--------------------  ....#....##....##.##. #####. AC: 3Str: 13  #........#.......... #..... EV: 15Int: 20  #........#.......... #...#. SH: 0Dex: 21  #........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: ==-------  Time: 9222.4 (0.0) ........#...##..$.# (..... #..... c) +0 dagger (protect) ...#........☼○....# ...gki#o  #..... Cast: Poisonous Vapours ..........#.§o....# #..... Fly .............°☼...# +..... ....#.#.........Y.# #..... Y   elephant (trample, confused, very poi…)....#.......##....# ....... o   orc  .. #.......##....# ......^  #...P..PP.....#Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +0 short sword and wearing a +0 chain mail  gkiYo IYou feel a surge of power! Poisonous fumes billow around the orc!gkiLp ;o.gkix #......  ........#  #....##.#  ...##....##.##.  #........#gkiy ....  #........#....  #...........< #..@.##.)... #..$.# (..... .○°o...# ... #.☼.....# .....○...# .......Y.# ...##....#   orc (poisoned)  .. #.......##....# ^  gki{ 2-3.4 (1gkiǀ gkiZ Sonfirm with . or Enter, or press ? or * to list all spells.gki Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: an orc, wielding a +0 short sword and wearing a +0 chain mail  You feel a surge of power! Poisonous fumes billow around the orc! _The orc is poisoned.hkiF  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.hki:..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================  #.#.......##....##.########..## Magic: 2/17==----------------------  ....#....##....##.##. #####. AC: 3Str: 13  #........#.......... #..... EV: 15Int: 20  #........#.......... #...#. SH: 0Dex: 21  #........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 .....#......##..@.##.)... #..... Noise: =--------  Time: 9223.4 (0.0) ........#...##..$.# (..... #..... c) +0 dagger (protect) ...#........○ki:nm°o...# ... #..... Cast: Poisonous Vapours ..........#.☼.....# #..... Fly ..............○...# +..... ....#.#.........Y.# #..... Y   elephant (trample, confused, very poi…)....#.......##....# ....... o   orc (poisoned)  .. #.......##....# ......^  #...P..PP.....#Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +0 short sword and wearing a +0 chain mail (severelywounded, poisoned)hki..##........#........'..........# ludeguy the Toxicologist hki..#.........#........#..........# Octopode of Gozag Gold: 1017  ........#..+........#..........# Health: 71/71 ========================  #.#.......##....##.########..## Magic: 2/17hkiI==----------------------  ....#....##....##.##. #####. AC: 3Str: 13  #........#.......... #..... EV: 15Int: 20 hkia #........#.......... #...#. SH: 0Dex: 21 hki #........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 hki.....#......##..@.##.)... #..... Noise: =--------  Time: 9223.4 (0.0) hki........#...##..$.# (..... #..... c) +0 dagger (protect) hki...#........○°$...# ... #..... Cast: Poisonous Vapours hki..........#.☼.....# #..... Fly ..............○...# +..... hki....#.#.........Y.# #..... Y   elephant (trample, confused, very poi…)hki7....#.......##....# ....... o   orc (poisoned) hkiOF .. #.......##....# ......^  #...P..PP.....#hkifMConfirm with . or Enter, or press ? or * to list all spells.hki}Aiming: Poisonous Vapours (safe; 1% risk of failure)  hki3Press: ? - help, Dir - move targethkiAim: an orc, wielding a +0 short sword and wearing a +0 chain mail (severelywounded, poisoned)  hkiIYou feel a surge of power! Poisonous fumes billow around the orc!hkit G?Yhki#......  ........#  #....##.# hkiQ+ ...##....##.##.  #........#....  #........#....  #...........< #..@.##.)... #..$.# (..... hki .○°$...# ... #.☼.....# .....○...# .......?Y# ...##....#   .. #.......##....# ^  hkirh4.4 (1Poisonous Vapourshki"hki/ MAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targethkix 9: an orc, wielding a +0 short sword and wearing a +0 chain mail (severelywounded, poisoned)  You feel a surge of power! Poisonous fumes billow around the orc! _You kill the orc!jkivpjkiFr Your spells (describe)TypeFailure Level  a + Poisonous VapoursjkirAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%jkiro3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemyjkis82%4 jki>sSelect a spell to describe [?] help [!]/[I] toggle spell headerskki kki kki..##........#........'..........# ludeguy the Toxicologist ..#.........#........#..........# Octopode of Gozag Gold: 1017 kki ........#..+........#..........# Health: 71/71 ========================#.#.......##....##.########..## Magic: 2/17==----------------------kkis....#....##....##.##. #####. AC: 3Str: 13#........#.......... #..... EV: 15Int: 20#........#.......... #...#. SH: 0Dex: 21#........'.........< #...## XL: 10 Next: 33% Place: Dungeon:8 kkim.....#......##..@.##.)... #..... Noise: =--------  Time: 9224.4 (0.0) kki&........#...##..$.# (..... #..... c) +0 dagger (protect) ...#........○°$...# ... #..... Cast: Poisonous Vapours ..........#.☼.....##..... Fly ..............○...#+..... kki_}....#.#.........?Y##..... Y   elephant (trample, confused, very poi…)....#.......##....#kki......... #.......##....#......^#...P..PP.....#kki9Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc, wielding a +0 short sword and wearing a +0 chain mail (severelykkiwounded, poisoned)  You feel a surge of power! Poisonous fumes billow around the orc! _You kill the orc!kki%kki&kki5/kki2kki7T ##.#.## #################.###..' ..#...##........#..+........#..........#.#.....#.########..##....#....##....##.##. #####....kkiT#..  #........'..@......< ###......##....##.)... .....#...##..$.# (.....#..○°$....#.☼..#...kkiBU@○...+#.........?Y # ....#... #.......##......^kkitUkki+X4Y.kkih°.○°Yvery poisoned)-5.4 (1kkiXkkki9o7 _The elephant seems less confused.lkiC #.##..  ##.#.## #################.###. .##........'.#. .#..#........#.#. ........#..+........#..........#.#.#.......##....##.########......#....##....##.##.. ######........#.#.....ß#........#.. #...#.[  #..'.........<. #...###......##....##.)... #.....>....#...##..$.# (..... #.....<#.°.$...# .... #.#.○.....# .. #....°.Y.# . +.#.#...?.# # ...#.##....# ..Ylki}D .lki%NlkiN?-6lkiVlkiYlki# #.#..ß #.##..  ##.#.## #################.###.# ##........'.#.# #..#........#.#.# .......#..+........#..........#.# #.#.......##....##.########..##.#lki ....#....##....##.##... #####...#.#.#.....ß.#........#... #...#.[  #..'.........<.. #...##.##......##....##.).... #.....>.....#...##..$.# (..... #.....<#.°.$...# ...... #.lkim g#.○....Y# ..... #....°...# ..... +.#.#...?.# #lki 6Y.lkil V.°....lkie %7lki lki lki #.#..ß.#.##...# ##.#.## ##########.###.# #.#........'.#.# .#........#.#.# #..+........#.#.# .#.##....##.########..##.# ....#....##....##.##....#####...##.#.#.....ß.#.#.#...#.[.##.'.<...#...##.##......##....##.).....#.....>.#...##..$.# (......#.....<. #...$..Y# .#.#.°.....# .......#..# .......+. .#.#.?.# #.Y.10178ki/ 49mmkix#.#..ß.#.##...# #.#.## ###########.###.## .#........'.#.# #........#.#.# #..+........#.#.# #.##....##.########..##.## #....##....##.##....#####...# #.#.#.....ß. #.#.#...#.[.# #.'.<...#...##.##. .#......##....##.).....#.....>..##...##..$Y##(......#.....<..# .$...#..#.##.°.....#..#.mkiXy#..#..+.# #.#.?.# #.#mki]{8Y.mki·8.mkiPn3==9Poisonous VapoursmkitmkiYmki!6F#.#..ß.#.##...# .#.## ###########.###.## #........'.#.# #........#.#.# #..+........#.#.# .##....##.########..##.## #....##....##.##....#####...# .#.#.....ß. .#.#...#.[.# .'.<...#...##.##. #......##...Y##.).....#.....>..# #...##..$.$...#.#.# #.........# mkik79Y.mki`CmkiID&30mki)Kmki1Omkiw#.##...#### #.## #################.###.## .....#........'..........#.# #..#.#.# #..+..#.#.# mki..##....##.########..##.# .#....##....##.##....#####...####.....#.............#.....ß.....#.#...#.[.####'....Y....<...#...##.##...##....##.).....#.....>..# mkil=..#...##..$.##(......#.....<..# .....$...#........#...##.......#.#.# .......#.+ #?.########+#.....##....# ...$#mkijA.Ymkimki%1mkimkimki!Z n.## #################.###.## .....#........'..........#.# #........#.#.# #..+..#.#.# mkiZ ..##....##.########..##.## # #....##....##.##....#####...##### ......#.............#.....ß......#.#...#.[.#####'.....Y#...##.##...##....##.).....#.....>..# mki[ #...##..$.##(......#.....<..# #.....$...#........#........# #.......#.#.mkiU[ +.# ?.########+# mki[ .....##....# ...$###....# mki[ ]......^#mki4] =.YmkiBh mkiQi %2mkiZs mkit a _There is a stone staircase leading up here.nki$  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.nkigF.## #################.###.## # ludeguy the Toxicologist .....#........'..........#.#  Octopode of Gozag Gold: 1017 .....#........#..........#.#  Health: 71/71 ======================== ..#..+........#..........#.#  Magic: 0/17------------------------ .....##....##.########..##.## # AC: 3Str: 13 #....##....##.##....#####...##### EV: 15Int: 20 ......#.............#.....ß...... SH: 0Dex: 21 nki}i......#.....***.....#...#.[.##### XL: 10 Next: 33% Place: Dungeon:8 ......'.....*Y**@...#...##.##...# Noise: ---------  Time: 9232.4 (0.0) .....##....##**.....#.....>..#  c) +0 dagger (protect) .#...##..$.##(......#.....<..# # Cast: Poisonous Vapours .......$...#........#........#  Fly ...#.......#........#........# ...........#........+........#  Y   elephant (trample, very poisoned) .........?.########+#........# .....##....# .........$# .....##....# ......^...# _There is a stone staircase leading up here.  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: an elnkiioephant (heavily wounded, very poisoned, chance to affect: 58%)nki] .## #################.###.## # ludeguy the Toxicologist .....#........'..........#.#Octopode of Gozag Gold: 1017 .....#........#..........#.#Health: 71/71 ======================== ..#..+........#..........#.#Magic: 0/17------------------------ .....##....##.########..##.## # AC: 3Str: 13 #....##....##.##....#####...##### EV: 15Int: 20 ......#.............#.....ß...... SH: 0Dex: 21 nki] `......#.....###.....#...#.[.##### XL: 10 Next: 33% Place: Dungeon:8 ......'.....###*@...#...##.##...# Noise: ---------  Time: 9232.4 (0.0) .....##....####.....#.....>..#c) +0 dagger (protect) .#...##..$.##(......#.....<..# # Cast: Poisonous Vapours .......$...#........#........#Fly ...#.......#........#........# nkiV^ ...........#........+........#Y   elephant (trample, very poisoned) .........?.########+#........# .....##....#.........$# .....##....#nki^ <......^...#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linenki_ Aim: an elephant (heavily wounded, very poisoned, chance to affect: 58%)  You feel a surge of power!  The flask of dizzying concoctions shatters into a vile cloud!nki/ nkiQ §YAim: an elephant (heavily wounded, very poisoned, chance to affect: 58%)  You feel a surge of power!  The flask of dizzying concoctions shatters into a vile cloud!  The elephant is heavily wounded.hear a shout!elephant is engulfed in noxious fumes.nkie §§§°§Y.§☼Yconfused, poisoned)nkig =======3.4 (1Poisonous Vapoursnki%v nki~  nki ._The elephant appears confused.oki #.## #.###.## .#........'.#.#.#........#.#.#.#..+........#.#.#.##....##.########..##.## .#....##....##.##....#####....#.#.....ß.#.....§§§.....#...#.[..'.....°§Y@<...#...##.##....##....##§☼.....#.....>..# ..#...##..$.##(......#.....<..# .$...#.#.# ....#.#.#.#.#.+.# #.?.#+#.# ......##....# .$# ......##....# ......^...#okil . The elephant is engulfed in noxious fumes.  The elephant appears confused. The elephant tramples itself.oki E-------4okiZ okiԷ 6 _The elephant trunk-slaps itself.pki/☼○ puncture the elephant!  Your weapon exudes an aura of protection.  You squeeze the elephant.  The elephant is almost dead.is engulfed in noxious fumespki].  appears confused. The elephant misses you.pkiC669-pkirz10 =------5.2 (0.8pki`pki3 _The elephant trunk-slaps you.pkiF Y°You hit the elephant.  The elephant is almost dead..pki70-1=6.0Poisonous VapourspkiOpki>@ _The elephant is engulfed in noxious fumes.qkiW §You strike the helpless elephant from behind!  You impale the elephant!!qki,J○°qki 1017 =4-8Poisonous Vapours _You kill the elephant!qki"qkim _Your Short Blades skill increases to level 4!ski=-7.8 (1.0 _skiD°)1=8ski"z☼9ski̓]..40ski ;○☼skiB 8 3 1skiG ski skih` skia m=2=2skiwi skil tkikk°○☼☼3tkitkitki*1otki3ro   orc wizard (wandering)tki4%4tki(<tki,Bx _You encounter an orc wizard. It is wielding a +0 dagger.tkip5o.tki4P.°○○tkiٽ%5tkitkitki$=.otki s=6Poisonous VapourstkijtkitkiS 5o.tki I.°°tkim c7Poisonous Vapourstki tki6 ukiM}.## #.###.## ##........'.#.# #........#.#.# #..+........#.#.# ##....##.########..##.## # #....##....##.##....#####...##.#.....ß.#....o..°.....#...#.[.#'....#...##.##...###....##°).....#.....>..# #...##..$.##(......#.....<..# #$...#.#.# #.+.# o.ukiX;8uki(`ukica _There is a stone staircase leading up here.uki  uki'  Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.vki" _You don't know that spell.vki#( 3vki=4 vki7 5o.vki|F ?$.vkiJ Y3==9 _vki]T vki B==7vkio  #.# .........#........# # .######....###.#### # .......#.###.# ## ########.#...#.#  ..............# .### .######.#.###### # #........# vki # ..####+#####.# ## .# #.##...## #...... .# #.##..........# #...... #.##....# #...... .#+##### #.##....# #......vki G....# #.#########...# #......# #.##########'##.#...... ####)..............#...... ..#....##########.####...... ................#....'...... vki9 ;101751.3 (2.5vki vki  _You fly upwards.vki c _There is a stone staircase leading down here.wki 3wkiQ wki wki$ ,wki wki} u4=wki BwkiA wki" wkiR wki wki{ wki wki wki wki 9=wki 5====wki# wki$ wki% S6=wki% wki' ,wki( wkim* wki* wki+ wki, wki- wki. wki)/ wki/ 9=wki0 wki|2 ,wkiW3 wki64 wki4 wki5 wki7 wkiv7 S7=wki8 wki": wki~: wki'; wki< wki< wki= wki'@ wkip@ wki9A wkiB wkiC 9=wkiC wki&F ,wkiG wkiH wkiI T8==wkiI wkiK ,wkiL wkiN wkiN wkiO wkiQ wkiQ wkiR wkiS wkiT :==wkiU wkiV wki$W wkiW wkiqY ,wki5Z wki[ wki \ M9=wki\ wki^ ,wki_ wki@a ,wkib wkic wkic wkid wkif O=wkig wkij ,wkik wki(l ,wkil wkim wkiNn R10/17==wkio wkip wki8q wkir wkis wkis wkit wkiv wkiv wkiw wkiMy wkiy :==wkiz wki| wkis} wki} wkiI wki M1=wki wki5 wkie wkit wki= wki wkiI wki wki҇ wki wkiL wki 9=wki wki wki܌ wki wki wki wki wki. 2==3==wkiֳ Bwkiӽ ==wki ,wki wki w4=wkiT wki wkid wki wki wki wkiw ,wki] wki wki 9=wki wki wki+ wki wki wki} wki wki0 wki L5==wki wkiS ,wki' wki wki wki wki wki wki wki_ ==wki" wkig K6=wki wkie ,wki wki| wki wki@ wkii ,wki wki wki 9=wki wki[ wki wki wkiv n _You start resting.Magic restored.wki wki 1341.3 (90.0)wki a7==2.3 (91 _wki< wki xkiVxki Spells (Memorise)TypeFailure Level  a - Kinetic GrapnelForgecraft4% 1b - HailstormConjuration/Ice6% 3  c - Launch Clockwork BeeForgecraft14% 3  d - Sigil of BindingHexes14% 3 xki e - Curse of AgonyNecromancy75% 5  f - Lee's Rapid Deconstruction Earth75% 5  g - Diamond SawbladesForgecraft100% 7 4 spell levels left [!] Memorise|Describe|Hide|Show [Ctrl-F] search [?] help[Esc] exitzkizkizkig#.# .........#........#ludeguy the Toxicologist ..# .######....###.####Octopode of Gozag Gold: 1017 ..# .......#.###.#zkiHealth: 71/71 ======================== ..### ########.#...#.#Magic: 17/17 ======================== ..... ..............#AC: 3Str: 13 .### .######.#.######EV: 15Int: 20 .##........#SH: 0zkiWDex: 21 .#..####+#####.# ####### XL: 10 Next: 43% Place: Dungeon:7 .##.##..@......## #...... Noise: ---------  Time: 9342.3 (0.0) .#zkiw#.##..........# #...... c) +0 dagger (protect) .##.##..........# #...... Cast: Poisonous Vapours .#+##### #.##..........# #...... Fly .......# #.#########...# #...... .......# #.##########'##.#......  .......####)..............#......  .......#....##########.####......  .....................#....'...... Confirm with . or Enter, or press ? or * to list all spells. _You don't know that spell. _You fly upwards. _There is a stone staircase leading down here. _You start resting. _Magic restored.zki$P  Okay, then.zki4%zki)zkiz+. _zkiޅ 3zki zkiH F _Unknown command.{ki{ki{ki{ki {ki.@_There are no items here.{kiٱ{ki  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 4.7   5.9  -1  {ki]         b - Polearms   0.0   1.0   0   k - Conjurations   4.0   5.0   0  {ki c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1  {kiS d - Throwing   0.0   1.0   0   m + Fire Magic3.1   4.0   0      {kin + Air Magic3.8   4.0   0   e + Short Blades   4.0   2.5   0 +4     f - Long Blades   2.3   1.0   0   o - Evocations   0.0   0.8  +1  {ki3     p - Shapeshifting   0.0   1.2  -1  {ki+g + Dodging5.2   6.0   0      {ki9W h - Shields   0.0   1.0   0      i + Stealth{ki`7.3   4.0  +4      {ki        {ki        {kiѷ        {kil    {ki        {ki=a    {ki`Skills enhanced by cross-training are in green. Bonus from skill manuals is in  red.  [?] Help{kiG[=] set a skill target  {ki̸}[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetski: #.# .........#........#ludeguy the Toxicologist ..# .######....###.####Octopode of Gozag Gold: 1017 ..# .......#.###.#Health: 71/71 ======================== ..### ########.#...#.#Magic: 17/17 ======================== ..... ..............#ki AC: 3Str: 13 .### .######.#.######EV: 15Int: 20 .##........#SH: 0Dex: 21 .#..####+#####.# ####### XL: 10 Next: 43% Place: Dungeon:7 .##.##..@......## #...... Noise: ---------  Time: 9342.3 (0.0) ki$ .##.##..........# #...... c) +0 dagger (protect) .#ki #.##..........# #...... Cast: Poisonous Vapours .#+##### #.##..........# #...... Fly .......# #.#########...# #...... .......# #.##########'##.#......  .......####)..............#......  .......#....##########.####......  .....................#....'......  _There is a stone staircase leading down here. _You start resting. _Magic restored. _Okay, then. _Unknown command. kiH /_There are no items here.kiB ki ki ki kiL 3kinQ ki(W ki[ 13.3 (1 _kit\ kic G 8  You fly downwards.kid kie kik r .## #################.###.## #...#........'..........#.#...#.....o..#..........#.#..+........#..........#.###....##.########..##.## # #....##..o.##.##....#####...##### ......#.......o.....#.....ß...... ......#.......$o....#...#.[. ......'.......#...##.##...# .....##....##.).....#.....>..# kiYl ...##..$.##(#.....<..# # .......$...#..#........# #.......#........#........#kil ....#........+........# o   orc priest (wandering)..?.########+#........# o   orc wizard (wandering)##....# .........$# oo 2 orcs (1 wandering)kil ##....# ......^...#ki H4.8 (2.5Poisonous Vapourski! ki ` _You encounter an orc priest and 2 orcs.ki> a _There is a stone staircase leading up here.ki#.## #.###.## .#........'.#.#.#.....o..#.#.#.#..+........#.#.#.##....##.########..##.## .#....##..o.##.##....#####....#.o.....#.....ß.#ki>.$o....#...#.[..'<...#...##.##....##....##.).....#.....>..# ..#...##..$.##(......#.....<..# .$...#.#.# ....#.#.#.#.#.+.# #kiY.?.#+#.#.##....# .$# ......##....# ......^...#kiQ.oki.kijookiN ooowizardoo 2 orcs (1 wandering)  The orc hits you with a +0 hand axe.kib0-=5.8 (1.0kicki, _The orc wizard shouts!ki $You hit the orc wizard.  Your weapon exudes an aura of protection.  Your grab misses the orc wizard. You squeeze the orc wizard!kiQ.okiO.okioo 2 orcs (1 wandering)ki1017 10 4====6.6 (0.8kikiN _You kill the orc wizard!ki  $You barely miss the orc. You grab the orc. You squeeze the orc.  The orc is severely wounded.You constrict the orc.kiH.oki-okiLo   orc priesto   orc (wandering)ki#\=---7.4ki7ki kiA_You kill the orc!ki  Casting: Mephitic Cloud (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki1 .......o.o....##.#######...##.##....#............#....o.$$....#.......@<...#...##.).....##(......##........##........##........+(poisoned)########+#o  poisoned)You feel a surge of power! You begin to radiate toxic energy.  The orc priest is poisoned.  The orc shouts!ki .......o.o....##.#######...##.##....#............#....o.$$....#.......@<...#...##.).....##(......##........##........##........+########+#ki $The orc is poisoned. The orc looks even sicker.kiE.okiöC ki"1=3------====8.4 (1.0Poisonous VapoursToxic Fly kikiDG _You kill the orc!ki  #.##...#### #.## #################.###.##....'...#........#..+....o...#..........#.# ...##o########..##.## #....##....##.##....#####...####......ß.....#.....$.$@..[.####.'.........<##.##.......##.)>#...##..$.##(<....$...### ...#........+ #.........?.########+#....$kiÌ very poisoned)  The orc priest looks even sicker.  Your toxic aura wanes.kiɑ kin kiB a----9Poisonous Vapourski @Fly ki# ki/ e _The orc priest looks satisfied for a moment.kit4 i _Items here: $ )) [.kiM #.##... .#.## ##########.###.##.#........'.#.#.#........#.#.#.#..+....o...#.#.#.##....##o########..##.## ..#....##....##.##....#####....#.#.....ß.#.....$.@$....#...#.[..'.<...#...##.## #......##....##.).....#.....>..#.#...##..$.##(......#.....<..# .$...#.#.#.#.#.#.# .#.+.# .#.?.#+#.# .##....# .$#.o 3 ----50 _ki*kidR _You see here 20 gold pieces.ki#.##...### ludeguy the Toxicologist .#.## #################.###.##Octopode of Gozag Gold: 1017 .......#........'..........#.#Health: 71/71 ======================== .......#........#..........#.#kiMagic: 12/17 ================-------- ....#..+....o...#..........#.#AC: 3Str: 13 .......##....##.########..##.##EV: 15Int: 20 ..#....##....##o##....#####...### SH: 0Dex: 21 ki........#.............#.....ß.... XL: 10 Next: 44% Place: Dungeon:8 ........#.....$.@$....#...#.[.### Noise: ---------  Time: 9350.4 (0.0) ........'.........<...#...##.##.. c) +0 dagger (protect) #......##....##.).....#.....>..# Cast: Poisonous Vapours ...#...##..$.##(......#.....<..# Fly .........$...#........#........# .....#.......#........#........# o   orc priest (very poisoned) .............#........+........# .#.........?.########+#........# .......##....#.........$#Press: ? - help, Dir - move targetAim: an orc priest, wielding a +0 club and wearing aki +0 leather armour (heavilywounded, very poisoned)  You feel a surge of power!  Poisonous fumes billow around the orc priest!  The orc priest looks even sicker.kiki`kitb2=1.4 (1kipAim: an orc priest, wielding a +0 club and wearing a +0 leather armour (heavilywounded, very poisoned)  You feel a surge of power!  Poisonous fumes billow around the orc priest!  The orc priest looks even sicker. _The orc priest begins to cast a cantrip, but forgets the words!kiF' #.##...### ludeguy the Toxicologist .#.## #################.###.##  Octopode of Gozag Gold: 1017 .......#........'..........#.#  Health: 71/71 ======================== .......#........#..........#.#  Magic: 11/17 ===============--------- ....#..+....o...#..........#.#  AC: 3Str: 13 .......##....##.########..##.##  EV: 15Int: 20 ki4..#....##....##$##....#####...### SH: 0Dex: 21 ........#.............#.....ß.... XL: 10 Next: 44% Place: Dungeon:8 ........#.....$.@$....#...#.[.### Noise: =--------  Time: 9351.4 (0.0) ........'.........<...#...##.##.. c) +0 dagger (protect) #......##....##.).....#.....>..#  Cast: Poisonous Vapours ...#...##..$.##(......#.....<..#  Fly .........$...#........#........# .....#.......#........#........#  o   orc priest (very poisoned) .............#........+........# .#.........?.########+#........# .......##....# .........$# Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: an orc priest, wielding a +0 club and wearing a +0 leather armour (almostdead, very poisoned)  You feel a surge of power!  Poiski0onous fumes billow around the orc priest!kij ######### ... ... ...o... ....##.####### ....##$##....#....ki..#......#...#.[......#....##.).....#.....>..# ..$.##(......#.....<..# $...#........##........#ki(*#........+?.########+# $ki0p52.4 (1Poisonous VapourskikiIMPress: ? - help, Dir - move target  Aim: an orc priest, wielding a +0 club and wearing a +0 leather armour (almostdead, very poisoned)  You feel a surge of power!  ki[vPoisonous fumes billow around the orc priest! _You kill the orc priest!kir#.##...# #.## ##########.###.## #........'.#.# #........#.#.# #..+....o...#.#.# ##....##.########..##.## #....##....##$##....#####...##.ki#.....ß.#.....$.$@....#...#.[.#'.<...#...##.##. ......##....##.).....#.....>..# #...##..$.##(......#.....<..# kikig--3kikil  You now have 1032 gold pieces (gained 15).  Things that are here:kid322=-4.4 (2kiki= kiM_a +0 hand axe; a +0 dagger; a +0 robeki #.##... .#.## ##########.###.##.#........'.#.#.#........#.#.#.#..+....o...#.#.#.##....##.########..##.## .ki.#....##....##$##....#####....#.#.....ß.#.....$.@)....#...#.[..'.<...#...##.## #......##....##.).....#.....>..#.#...##..$.##(......#.....<..# .$...#.#.# .....#.#.#.# .#.+.# .#.?.#+#kiY.# .##....# .$#kiO ki *5.4 (1ki ki kiU F56.4 (2ki ki @ _You now have 1052 gold pieces (gained 20).kik ' #.##... #.#.## ###########.###.##.#........'.#.#.#........#.#.#.#..+....o...#.#.# #.##....##.########..##.##.#....##....##$##....#####... #.#.#.....ß ki v#.#.....$@.)....#...#.[. #.'.<...#...##.## .#......##....##.).....#.....>..#.#...##..$.##(......#.....<..#.$...#.#.#.#.......#.#.# .....#.+.#  #.#.?.#+#.#  #.##....# .$# ki kiJ *7.4 (1ki kiq kiJM..ß... #.##...## #.#.## #################.###.##........'...#..... .....#..+....o...#..........#.# #.....##.########..##.## ...#....##....##$##....#####...##.@....ß...#.....$..)..[.## #..'.........<##.##. .#.....##.)> ....#...##..$.##(......#.....<..#. ...########+#ki7kiA=8ki*ki,ki!M#...##..ß... #.##...## #.#.## #################.###.##....'...#...... .....#..+....o...#..........#.# #.......##....##.########..##.## ki΍y...#....##....##@##....#####...##......ß...#.....$..)..[.## #........'.........<...#...##.##. Fly ......#........+ki%;9kiBkik  You now have 1058 gold pieces (gained 6).  Things that are here:kiG860.4 (2ki7kiT _a +0 club; a +0 leather armourki'9 ..ß...#...## #.#.## #################.###.## ........#........'..........#.# ....##..+....o. #.......##....##.########..##.## ...#....##....##)##....#####...## #........#......@......#.....ß...$..)#.[.##'.........<#.##.Fly ......#........+ #.#.........?.########+#........# kiCki[3==1.4 (1ki?kiPki  #...## #.#.## #################.###.## ........#........'..........#.# ........##..+....o #.......##....##.########..##.## ...#..##)##....#####...## #........#.............#.....ß...$@.)#.[.##'.........<#.##. .###....##.)....>..#.Fly ....########+# #.......##....#.........$# ki I10582kiQ ki kiP  #.##... ##.#.## ###########.###.## #.#........'.#.#.#........#.#.#.#..+....o...#.#.# .#ki A.##....##.########..##.##.#....##....##)##....#####...  #.#ki U.#.....ß  #ki 3.#.....@..)....#...#.[.  #.'.<...#...##.## .ki .#......##....##.).....#.....>..ki6 .#...##..$.##(......#.....<.. #.$...#.kia _.#..#.......#.ki .#......#..+.ki  .#.#.........?.########+#ki ;. .#ki q.##....# .$ki< kiM %3ki ki N  You now have 1064 gold pieces (gained 6).kit 3644.4 (2ki ki4 - _You see here a +0 club.kicf ##.#.## #################.###.# #........#........'..........#.# ......#ki&#..+.....#.......##....##.########..##.## ....###)##....#####... ki: #........#.............#.....ß...)..)#.[.#.'.<#.# ..###....##.)....>.....#...##..$.##(.<.Fly .......#.......##....#......^... kiְkiG==5.4 (1kiɹkiki!3kii*ki .kiSi .#.## #.###.## .#........'.#.# #........#.#.# #..+........#.#.# #.kiiP##....##.########..##.## #....##....##)##....#####...# #.#.#.....ß. #.#.....)..)....#...#.[.# #.'.kii<...#...##.##. .#......##....##.).....#.....>..#kii/#...##..$.##(......#.....<..# .$...#..#.#kii#.......#..#.#.....#..+.kij# #.#.........?.########+#.# #.kij##....# .$# #.##....# ......^...#ki7wki!x%6ki}kinki+ ........#........'..........#.# .....##..+.... #.......##....##.########..##.## ...###)##....#####...## #........#.............#.....ß...)..)#.[.##'.........<#.##. .###....##@)....>..# ....#...##..$.##(.<......$...#...#.......# #...P..PP.....#ki3ki4S4=7ki<ki 3kiQ kiz ki ki ki kib ki:M#.#.## #################.###.##.....'...#.... .....#..+........#..........#.# #...##.########..##.## ...#....##....##)##....#####...##......ß...#.....)..)..[.## #..'......@..<##.##. .#......##....##.)>#...##..$.##(<....$...# ......#.......#........#........#kiki%8ki% kikiT#.#.## #.###.## kik#.#........'.#.#ki p.#........#.#.#kiU.#..+........#kii .#.# .#.##....##.########..##.##.#....##....##)##....#####... ki|: #.#ki..#.....ß ki' #ki.#.....)..)....#...#.[.  #ki.'ki?.<...#...##.## .ki .#......##....##.).....#.....>..ki6.#...##..$.##(......#.....<.. #kiUL.$...#.kig'.#kiw.ki0.#.......#.ki].#.......#.ki..+. ki%.#.#.........?.########+#. .#kiP,.##....# kizY.$  #.##....#kin ......^...ki kiz%9ki ki1ki]b ##.#.## #.###. ##.#........'.#.# #.#........#.#.#.#..+........#kio]k.#.# #.#.##....##.########..##.  ....#....##....##)##....#####... #ki]S.#.#.....ß #ki].#.....)..)....#...#.[. #.'ki^.<...#...##..#......##....##.).....#.....>ki;^.#...##..$.##(......#.....< .#kiY^v.$...#........#kiw^.#.......#........#.....#........+ .ki^.#.#.........?.########+# ..#.##....#ki^_ . . #.##....# ......^kikkil&70kiukixkic; ##.#.## #.###. .##.#........'.#. .#.#........#.#..#..+........#kid.#.  #.#.##....##.########..##.ki?d ....#....##....##)##....##### #.#kind@.#.....ß #kid.#.....)..)....#...#.[ #kid\.'.<...#...##.kid.#......##....##.).....#.....>kid.#...##..$.##(......#.....<.#kie....$...#........#.#kiTe.#........#.#........+.#.#.?.########+#.#ki~e.##....# . #kief.##....# ......^kiskitA=1ki|ki$~ki{ . ##.#.## #.### ..##.#........'.# ..#.#........#.# ki .#..+........#.# #.#.##....##.########..##ki ....#....##....##)##....##### #........#.#.....ki #....s...#.....)..)....#...#.kil #.'.<...#...##ki5.#......##....##.).....#.....ki~e.#...##..$.##(......#......#...$...#........#.#.#ki.#ki;.#.+kis   scorpion (wandering).#.#ki.?.##+#ki^.#.##....#kiY   .. #kii.##....# ......^ki.kin ski/You encounter a scorpion.ki%2kiki\5 _The scorpion leaves your sight.ki  .##........#........'.............#  ..#..+# #.#.......##....##.########..# ....#..#)##....#####. #........#.............#.......)..)#ki[ ;s....'.........<# .....#......##..@.##.).......#...##..$.##(...#..........$...#......#....ki ...##....##...P..PP.....#kiW 0ski& .s   scorpion (wandering)ki' %3ki- ki/ ki\V .#  ..#..+# #.#.......##....##.########..# ....#...#)##....#####. #........#.............#.....)..).#s...'.........<# .....#......##....##.).......#(.#..........$...#.........#......+#.#?.########+#..PP.....##$......PPPP..#kiFZki,[#5kiH[1==4kibkikkim3725.4 (2kiskivw? _You now have 1072 gold pieces (gained 8).ki<  ..#..+ #.#.......##....##.########..# ....#....#)##....#####. #........#.............#........)..).#s...'.........<# .....#......##....##.).......#..s#(.#..........$.@.#.........#.....+Fly .s   scorpion (wandering).#$.........P..#+....PP..P.kiDG.skik]6.4 (1ki*? .#..+.#ki. #.#.......##....##.##.. ....#....##....##)##....##### #........#.......# #........#.....)..)....#...# #....s...'.........<...#...  .....#......##....##.).....#  .#...##....##(......#.#........s.$@..#.#..#.#.#.#.+.#.#.?.##+#  ....#.##....#  .. #.......##....# ...... #...P..PPiT7m.....# #$.........P..#  +....PP..P.P..#h.sh   black bear (wandering)s   scorpion7Poisonous Vapours _You encounter a black bear.ki`$ .#..+.# #.#.......##....##.##.. ....#....##....##)##.... #........#.# #..#.....)..)....#... #....s...'.........<...#... .....#......##....##.).....# .#...##....##(......#  ....#.........s@...#.#  ...#.#.#  ..#.+  .....#.#.?.##+# ....#.##....#  .. #.##....#  ki$#...P..PP.....# #$.........Ph.#  +....PP..P.P..#h.ki7  The scorpion stings you.  You are poisoned.ki7$68ki7v===--===8ki7LPois Fly ki@kiBE _The scorpion poisons you!  Things that are here:kifF _5 gold pieces; a +0 chain mail; a +0 short swordki0 h.  Things that are here: _5 gold pieces; a +0 chain mail; a +0 short sword  You puncture the scorpion!  Your weapon exudes an aura of protection.  Your grab misses the scorpion. Your squeeze misses the scorpion. ki"1 m The scorpion is severely wounded.ki: ]  You feel sick.ki; {6--10 =ki; 9.2 (0.8kiD kiH A _The scorpion stings you but does no damage.kily $You puncture the scorpion!kim- .kinPhYou kill the scorpion!kiw)kif|1072 4-7-80.0Poisonous Vapourskiki$ _You feel sick.ki .#..+.# #.#.##....##.# ....#....##....##)##.... #........#.# #........#.....)..)....# #........'.........<...# .....#......##....##.).....# .#...##....##(......# ....#.........@$...#.# ...#.#.# ...#.+ .....#.#.?.#ki+#+# ....#.##....#  .. #.##....#ki  #...P..PP...h.#ki  #$.........P..# kiAM +....PP..P.P..#kiI.hkikiQ3-6ki`=--1.0 (1.0ki  _You feel sick. _You see here 5 gold pieces.ki[.#..+.#.#.#.##....##.#.....#....##....##)##....##........#.#.#........#.....)..)....#.ki[#........'.........<...#......#......##....##.).....#..#...##....##(......#.ki\....#.........$@...#.#....#.#.#....#.ki\w+......#.#.?.##ki\b+#.....#.##....# ki]... #.##....# .ki3]7#...P..PP.....##$.........P.h# kiU] ki_.ki+hMhki{ie2--2kipki{You feel sick. _You see here 5 gold pieces. _You feel sick.  You now have 1077 gold pieces (gained 5).  Things that are here:  a +0 chain mail; a +0 short swordki|t71-3.0 (2kiWkiW$ _You feel sick.ki .#..+.#.#.#.......##....##.##..#....#....##....##)##....##........#.#.#..#.....)..)....#...##........'.........<...#...#.....#......##....##.).....#..#...##....##(......#. ki |....#.........$[@..#.#. ...#.#.#. ..#.+. .....#.#.?.##+#.....#.##....# ... #.ki ##....# .#...#$..... ki ki١ kiq *4.0 (1kiڧ ki $ _You feel sick.kiA.#..+.#.##.#.......##....##.##..#....#....##....##)##....#####.#........#.......#.#........#.....)..)....#...#.#.ki.'.........<...#...# .....#......##....##.).....#. .#...##....##(......#.#.........$[.@.#.#..#.#.#.#.+.#.#.ki?.##+#. ....#.##....# .kiF.. #.......##....# ......^#...P..#$....... kipkir0= 3 5ki;ki?$ _You feel sick.ki  #.#.......##....##.########..# ....#....#)##....#####. #........#.............#.......)..)#..'.........<# .....#......##....##.).......#...#(.#.........$[...#.........#.....+#.#?.########+#Pois Fly +....PP.......##...PP....P...hkih   black bear (wandering)kiS59=-ki6ki+kih$ _You feel sick.ki@P ....#)##....#####. #........#.............#.....)..)#....'.........<# .....#......##....##.).......#...#(.#.........$[...#.........#......+#.#?.########+#......##....# ..  .. ..#^ #...P..PP.$.........P+....PP......h#...PP....P...P.....PP.P. h.  You feel sick.kiXkiYkiY8=-7Fly kibkiJm[ _You are no longer poisoned.kin #........#.............#.....)..)#....'.........<# .....#......##....##.).......#...#ki4(.#.........$[...#.........#.....+#.#ki#######+#......##....# .. ki .. #.......#^ #...P..P..ki ki>$.........P.h+....PP.......ki\#...PP....PP.....PP.....P..####...Pki{ki8h.kiki)97ki2==8kiXPoisonous Vapourskiki! _You see here a scroll of teleportation.ki,  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kih kii kio kir P _You don't know that spell.kiMx #........#.............#..... ludeguy the Toxicologist  #........#.....)..)....#...#. Octopode of Gozag Gold: 1077  #........'.........<...#...## Health: 59/71 ===================----- .....#......##....##.).....#..... Magic: 16/17 ======================-- ........#...##....##(......#..... AC: 3Str: 13 ...#.........$[...#........#..... EV: 15Int: 20 ..........#.......#........#..... SH: 0Dex: 21 ..................#........+..... XL: 10 Next: 47% Place: Dungeon:8 ....#.#.........@.########+#..... Noise: ---------  Time: 9388.0 (0.0) ....#.......##....# ....... c) +0 dagger (protect)  .. #.......##..hix0m.# ......^ Cast: Poisonous Vapours  #...P..P......# Fly  #$.........P..#  +....PP.......# h   black bear (wandering)  #...PP....P...#  P.....PP......#  ..P..####...P.#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: a black bear (wandering, hasn't noticed you)  You feel a surge of power!  Poisonous fumes billow around the black bear!ki~  .#.....)..)  #........'.........<...##....##.)...##....##(kiB....$[...#.#.......#.........#.......@.#...##....#  .. #..h.# ^  ......# kih  #$.........P..#  +....PP.......#ki9hpoisoned) ki #...PP....P...# ki P.....PP......#  ki2=9.0 (1kiPki>  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: a black bear (wandering, hasn't noticed you)  You feel a surge of power!  Poisonous fumes billow around the black bear! _The black bear is poisoned.ki  #........#.............#..... ludeguy the Toxicologistki #........#.....)..)....#...#. Octopode of Gozag Gold: 1077 ki- #........'.........<...#...## Health: 59/71 ===================----- kiH $.....#......##....##.).....#..... Magic: 14/17 ===================----- kif ........#...##....##(......#..... AC: 3Str: 13 ki ...#.........$[...#........#..... EV: 15Int: 20 ki ..........#.......#........#..... SH: 0Dex: 21 ki ..................#........+..... XL: 10 Next: 47% Place: Dungeon:8 ....#.#.........@.########+#..... Noise: =--------  Time: 9389.0 (0.0) ....#.......##..*.#ki] k....... c) +0 dagger (protect)ki Q.. #.......##..h.#......^ Cast: Poisonous Vapours#...P..P......#Fly #$.........P..#+....PP.......#ki Ih   black bear (poisoned)#...PP....P...#P.....PP......#ki ..P..####...P.#Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  ki9 Press: ? - help, Shift-Dir - straight lineAim: a black bear (lightly wounded, poisoned, chance to weaken: 76%)  You feel a surge of power!  The glob of mercury hits the black bear!kiC[8h.kidkie3=90.0 (1kiPnkigr  Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a black bear (lightly wounded, poisoned, chance to weaken: 76%)  You feel a surge of power!  The glob of mercury hits the black bear! _The black bear is heavily wounded.ki  #........#.............#..... ludeguy the Toxicologist#........#.....)..)....#...#. Octopode of Gozag Gold: 1077 ki Z#........'.........<...#...## Health: 59/71 ===================----- .....#......##....##.).....#..... Magic: 12/17 ================-------- ........#...##....##(......#..... AC: 3Str: 13 ...#.........$[...#........#..... EV: 15Int: 20 kim ..........#.......#........#..... SH: 0Dex: 21 ..................#........+..... XL: 10 Next: 47% Place: Dungeon:8 ....#.#.........@.########+#..... Noise: ==-------  Time: 9390.0 (0.0) ....#.......##..h.#ki ....... c) +0 dagger (protect).. #.......##....#ki ......^ Cast: Poisonous Vapours#...P..P......#kiҟ 'Fly ki #$.........P..#+....PP.......#ki h   black bear (poisoned)#...PP....P...#ki5 P.....PP......#..P..####...P.#kiT Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  kiu Press: ? - help, Shift-Dir - straight lineAim: a black bear (heavily wounded, poisoned, chance to weaken: 76%)  ki IYou feel a surge of power!  The glob of mercury hits the black bear!ki4 uhhberserk, poisoned)Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a black bear (heavily wounded, poisoned, chance to weaken: 76%)  You feel a surge of power!  The glob of mercury hits the black bear!  The black bear is severely wounded.ki6 Y60=1.0 (1ki=@ kiiC \ _The black bear goes berserk!ki8 _The black bear goes berserk!  You hit the black bear.r weapon exudes an aura of protection.  You grab the black bear.almost dead. ki٧` You constrict the black bear. The black bear barely misses you.kiY10 -8 (0.8ki>ki  _The black bear closely misses you. The black bear barely misses you.ki_ x $You hit the black bear.kig )kil 9-2.6Poisonous Vapourskip kiSz ] _You kill the black bear!kin{ j1=-3.6 (1kiS kir ] _t - a scroll of teleportationkiV4 ki2)..)#....'.........<# .....#......##....##.)..ki5.....#...#ki(.#.........$[...#..ki{.......#.....+#.########+#ki......##..@.# ..  .. #.......##...kiP^ #...P..P.. ..Fly ki####...P.#..... ......kiQkiWd3==-40kiki kiiG805.6 (2kiki!? _You now have 1080 gold pieces (gained 3).ki  #.#.............#... #.#.....)..)....#... ..'.........<...#...#  .....#......##....##.).....#  ........#...##....##(......##.........$[...#.#..#.#.#....#........+.#.#........@..########+#..#.......##....# ........ #.......##....#...... #...P..P......# #$......P..# +....PP.......# #...PP....P...# P.....PP......# ..P..####...P.#i Hki ki *6.6 (1ki ki kiw ....#....##....##)##....#### #........#.............#... #........#.....)..)....#... ki$x ..'.........<...# .....#......##....##.).....#  ........#...##....##(......# kiHx c ....#.........$[...#.#  ..#.#.# kihx  ..........#........+.#.#...........########+#kix ..#.......##....# .. #.......##....#.....kix I #...P..P......# #$.......P..# +....PP.......# #...PP..P...# P.....PP......#ki| ki@ @2 3 7ki kiٕM#.#.......##....##.########.....#....##....##)##....### #........#.............# #........#.....)..)....# ..'.........<...# .....#......##....##.).....# ........#...##....##(......#ki ....#.........$[...#.# ....#.#.# ..........#........+.#.#...........########+#..#.......##....#ki .. #.......##....#.... #...P..P......# #$........ki_P..# +....PP.......# #...PP....P...#ki1kiB==8ki{ki........#..+........#......#.#.......##....##.#####....#....##....##)##....## #........#.............# #........#.....)..)....# ..'.........<...# .....#......##....##.).....# ........#...##....##(......# ....#........@$[...#kiY.# ....#.#.# ...........#........+.#.#...........########+#..#.##....# .. #.......##....#... #...P..P......#ki #$........P..# +....PP.......#kiPki`%9kiDkixkiki{ki kiP ki#.#..+.#.#.#.......##....##.#.....#....##....##)##....##........#.....#.#........#.....)..)....#.#........'...<...#......#......##....##.).....#.ki%a.#...##....##(......#.....#.........@[...#.#....#.#.#......#.+......#.#.ki̸##+#.....#.##....# ... #.##....# .#.ki4 kik3=400ki9kiki#5kiQ4=1.6 (2kiSki? _You now have 1085 gold pieces (gained 5).ki X.#..+.#.#.#.##....##.#.....#....##....##)##....##........#.#.#........#.....)..)....#.#........'.........<...#......#......##....##.).....#..#...##....##(......#.....#..........@...#.#....#.#.#....#.+......#.#.##+#.....#.##....# ... #.##....# .#...P..P......##$.........P..# ki ki *2.6 (1ki# ki& $  Things that are here:ki( W _a +0 chain mail; a +0 short swordkiH.#..+.#.#.#.......##....##.##..#....#....##....##)##....##........#.#.#..#.....)..)....#...##........'.........<...#...#.....#......##....##.).....#..#...##....##(......#. ....#..........[@..#.#. ...#.#.#. ..#.+. .....#.#.##+#.....#.##....# ... #.##....# .#...#$..... kiQkiRd4=3 _kiZki[kiHvM..#...#........#..+........#..........#.#.......#.########......#....##....##)##....#####............#.....)..). #........'.........<##......#.)  ........#...##.@..##(#..........[..#ki# ...................#........+.... Fly .......P..#kiYki310854kikiki{4M...##'..#.........#..#........#..+........#..........#.#.......ki#.########......#....##....##)##....#####...............#.....)..). #........'.........<kid##....)  ........#...##....##(#..........[..## ...................#........+....P..P......#kikiA=5kikickit1G ##.#.## #################.### ..##..'.# ..#...#........#.#........#..+........#........ki 2#.#.......##....##.########......#....##....##)##....######........#.............#.....#.#.....)..)....#...#. #........'..@......<...#...## .....#......##....##.).....#.....#...##....##(......#.#kia2...[...#.#.##.#....#........+.....  ki2 ....#.#.....########+#  ....#.##....# .ki 3  .. #.......##....# ......^ kiJJkiJ-56kicWkiYkite  #.##..  ##.#.## #################.###. .##........'.#. .#..#........#.#. ........#..+........#..........#.#.#.......##....##.########......#....##....##)##....######........#.............#.....ß#........#...@.)..)....#...#.[  #..'.........<...#...##kif 3#......##....##.).....#.....>....#...##....##(......#.....<#...[...#........#.##........#....#........+.#.#.....########+# ...#.##....# ..kip kiq T5==7kiFy kiq{ ki kiX ki ki ki ,kiM ki kiSkikiTK6=kiki= ki/ :==ki kiE,kitkikiU7=kiZkikiK6=ki!ki*Bki*kid+%8ki-ki)1ki1ki3ki7ki*89=kiv:ki=kiZ>K9=ki@kiMDkiDkiFki5JkiJL7==kiTkiWY4 _Magic restored.kiYV70=ki[kii_ki_kiakieki fkilhkijkiWk:==kimkisqkirK1=kitkiz1 _HP restored.kih|ki|ki,kikiHkiki kikiki:ki~ki˔kiki9=ki kikikikiȣkikiki kikiܫkikiۭkikikiòki kiki=kikiLki}kiAkikikiCki kiki&kikikiVkikiki}ki&99kikiO _You now have 1099 gold pieces (gained 14).kivki/kiki7kikikikiSF _You reach down and open the door.kikikiki@  There is an open door here.kiki _kikikikikiZkikiOkikiki kiZ ki ki ki?ki  You reach down and open the door.  You encounter an elephant.ki.......#.......##....#  .......#.......##....#  P......#...P..P......#  PPP....#..........P..#  ..P....'....PP.......#  .......#...PP....P...#  PP.....P.....PP......# kiY PPP......P..####...P.#  ...........@'.Y#......  ..P..#?>#  ..P...# ## Poisonous Vapours ........PP... ......#..P.P. .....#..P..P.Y   elephant (trample, asleep) ... ##.P... .?.P... kiw ki046.6 (39.0)ki27.6 (40 _ki%ki' _Found a scroll of noise. Found a staircase to the Lair.kid" .  .......#.......##....#  P......#...P..P......#  PPP....#........  ..P....'....PP.  .......#...PP.  PP.....P.....  PPP......P..####  ...........@'.Y#  .........P..#?>#  ........P...# ##  ........PP... ......#..P.P. ki.....#..P..P.  ... ##.P....  .?.P... ki9i .  .......#.......##....#  P......#...P..P......#  PPP....#........  ki:..P....'....PP.  .......#...PP.  PP.....P.....  PPP......P..####  ...........@'.Y#  ki:.........P..#?>#  ........P...# ##  ........PP... ......#..P.P .....#..P..P.  ... ##.P... .?.P... kiBki}BkiGki!K` _An elephant is nearby!kiHq" .  .......#.......##....#  P......#...P..P......#  PPP....#........  ..P....'....PP.  .......#...PP.  PP.....P.....  PPP......P..####  ...........@'.Y#  .........P..#?>#  ........P...# ##  ........PP... ......#..P.P. kiq.....#..P..P.  ... ##.P....  .?.P... ki2 .  .......#.......##....#  ki7P......#...P..P......#  PPP....#........  ki..P....'....PP.  ki9.......#...PP. ki\ PP.....P..... kixd PPP......P..####ki  ki...........@'.Y#  ki|.........P..#?>#  ki ........P...# ##  ........PP... kiA ......#..P.P ki 2.....#..P..P.  ... ##.P... .?.P... ki$kiki3ki1` _An elephant is nearby!ki.#.......##....# .......#.......##....# P......#...P..P......# PPP....#..........P..# ..P....'....PP.......# .#...PP....P...# PP.....P.....PP......# kiPPP......P..####...P.# ..Y#...... .P..#?># .P...#### .PP... ......#..P.PkiH......#..P..P. ... ##.P.....?.P...kiki78.6 (1.0) _kiki3Q _There is an open door here.ki 5.#.##....# ..#.......##....# .P......#...P..P......# PPP....#..........P..# ki ?..P....'....PP.# .#...PP....P...# PP.....P.....PP......# ki PPP......P..####...P.# .'@Y#...... .kit P..#?># .P...#### .PP... ......#..P.P.ki .....#..P..P. ... ##.P.....?.P...ki ki? ,9 _ki ki kih $The helpless elephant fails to defend itself.  You spit the elephant like a pig!!!  Your weapon exudes an aura of protection.ki(ki 1099 10 6050.4 (0.8Poisonous Vapours _You kill the elephant!kikij _Your Air Magic skill increases to level 4!kiˢ l.#.##....# ..#.##....# .P......#...P..P......# PPP....#.P..# ..P....'....PP.# .#...PP....P...# PP.....P.....PP......# PPP......P..####...P.# .'.@#...... .P..#?># .P...#### .PP... ......#..P.P......# kiS ki 31.4 (1.0 _ki ki ki@ H1162.4 (2ki ki @ _You now have 1116 gold pieces (gained 17).kim .#.##....#  .#.##....# kiD P......#...P..P......# PPP....#.P..# ..P....'....PP.# .#...PP....P...#ki_} PP.....P.....PP......# PPP......P..####...P.# .'@.#...... ki.P..#?># .P...####ki= .PP...ki ......#..P.P. .....ki"#..P..P. ki ... ##.P....  .?.P...kiEki00 3 kiH 3.4 (1kiki4kikiXkiIkikikikiki@  There is an open door here.ki S _ki ki kiL7 I PPP......P..####...P.#  ............'..#......  .........P..#?>#  ........P...####.. ........PP........ ......#..P.P..... .....#..P..P...P ... ##.P....... #.@.P....P #.......#.. +.......+.. #.......# #######+# ki'> V61.4 (82.4 (9ki%B kiF  kiZF _x - a scroll of amnesiakiWkikiki#kiki"A1116kikikikikiki]kikiki`F _You reach down and open the door.ki ki kiM ki@  There is an open door here.kijkiN _ki"kikiAn  You encounter a water moccasin.kik& ...PP........  ........#..P.P.....  ........#..P..P...P ........##.P....... ........#...P....P.ki& ........#.......#..........'.......+..........#.......#.......@#######+#........ ........ ......ki&8................................kim'S   water moccasin (asleep)#########.....#..S..+ki/+7.4 (5kia018.4 (6 _ki56ki9kilz   ........#..P.P.....  ........#..P.  ........##.P  ........#..  ........#.  ........'.  ........#  .......@#  ...............  ...............  ...............  ...............  ...............  #########.....#  ..S..+ ki/p   ........#..P.P.....  ........#..P.  ........##.P  ........#..  ........#.  ........'.  ........#  .......@#  ...............  ...............  ...............  ............... ...............  #########.....# ..S..+ kiԐe _A water moccasin is nearby!ki z   ........#..P.P.....  ........#..P.  ........##.P  ........#..  ........#.  ........'.  ........#  .......@#  ...............  ...............  ...............  ...............  ...............  #########.....#  ..S..+ kib '   ........#..P.P.....  ........#..P.  ........##.P  ........#..  ........#.  ........'.  ........#  .......@#  ...............  ...............  ...............  ............... ...............  #########.....# ..S..+ kif kiif ki+j ki,l e _A water moccasin is nearby!ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki4p3ki,vki y ki6y_You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki#..P.PP..P...P#.P..........P....P.......#.'.+#.# .#######+....... #########.....# ..S..+...#ki]9.4 (1 _kikiL.P...P#.P..........P....P....#.'+## ######+ki....... #########.....# ..S..+...##kipY70ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kih 7  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kit.##.P....... .#..P. .#.......#.. .'.+.. .#.# .#######+# ........ ....#########.....## ..S..+.....# .....#.1 _ki r*ki^s$........##.P.......kis7ludeguy the Toxicologistki/tL........#...P....P.kitmOctopode of Gozag Gold: 1116kiuD........#.......#..kiudHealth: 71/71 ========================kivL........'.......+..kixvMagic: 15/17 =====================---kix8........#.......#ki5y-AC: 3ki~y-Str: 13kiyb........#######+#kiz-EV: 15kiFz-Int: 20kiz7................kiz-SH: 0ki{-Dex: 21kic{7................ki{XL: 10 Next: 60% Place: Dungeon:8ki|W........@.......kiU|Noise: ---------  Time: 9471.4 (0.0)ki|X.........*......ki|@c) +0 dagger (protect)ki}`.........*......kiX}7Cast: Poisonous Vapourski}b#########.*...##ki}(Fly ki~D..S..+ki9~.....#ki~nS   water moccasin (weak)ki$.....#ki ......  ki&;Press: ? - help, Shift-Dir - straight linekifRAim: a water moccasin (asleep, chance to weaken: 88%)  ki!You feel a surge of power!  ki3The glob of mercury hits the water moccasin!  ki2'The water moccasin looks weaker.  kik=The water moccasin is moderately wounded.kikiAS.S...==2.4 (1  Aim: a water moccasin (asleep, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the water moccasin!water moccasin looks weaker.  The water moccasin is moderately wounded. _The water moccasin hisses angrily.ki .#..P. .#.......#.. .'.+.. .kiR ^#.# .#######+# ......... ....S#########.....### ki #.....+ #.....##.....# #.#.ki$ ki% --3ki + kiN. F _The water moccasin bites you but does no damage.kiV% ........#...P....P.ludeguy the Toxicologist........#.......#..Octopode of Gozag Gold: 1116........'.......+..Health: 71/71 ========================........#.......#Magic: 13/17 ==================------........#######+#AC: 3Str: 13.................ki% EV: 15Int: 20.................SH: 0Dex: 21.................XL: 10 Next: 60% Place: Dungeon:8.........@.......ki& .Noise: =--------  Time: 9473.4 (0.0).........*.......c) +0 dagger (protect)ki& #########.....###Cast: Poisonous Vapours#.....+Fly #.....##.....#S   water moccasin (weak)#......#.......  kir' 1Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (moderately wounded, weak, chance to weaken: 88%)  You feel a surge of power!kiZ vSAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a water moccasin (moderately wounded, weak, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury misses the water moccasin.  The water moccasin bites you but does no damage.=4.4 (1ki ki  ki M_The water moccasin barely misses you.ki}p  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiP _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kikiNkiki}  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.) ki Casting: Mercury Arrow (safe; 1% risk of failureki)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki & _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki? kiJ ki ki   Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kiP& _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)asting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki>ki"3ki$ ki$ Casting: Mercury Arrow (safe; 1% risk of failure)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  Casting: Mercury Arrow (safe; 1% risk of failureki"%)onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki] onfirm with . or Enter, or press ? or * to list all spells. _You can't see any susceptible monsters within range! (Use Z to cast anyway.)  You puncture the water moccasin!  Your weapon exudes an aura of protection.  You grab the water moccasin.  The water moccasin is heavily wounded.kiq^[10 -5.2 (0.8kiekiEi~ _You constrict the water moccasin. The water moccasin closely misses you.ki $You hit the water moccasin.  The water moccasin is almost dead.You constrict the water moccasin.ki)ki{1116 3-9 (0.7kikiR _You kill the water moccasin!kiF2....#.'+## #######+#.........#########.....### + ki##....###ki$ki4-6.9 (1.0ki6ki?kis$24kiY4=-7.9 (2kikih ki1_You now have 1124 gold pieces (gained 8).ki 4 kiR '+## #######+#.........#########@....###kiq + + ki 0##ki N#.....#ki ki *8.9 (1kiu ki kiIkiWkiR,kikiO0 3 kiki2ki9=kikiki kikiki:L5==ki)kikiOki'kikiOki ki kiC +1124ki ki ki>:==ki=kiki}kiuki8kikikiuki56=ki6ki kikiJki/ki$kikipki!ki!ki"ki$kiP%9=kiK&ki.(ki(ki)kid+ki+ki,ki.ki_/67==ki/ki0ki3kiz5ki5ki6ki8kie:ki:ki;kiY=ki??ki?ki@kiOBkiCkiD:==kiEkiHkiIkiJkiJkiNki OkiOkirPkiRkiSkiTki"UkiiWkiyY,kiHZkiw^F _You reach down and open the door.kiem........'.......+.. ........#.......#............#######+#................>kif'........#########....@### 505.9 (27.0)#.....'.# ki)f#.....#.# #.....###.#kiPf,#.........##.........##.....###.#kipf#.....# ##.....#kilkin+6.9 (28ki^vQ _Found a stone staircase leading down.kiFGIkizHkiIkiLBkiMki NkiNkiOkiPkiPkimQkiTkiUkiUkiUki]ki?_ki2aki2bki$ckidkif,kiegkihkiikiikijkikki2mkimkinkijqki(t,kiyuki.wkiykiDykiqzki{ki5}kie}ki~kiH@  There is an open door here.kiK _kiXkia,kiDkikiq  You encounter a kobold. It is wielding a +0 short sword.kikiM...#...P..# ...'....PP.......#.. ...#...PP....P...#.. ...P.....PP# .....P..####...P.# ........'..#. ki.....P..#?># ....P...####.....'.....K ....PP..........@# ...#..P.P......P.# .... ...#..P..P...P...#..... ...##.P.......P'##..... kig...#...P....P.......... kiŚ...#.......#...........K   kobold (asleep) ki...'.......+........... ...#.......#........... kiI...#######+#...........kiK-21.9 (15ki22.9 (16 _kimkikiXP.......#...... ....P...#...... P......#...... #...P.#...... #............ ?>#............ ###.....'.....K .......@#......P.# .... P...P...#..... .....P'##..... ...P...kis ..#.... ..+.... #.... .ki' kiP &P.......#...... ....P...#...... P......#...... #...P.#...... #............ ?>#............ ###.....'.....K .......@#......P.# .... P...P...#..... .....P'##..... ...P.....#....kiPQ ..+....#.....ki\ kid] kig ki!k ] _A kobold is nearby!ki|=P.......#...... ....P...#...... P......#...... #...P.#...... #............ ?>#............ ###.....'.....K .......@#......P.# .... P...P...#..... .....P'##..... ...P... ..#.... ..+.... #.... . ki2P.......#...... ....P...#...... P......#...... #...P.#...... #............ ?>#............ ###.....'.....K .......@#......P.# .... P...P...#..... .....P'##..... ...P.....#.... ..+....#.....ki kikiki"ki%] _A kobold is nearby!ki ki ki) \ _Unknown command.kiE#...P..P......# #..........P..#.'....#.#...PP....P...#.P.....PP......#.kiAJ P..####...P.#..'..#.#?>#.............P...####.....K.PP.....#.......#..P.P......P.#.......#..P..P...P...#.......##.P.......P'##.......#...P....P............#.#.............'.+.............#.......#..kiLkiM73.0) _kiDRkiUQ _There is an open door here.ki@  _Unknown command.kiG ki kiJ ki  ki 8_Unknown command.kiO#...P..P......# #.P..#.'....PP.......#.#...PP....P...#.ki!P.....PP......#.P..####...P.#.'..#.P..#?>#.kiP...####.....'@....K.PP.ki#.K#..P.P......P.#.kiq#..P..P...P...#.Kki<P##.P.P'##.Kki\#...P....P......KKK 4 koboki{_lds (2 missiles, asleep) .#.#.......ki@'.+....... ki;;4kiki!  You encounter 3 kobolds. _A kobold is quivering stones. A kobold is quivering stones.kiX  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiS $You feel a surge of power! You begin to radiate toxic energy.  The kobold shouts!  The kobold is poisoned.kiύ 0$kid 1$ki ...P..#..............#..........P...#........ki ......#........#...P.#........#..............#..............#.....'@....$........#...........P.#..........P...#.......$...P'##.......$ki% .P.............K   kobold (poisoned)#.......................ki @...P..#..............#..........P...#..............#........#...P.#........#..............#..............#.....'@....$........#...........P.#..........P...#.......$...P'##.......$.P.............#.......................ki# K.  You kill the kobold! x3kik KYou hear a shout! x2ki KYou encounter a kobold. It is wielding a +0 dagger.ki KYou encounter a kobold brigand. It is wielding a +0 dagger and quiveringcurare-tipped darts.ki(K   kobold brigand (missile, wandering)KKK 3 kobolds (1 poisoned)ki1124 3------===5Toxic Fly kiH ki%s _You encounter a kobold. It is wielding a +0 dagger.ki 0#...P..P......# #.P..#. '....PP.......#. #...PP....P...#. P.....PP......#.P..####...P.#.'..#.P..#?>#.ki0P...####.....'.@...$K.PP.#. #..P.P......P.#.K. #..P..P...P...#.$. ##.P.......P'##.K. #...P....P.....K. #.ki0a#...... '.+...... ki; $The kobold brigand shouts!  The kobold brigand is poisoned. The kobold is poisoned. x2ki<:K$ki=1K.ki%D KK  poisoned) 2 kobolds (You kill the kobold!ki$HQ(((((((kiU.@.....ki--6kiki>s _The kobold brigand throws a dart. The dart barely misses you.kii ...P..P......# ..P..#.# ....PP.......#.# ...PP....P...#.# .....PP......#.#P..####...P.#.#'..#.#P..#?>#.kirj # P...####.....'..@..$$..# PP.#.# ..P.P......P.#.K.# ..P..P...P...#.$.#.P.kij yP'##......K$.# ...P....P.....K..# .#......# .+.....# kit | $The kobold brigand looks even sicker.kiz -$ki very poisoned)  You kill the kobold! x2  Your toxic aura wanes.kiч V(((((((ki  Z..@....ki --7Fly ki ki t _The kobold brigand throws a dart. The dart closely misses you.kix  Casting: Olgreb's Toxic Radiance (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki2MkiM7-kiTkiW _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki ki kiZ kiɯ F _Unknown command.kil......P..#.........#PP.......#.# PP....P...#.# .PP......#.# P..####...P.#.# ..'..#.......# ki@P..#?>#.# ..####.....'.....$$..# ........#...@.....# .P.P......P.#.K.# P..P...P...#.kiQ$.# P.......P'##......$$.# .P...........$..#kiC...#........# +....#... #####+ki4K.kiki P-8Poisonous Vapours _ki^kivkie .........P..#.........#ludeguy the Toxicologist ...PP.......#.........#Octopode of Gozag Gold: 1124 ..PP....P...#.........#Health: 71/71 ======================== ....PP......#.........#Magic: 11/17 ===============--------- P..####...P.#.........#AC: 3Str: 13 ...'..#...............#EV: 15Int: 20 P..#?>#...............#SH: 0Dex: 21 ...####.....'.....$$..#kitf ]XL: 10 Next: 63% Place: Dungeon:8 P...........#...@*....#Noise: ---------  Time: 9528.9 (0.0) .P.P......P.#.....**..#c) +0 dagger (protect) .P..P...P...#.......$.#Cast: Poisonous Vapours .P.......P'##......$$.#Fly ..P....P...........$..# ......#...............#K   kobold brigand (missile, very poisoned)......+...............# ......#...............# #####+#...........kif Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight linekif Aim: a kobold brigand, wielding a +0 dagger and quivering curare-tipped darts  (heavily wounded, very poisoned, chance to weaken: 88%)  You feel a surge of power!ki u..KAiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight line  Aim: a kobold brigand, wielding a +0 dagger and quivering curare-tipped darts  (heavily wounded, very poisoned, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury misses the kobold brigand.kiu  ((The kobold brigand throws a dart. The dart hits you.  You are poisoned.You have difficulty breathing.ki ,..ki| 66==--==9.9 (1Slow Pois Fly ki ki \ _You feel yourself slow down.kiƽM.........P..#.........#ludeguy the Toxicologist ...PP.......#.........#Octopode of Gozag Gold: 1124 ..PP....P...#.........#Health: 66/71 ======================-- kiS....PP......#.........#Magic: 9/17============------------ P..####...P.#.........#AC: 3kiNStr: 13 ...'..#...............#EV: 15Int: 20 kiP..#?>#...............#SH: 0Dex: 21 kih...####.....'.....$$..#ki¾XL: 10 Next: 63% Place: Dungeon:8 P...........#...@*....#kiNoise: ==-------  Time: 9529.9 (0.0) .P.P......P.#.....*K..#kic) +0 dagger (protect) .P..P...P...#.......$.#ki9Cast: Poisonous Vapours .P.......P'##......$$.#kiZSlow Pois Fly ..P....P...........$..# kivI......#...............#kiK   kobold brigand (missile, very poisone…)......+...............# ki......#...............# #####+#...........Press: ? - help, Shift-Dir - straight lineAim: a kobold brigand, wielding a +0 dagger and quivering curare-tipped darts  (heavily wounded, very poisoned, chance to weaken: 88%)  You feel a surge of power!  kiSThe glob of mercury hits the kobold brigand!  The kobold brigand looks weaker.kiFK.  Aim: a kobold brigand, wielding a +0 dagger and quivering curare-tipped darts  (heavily wounded, very poisoned, chance to weaken: 88%)  You feel a surge of power!  The glob of mercury hits the kobold brigand!kobold brigand looks weaker.  The kobold brigand is severely wounded.ki'Q$...kiR4-10/17==31.4 (1.5ki\ki_$ _You feel sick.ki7 ~.........P..#.........#ludeguy the Toxicologist ...PP.......#.........#Octopode of Gozag Gold: 1124 ..PP....P...#.........#Health: 64/71 =====================--- ....PP......#.........#Magic: 9/17============------------ P..####...P.#.........#AC: 3Str: 13 ...'..#...............#EV: 15Int: 20 P..#?>#...............#SH: 0Dex: 21 ...####.....'.....$$..#XL: 10 Next: 63% Place: Dungeon:8 P...........#...@.K...#Noise: ==-------  Time: 9531.4 (0.0) .P.P......P.#.........#ki c) +0 dagger (protect) .P..P...P...#.......$.#Cast: Poisonous Vapours .P.......P'##......$$.#Slow Pois Fly ..P....P...........$..# ......#...............#K   kobold brigand (missile, unaware, daz…)......+...............# ......#...............# #####+#...........Press: ? - help, Dir - move targetAim: a kobold brigand, wielding a +0 dagger and quivering curare-tipped darts  (severely wounded, very poisoned, weak)  ki  You feel a surge of power!  Poisonous fumes billow around the kobold brigand!  The kobold brigand looks even sicker. You feel sick.ki <3-2.9 (1.5kid ki 2  Aim: a kobold brigand, wielding a +0 dagger and quivering curare-tipped darts  (severely wounded, very poisoned, weak)  You feel a surge of power!  Poisonous fumes billow around the kobold brigand!  ki uThe kobold brigand looks even sicker. You feel sick. _is distracted by your dazzling golden aura.ki2 $P..#.# PP.#.# PP....P...#.# PP......#.# ..####...P.#.# '..#.# ..#?>#.# ####.....'.....$$..# .#....@K...# P.P......P.#.# ki P..P...P...#.$.# P.P'##......$$.# #....# +...#... ki c $You feel sick.ki (ki& 2=-5--4.4Poisonous Vapourskiմ kiķ R _You kill the kobold brigand!kiA:P..#.# PP.#.# PP....P...#.# PP......#.# ####...P.#.# '..#.# #?>#.# ####.....'.....$$..# #.....@...# .P......P.#.ki;# ..P...P...#.$.# .P'##......$$.# #....+....#.... kiD3  You feel sick.kiE>=--ki(Ea5.9Fly kiKkiV _You are no longer poisoned.You now have 1131 gold pieces (gained 7).  Things that are here:kiy317.4 (3.0 _a +0 dagger; a curare-tipped dartkiQA MP..P......# ......P .PP.... PP....P ..PP...... .####...P.#'..?>........####.....'$...)P......P.P...P.... .......P'##......$$.#...........#3=10/17==8.9 (1.5ki.K  You now have 1138 gold pieces (gained 7).113840.4 (3.0kiL kiO 4 _You see here a +0 short sword.kif Y..P......# P..#.# PP.#.# ....P...#.# PP......#.# ####...P.#.# '..#.# #?>#.# ####.....'.....)@..# #.....)...# P......P.#.# P...P...#.$.# ....P....#.....+..... ki ki ,1.9 (1.5ki ki N  You now have 1142 gold pieces (gained 4).ki m424=3.4 (3.0kiٳ kiζ / _You see here a +0 dagger.ki6k ....P..#.........# PP..... P....P ki.PP... ####...P '..#...... #?>##'.....)) kiY.........#.....) PkiPki7. .P...P..ki)$.....P'#ki$kiQ..........# ##+#...........kiki ki!z1===4.9 (1.5ki'ki)kit PP..... P....P .PP... ####...P '..#...... #?>##'.....)) .........#.....). PP. .P...P..$.....P'#$P................# ..........#####ki!ki0/56.4kiƘki!ki  ....P .PP... ####...P '..#...... #?>##'.....)) .........#.....). PP. .P...P..$.....P'#$P......#...########## ..........#7.9ki....P...#.# PP......#.# ...P.#.# ..#.# ?>#.# .....'.....))..# #.....)...# ......P.#.# P...P...#..# P'##......$$.# P.$..# #.# +.#.+#.#ki͏kitU6=9.4kikiĻ  You now have 1148 gold pieces (gained 6).  Things that are here:  a +0 club; a stone8=50.9 (3.0Fly  _You feel yourself speed up.kiQ PP... ###...P ..#...... ?> ##'.....)) kiQ........#.....).P. P...P..) .....P'#$P......#..+ .....>...#kiQki\ki]7=2=1.9 (1kifkit  You now have 1155 gold pieces (gained 7).  Things that are here:552.9 (2ki|ki0 _a +0 short sword; 3 stoneski####...P.#.# '..#......# #?>#.# ####.....'.....))..# .........#.....)...# PP.#.........#P...P...#).# ......P'##$).#kiP.....@..##....#.+.#.#.# ##+#.# ...##########.#>...#.....#kiaki*3.9 (1kiki  You now have 1162 gold pieces (gained 7).6284.9 (2kit ki / _You see here a +0 dagger.ki0M.PP..... ####...P.# '..?>ki0........ ####.....'.....)) ..) P......Pki0\.P...P....)ki 1W..P'##).P)ki+1#+ kiM1Q...#...............#ki*;ki<F=5.9 (1kiYDkiAPN  You now have 1166 gold pieces (gained 4).kibQ266.9 (2kiYki[/ _You see here a +0 dagger.kiZkikikiki d3==kikiK9=kikikiqki%ki'kickikikiٸi70===ki\kiki8kikikiMkiki$kic1=4=kiki{kikikiFki,kiYki,kiikiVkiK==kifkikiOkihkikikiekib5==ki kikiIkikiq,kiDkiI,ki ki>ki:==kiki,kixki!a6=kiX%ki(ki )ki,+ki.ki.ki0ki4ki 5ki7ki:ki:9=ki4=kiK@,kiBkiUFkiFkiHkiLkiLE7==kiNkiWki[ki[ki c,kie,kiFhki"kki+q,kiorkizf==kit|ki>  You see here a +0 dagger.kivkiG _kikikiJkiekiI,kikikikiakiAkijkikikikiYkiYkiki<kiki@kiki*ki kiki0kikiki$ki`kikiki0kikiqkiQkikiNkiRki8ki,kikiki&kinkikiki,ki kikikiC77kibki  kiA I_You now have 1177 gold pieces (gained 11).ki. ki ki, kikikikikikikikikiQF _You reach down and open the door.ki*3kiki%@  There is an open door here.ki.(ki( _ki|)kiK+ki-ki-ki.ki]0ki 2kiz2ki33ki5ki6ki=7ki8ki9kiT;ki;ki=ki?ki8JkiKki$NkifNkiOkiSkiUkiUkiSVkilYki[ki ],kid^ki`kiYb,kiNckiekifkifkiikijkiBkkilki>mkinki:okioki3skipu  You reach down and open the door.  You encounter a bullfrog.kiI...#####'###.....#  ....#.......#.....#  ....#......##.....# ki{f ....#......##.....#  ....#.............# kiف ....#.............#  ....#.......#  ))..#.......# ki )...#......##...@.#  .kiw...#......#####'##  ..).#....... ...  .)).#....... ....#  .)..# .....#  ki....# ....F.#   F   bullfrog (asleep)# ##.....# kiςd # ####### kiT#  ki 1624.9 (68.0)ki25.9 (69 _kiՔki6ki .' ....#.....# ....##.....# ....##.....# ...........# ...........# ...........# )).........# ).ki) #...@.# ..####'## ..) ... .)) ....# .)..# .....#  ....F.#  ##.....#  ####### kiN "kiY .' ...#.....# ...##.....# ...##.....# ..........# ..........# ..........# )).........# ).#...@.# .####'## .) ... )) ....# )..# .....#  ....F.#  ##.....#  ####### ki\ ki] kic kig I _A bullfrog is nearby!kig ki .' ....#.....# ....##.....# ....##.....# .kiE |..........# ...........# ...........# )).........# ).kiw Q#...@.# ..####'## ..)ki T ... .)) ....# .)..# .....# ki L ....F.#  ##.....# ki > ####### kil.' ...#.....# ...##.....# ...##.....# ..........# .kil.........# ..........# )).........# ).kim&#...@.# .####'## .) ... ki-m%)) ....# )..# .....#  ....F.# kim ##.....#  ####### kiukiwkikiY_ _A bullfrog is nearby!kiHF........... ....#####'## .....#...##...kiF.##....... ... ))kiF;.... ).kiF..##.......#####'##.)kiF" ... kiG).#....... ....# .) ....ki1G ....F##.....#######kiUGkiPki*R76.9 (1.0) _kioYki\ki] ]#####'##.........#ki .#.. )) )...## ki `...#####'#)kiܬ M. ... ))ki n....#..# .....#ki @.....FkiU .##....kiv = ###### ki ki %7ki ki kil.........#.#.. )) ki)...## .####@##).........ki݉)).........#..# .....ki........F..##....kiS. ###### ####kiFkiNki%8kikiQ _There is an open door here.kiUA#..#........... ))..... )...##.....# ...#####'#).......@.#))..# .F##.... ###### ####kiIkiJH9Poisonous Vapours _kiNki2Rki@ ....#......##.....# ludeguy the Toxicologist ....#......##.....#ki{ ] Octopode of Gozag Gold: 1177 ....#.............# Health: 71/71 ======================== ....#.............#ki  Magic: 16/17 ======================-- ....#.............# AC: 3ki uStr: 13 ))..#.............#ki  EV: 15Int: 20 )...#......##.....#ki  SH: 0Dex: 21 ....#......#####'##kiH   XL: 10 Next: 65% Place: Dungeon:8 ..).#...........@.#kih  Noise: ---------  Time: 9629.9 (0.0) .)).#.............#ki  c) +0 dagger (protect) .)..# .......F.#ki  Cast: Poisonous Vapours ....# .........#ki > Fly ....# ..##.....# ....# . ####### F   bullfrog (asleep) ....# ki-#####kiZAiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetkiAim: a bullfrog (asleep)  You feel a surge of power!  Poisonous fumes billow around the bullfrog!  ki!The bullfrog is poisoned.kihFki.kiL .##.....# .......# ki......# .....# ))# ) ..#####'## ).......@.# )).......F.# )..# .........# kiK, .........#  ..##.....#  . ####### Fpoisoned)kivki J====30.9 (1ki}$ki_)  Press: ? - help, Dir - move target  Aim: a bullfrog (asleep)  You feel a surge of power!  Poisonous fumes billow around the bullfrog!  The bullfrog is poisoned. _croakski) .ki7 ( ki7  You closely miss the bullfrog. You grab the bullfrog.  The bullfrog is lightly wounded.ki< a=---1.7 (0.8kiD kizH r _You constrict the bullfrog. The bullfrog closely misses you.kiXq$ _You constrict the bullfrog. The bullfrog closely misses you.You puncture the bullfrog!  Your weapon exudes an aura of protection.  You squeeze the bullfrog!  The bullfrog is almost dead.  kiSki21177 10 7---2.5Poisonous VapourskikiL _You kill the bullfrog!kiDc ........ )).....# ).##.....# ...#####'##).......))..# ..##  kiki4-3.5 (1.0kikikipa85-4.5 (2ki&kiP? _You now have 1185 gold pieces (gained 8).kiZ .......# ))....# )...## ...#####'##).......))...# .##.Fly   kidkid= 3 5.5 (1kijkimki}M##.....# ......# )).... )..##.....#.#####'#.)ki;.).#.... .)....##..... ....# . ####### kij7==6kikikiD M.##..... .......# )).......# )..##.....#.#####'#.)).#.....).. kiE ....# ..##.....# kifM kiM %7kiR kiU kiC2.#......##.....# .#......##.....# .#.............# .#.......# .#......# .))..#.....# .)...#......##.....# .#......#####'## .).#.# .)).#...# .)..#.# .#.# .# ...##.....# .# .. # .# . #  kiHki\J%8kiRkiRki Ability - do what?CostFailure  Invocations -  X - Renounce ReligionNone0% a - Potion Petition400 Gold0%  b - Call Merchant800 Gold0%  c - Bribe Branch3000 GoldkiS0% [?] toggle between ability selection and description.ki ki; i.....#......##.....#  ludeguy the Toxicologist .....#......##.....#  Octopode of Gozag Gold: 1185 .....#.............#  Health: 71/71 ======================== .....#.............#  Magic: 17/17 ======================== .....#.............#  AC: 3Str: 13 .))..#.............#ki̫   EV: 15Int: 20 .)...#......##.....#  SH: 0Dex: 21 .....#......#####'##  XL: 10 Next: 67% Place: Dungeon:8 ...).#..........@..#  Noise: ---------  Time: 9638.5 (0.0) ki ..)).#.............#  c) +0 dagger (protect) ..)..# ..........#  Cast: Poisonous Vapours .....# ..........#  Fly .....# ...##.....# .....# .. #######   .....# .   ######    ki ;Your weapon exudes an aura of protection.  You squeeze the bullfrog!  The bullfrog is almost dead.You constrict the bullfrog. _You kill the bullfrog! _You now have 1185 gold pieces (gained 8).ki P  Okay, then.ki ki: kib . _ki ki ki ki F _Unknown command.ki3kiki_ _You can't see any susceptible monsters within range! (Use Z to cast anyway.)ki@kiEkiki=kikiW: _kikiXkiKkiki,kikikikikibki kiEkiki"kiQki+1185kikikiHk  You encounter 4 killer bees.ki'.....))..#.............# #.....)...#......##.....# #.........#......#####'## #.......).#.............# #......)).#.............# ......)..#.............# .........#.............# .....#......##.....# .......######### ........#.....?.'y.... ###########..... Poisonous Vapours# # ..y. # ##......## y.y # #......# ..   yyyy 4 killer bees (asleep)# #....... . kim  #......#    ki4,44.5 (6kix15.5 (7 _ki}kiki,)) )...#......# #......#####'## ).#.............# )).#.............# )..#.............# #........ #......# kiv#.....@# #.....?.'y.... #.......#.....  .........# ..y.  ##......## y.y kir #......# ..  #....... .  #......#kiki-i)) )...#......# #......#####'## ).#.............# )).#.............# )..#.............# #........ #......# #.....@# #.....?.'y.... #.......#.....  .........# ..y.  ##......## y.y  #......# ..  #....... .  #......#kipki}qki4wkiyzd _There are monsters nearby!kiġ)) )...#......# #......#####'## ).#.............# )).#.............# )..#.............# #........ #......# #.....@# #.....?.'y.... #.......#.....  .........# ..y.  ##......## y.y  #......# ..  #....... .  #......#kiGL M)) )...#......# #......#####'## ).#.............# )).#.............# )..#.............# #........ #......# #.....@# #.....?.'y.... kiL y#.......#.....  .........# ..y.  ##......## y.y  #......# ..  #....... .  #......#kiRX kiY kiXb kifi d _There are monsters nearby!ki j.....)...#......##.....#  .........#......#####'##  .).#.............#  ......)).#.............#  ......)..#.............#  kik ..#.............#  #......##.....#  #......########  #.....?@'y....#  ki ##########.......#.....# # ...ki g# ..y.# kiӤ 7# ##ki ## y.y# # ki N......# ..# ki< # #....... .# ki` {# #......# #ki >  ....... ki /  ki 2y.ki ykiܮ .ki *y.ki& yThe killer bee buzzes angrily. x2; You hear an angry buzzing noise.ki| 1yki #.ki! %yki >yykiw ki 4y.ki 9y.ki¶ $.ki 'ykiP 1y.ki 7y.ki yyyyyyyy 6 killer bees (1 wandering)  You encounter a killer bee. x2ki 4===6.5 (1kiK ki 7 _The killer bee buzzes angrily. x2ki%  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki^ #......#......#......#......#......#......#......#########.....?@'.....##.......#yy.y.#ki^........# .y..##......## y.y##......# ..#kiL_r#.......#ypoisoned)#......#ki|_a.......You feel a surge of power! You begin to radiate toxic energy.ki #......#......#......#......#......#......#......#########.....?@'.....##.......#yy.y.#........# .y..##......## y.y##......# ..##.......##......#.......kis ky.y.ki 6y.ki 6y.ki  2y.kio 2y.ki ki ki 2y.ki 6y.ki 2y.ki6 .ki( - 5kis 3------7Toxic Fly ki kiG W _The killer bee is poisoned. x6; The killer bee looks even sicker.ki  $You hit the killer bee.  Your weapon exudes an aura of protection.  You grab the killer bee. You squeeze the killer bee.$kiy.y.y.y.kiX  3 killer bees (2 , 1 very po…)ki;You kill the killer bee! x2ki=1185 ------10 70--8.2 (0.7kiWkiP _The killer bee misses you.kis { $You puncture the killer bee!ki +$ki J yy   killer bee (unaware, dazed, very pois  You kill the killer bee! x2  Your toxic aura wanes.You feel a bit more experienced.kiu 4--9.0 (0.8Fly  _The killer bee is distracted by your dazzling golden aura.kiu  _Your Spellcasting skill increases to level 5!ki)...#......##.....#  #......#####'##  ).#.......ki#  )).#.......#  ki )..#.......#  #.......ki,.#  kiE\#......##.....#  ki\Z#......#  ki#.....?.@$....#  kis.#y....# ki-  kij.#$....# ki-  ki ##......##.....# ki#-  ki]#......# .....#   #....... .....# ki|-  ki#......# ...•.#  kiT....... '#####ki/  ki $Found 6 gold pieces and 2 flux baubles.kiiSki{5-50.0 (1.0Poisonous Vapourskiki7 _You kill the killer bee!You now have 1196 gold pieces (gained 11).kiea96-1.0 (2kiki1 _There is an open door here.ki` e...#......#####'##  ).#.......#  )).#.#  )..#.#  ..#.#  #......##.....#  #......########  #.....?.'$....#  ########.......#@....#   .........#$....#  ##......##.....#  ki !......##.....#  #.............#  #......##...•.#  ....... #'#####   #..   ki_ ki *2.0 (1ki* ki! ki A2014ki= 5=3.0 (2ki kiB ? _You now have 1201 gold pieces (gained 5).ki3M)......#####'#.).#..kio).#...)..#............##.....#.####### ki.......#.....?.' ########.......#..........#$kiŀ##.....#......##.....# ..kib .#..kiki= 3 4.0 (1ki͐kiܙkiG125.0 (2kiȠkị@ _You now have 1212 gold pieces (gained 11).ki( .###'#).......)).#....#......#........##..########?.'..... ########.......# ki4)V.........#$##......##. #....... .#..  kiv/ki/*6.0 (1ki5ki8kiE 4 ).......))..#.....#........##.....########....?.'..... ########.......#kiF  ..####. ..ki1F #..  kiMX kiY A=7ki)` kif king F88.0 (2ki k kil ? _You now have 1218 gold pieces (gained 6).ki7 " ))..#########?.'..... #######..# ..### ..##...•#..  ki ki *9.0 (1ki2 ki ki )..#.#  ..#.#  #......##.....#  #......########  #.....?.'.....#  #######.......#.....#   ...#.....#  ####.....# ki  ......##.@...#  #.............#  #......##...•.#  ....... #'#####   # #..  #..  #..  #.   kiA kiF U5==60kiž ki ki,p%..#.#  #......##.....#  #......########  #.....?.'.....#  ######.......#.....#   ...#.....# kipo ####.....#  ......##.....#  #..........@..#  kip#......##...•.#  ....... #'#####  kip # #..   #..  ki q#..  #.   kiq/  kiwkix%1ki}kikiMP#......##.....#  #......########  #.....?.'.....#  #####.......#.....#   ...#.....#  ####.....# ki ......##.....#  #.......#  kiB#......##...@.#  ....... #'#####   # #..   #..  #..  #.  kihQ    kikiM%2kiki>&kio'*3.0 (2ki+ki/3 _g - 5 flux baubles (gained 2)ki4.#.............# .#......##.....# .#......######## .....#.....?.'.....# ######.#.....#  ...#.....# #......##.....#  ###.....#kiy  #..........@..#  #......##.....# ....... #'##### ki# #..  #..  #.. #.kiŭ,   kiki$k1218==4.0 (1kiki kiA` )..#.# .#.............# .#......##.....# .#......######## ......#.....?.'.....# #######.#.....#  ...#.....# #......##.....#  #......##.@...#  #.............#  #......##.....# ....... #'##### # #..  #.. ki` #.. #.  kid kive %5kih kii ki+ zM))..##.....#.####### ......?.' #######...#....##......#......##.....#  Fly # #.ki` ki: S6=6ki ki kiM.)))..#...ki..........##.....#..####### ......?.' #######..kiIP.###....kiq#......##.....# ... ki)###.kicki`%7kikiki{...######'## ..).#.# .)).#.# )..#.# .#.............# .#......##.....# .#......######## .......#.....?.'.....# ########.#@....#  ...#.....# #......##.....#ki"R  ###.....#  #.............#  #......##.....# ....... #'##### ## #..  #.. ki ki+ %8kikikiunM)......#####'#.).#..).#...)..#....kin........##.....#.####### .......#.....?.' kin########................##.....kiNo#......##.....# .. .#..kivkiw%9ki}kiEkiuki*kikigkiWkidkihki/kid .)...#......##.....# .#......#####'## .).#..#ki#  .)).#...# .)..#....# .#.....# .#......##.....# .#......kiZ # .#.....?.@.....# ki {#.#.....# ki > ..#.....#ki   ##......##.....#kiҴ  ki } #......##.....# ki } #.............# ki% _ #......##.....#kiD   ....... #'#####kib x  ## #.. kiq kiA B=70ki kiV Q _There is an open door here.kiw &.)...#......##.....# .#......#####'## .).#.......#ki.x  .)).#.......# .)..#.......# kiMx e.#.......# kiox .#......##.....# .#......kix # .#.....?@'.....#kix  #.#.....# # kiy m.#.....# #kiy  ##......##.....# #ki Welcome to Luonef's Armour Boutique! What would you like to do?  a -  66 gold a +0 chain mail  b -  126 gold a +0 cloak of stealth  c -  22 gold a +0 leather armour  d -  198 gold a +0 plate armour ki> ' e -  44 gold a +0 ring mail  f -  44 gold a +0 ring mail  g -  143 gold a +1 ring mail of positive energy  h -  198 gold the +0 ring mail of Monotheism {+Inv}  i -  9 gold a +0 robe You have 1218 gold pieces. [Esc] exitki> [!] buy|examine items[a-i] mark item for purchase ki> [/] sort (type)[A-I] put item on shopping listkikiUki#.............#  ludeguy the Toxicologist##......##.....#  Octopode of Gozag Gold: 1218........##'#####  Health: 71/71 ========================##########.....#  Magic: 17/17 ========================#.....#  AC: 3Str: 13ki)#.....#  EV: 15Int: 20#.....#  SH: 0Dex: 21#.....#  XL: 10 Next: 75% Place: Dungeon:8#..@..#ki  Noise: ---------  Time: 9691.0 (7.0)#'#####  c) +0 dagger (protect)...  Cast: Poisonous Vapours.....  Fly ...... ####.         _g - 5 flux baubles (gained 2) _There is an open door here. _p - a scroll of poison _Found Luonef's Armour Boutique. _There is an open door here.  There is an entrance to Luonef's Armour Boutique here.kima _kikiքkiFkiهkikia: _kiki$kikiUkijki_kiki%kiF_There is an open door here. _p - a scroll of poison _Found Luonef's Armour Boutique. ki|>_There is an open door here.  There is an open door here.kiki] _kikikiki(kikiUkikiki.kikiki̷ki*N _e - 6 potions of enlightenment (gained 1)kiϿkimkikikikikipkikiokikiBkiki>kikikiUkiXkiGki*kikiqkikiEkikiki[kiki kikikikikiki`kikikiSkikikiE $ kiq T_t - 2 scrolls of teleportation (gained 1)kiIkiEkikikikikikikikieki>!  You reach down and open the door.  You encounter a kobold geomancer. It is wielding a +0 dagger of speed.ki)Y..'.#........##'### ki)..#.# .. ##########.... ..###.# ##. #........#.... ki>*=......# .. #........#.... ......# .. #........#.... ..###.# ###. #........#.... ..# #kie*..K #........#..∩. ..#ki*###'####........#'### .###...@................ ki*x.##.................... .ki*#....................Poisonous Vapourski* #.......########..... #.......#ki+i#..... #.......#ki9+#..... K   kobold geomancer (wandering)#.......#ki_+i#.....#.......#ki+e#.....#.......#ki-KK.712.0 (21.0)ki6ki723.0 (22 _ki>kiIki[  ..  ##.  ..  ..  ###.  # .K. #........#..∩ ###'####........#' #...@............. #........... . #........... #.......#### #.......#  #.......#  #.......#  #.......#   kiP  ..  ##.  ..  ..  ###.  # .K. #........#..∩ki E ###'####........#' #...@............. #........... #........... #.......#### ki #.......#  #.......# ki a #.......#  ki n#.......#  ki ki ki ki g _A kobold geomancer is nearby!kizPut on or remove which piece of jewellery? Jewellery (go to first with "=)  d - a +4 ring of slaying (worn)  e - a ring of see invisible (worn)  f - a ring of wizardry (worn)  i - a +4 ring of slaying (worn)  j - an amulet of chemistry (worn)  n - the ring "Tatui" (worn) {Fly rN+ Str+5 Dex+5}g - an amulet of guardian spirit  h - an amulet of reflection Talismans (go to first with %)a - a riddle talisman[?] describe selected [!] equip|wield|wear|put onki{[tab] equip|unequip kikiPki,..'.#........##'### ludeguy the Toxicologist ..#.#.. ##########.... Octopode of Gozag Gold: 1218 ..###.###. #........#.... Health: 71/71 ======================== ......#.. #........#.... Magic: 17/17 ======================== ......#kij.. #........#.... AC: 3Str: 13 ..###.# ###. #........#.... EV: 15Int: 20 ..# #.K. #........#..∩. SH: 0Dex: 21 ..####'####........#'### XL: 10 Next: 75% Place: Dungeon:8 .###...@................ Noise: ---------  Time: 9713.0 (0.0) .##.................... c) +0 dagger (protect) .#.................... Cast: Poisonous Vapourski#.......########..... Fly #.......##.....#.......##..... K   kobold geomancer (wandering)#.......#ki#.....#.......##.....#.......# _There is an open door here. ki_e - 6 potions of enlightenment (gained 1) _t - 2 scrolls of teleportation (gained 1)  You reach down and open the door. ki_You encounter a kobold geomancer. It is wielding a +0 dagger of speed. _A kobold geomancer is nearby!ki}P  Okay, then.kikiTki . _kiZR.########## ##......##....'.# .............##'##.#.#  .....#############.###....#.#.# .....#.#.....# .....#.#.###.# ###....#........#...# # #.K....#........#..∩..# ###@####........#'## ..## #.......# #...... .. #........ #.######## #.# # #.# # #.# # #.##....kiT/K.kiYkiZ14.0 (1 _kiE`kitdQ _There is an open door here.ki..........# #........########## ....##......##...'.# .............##'#.#.#  .....#############.###....#.#.# .....#.#.....# .....#.#kio.###.# ###....#.#...# # #K@....#.#....# ###'####..#'#.## #..........# #......... ... #.............. #.......######## #.......# # #.......# # #.# #kiYKKki-=5kiOki!] _The kobold geomancer barely misses you.kig ki ki ki ki'###### r weapon exudes an aura of protection.  You grab the kobold geomancer.  The kobold geomancer is moderately wounded.  You constrict the kobold geomancer.  The kobold geomancer casts a spell next to you.  The stone door frame shatters!ºki>@..'..10 =======7 (0.7ºkiEºki{HN _The blast of rock fragments hits you but does no damage.ºkieM###### _The blast of rock fragments hits you but does no damage.hitheavipoints next to you and mumbles some strange words.ºki%0J@..'..ºkig1'6.4ºki6ºki.9N _The blast of rock fragments hits you but does no damage.ºkiq  You completely miss the kobold geomancer.The kobold geomancer is severely wounded.ºki*rZ=------7.2 (0.8ºki#{O _You constrict the kobold geomancer.ºki ######  You hit the kobold geomancer but do no damage.r squeeze misse  The kobold geomancer closely misses you.The kobold geomancer points next to you and mumbles some strange words.úki)J@..'..úki-*e66--=======8.0úki.úki/Z _The stone door frame shatters! The blast of rock fragments hits you.úki5 $You hit the kobold geomancer.  The kobold geomancer is almost dead.You constrict the kobold geomancer.úkiRúki&1218 8=------8Poisonous Vapoursúki úki!T _You kill the kobold geomancer!úki<.# #.# ....##......##.'.# ......##'.#.# .....##.###.# ##....#.#.# .....#.#.# .....#.#.###.# ###....#.#.# # #@.....#.#.# ###'####.#'.## #......# #........ #..... #.......# #.......# # #.......# # #.# #úkiúki]7---------9.8 (1.0úkiúkil  You now have 1235 gold pieces (gained 17).  Things that are here:úkiEb35-20.8 (2úki6úkiu _a +0 dagger of speed; a +0 robeĺki# #.# ....##......##.'.# ......##'##.# .....##.###.# ##....#.#.# .....#.#.# .....#.#.###.# ###....#.#.# # #)@....#.#.# ###'####.#'### #......# #........ #......ĺkiJ#.......#.#.......# #.#.......# #.#.# #.ĺkiEĺkiϔ*1.8 (1ĺkiBĺkiƜĺkis ĺki ĺki ĺki ĺkij 8 3 ĺki ĺki ĺki( ĺkiY ĺki ĺki K9=ĺkiq ĺki ĺkib ĺki ĺki{ ,ĺki~ ĺki ĺkif ĺkiZ ĺki ĺkiv V70=ĺki3 ĺkin ĺki ĺki ĺkix ĺki ĺki ĺki ĺki4 K1=ĺki ĺki ĺkiB ĺki ĺki ĺki ĺki8 ,ĺki~ ĺki ĺki# ĺkik ĺki ĺkil ĺki ĺki ]1235=ĺki ĺki ĺki. ĺkiz ĺki ĺki ĺki ĺki ĺki ĺki ĺki{ ,ĺki ĺki ĺki ,ĺki6 ĺki7 ĺki ĺki+ ĺki ĺkiH# P...)..#...#...............#.....+...............#......##.....#...............#......####### ##+#...............#.......'.....##########.......#.....#................#.....>...#.......##......##.........#.....@.##......##.........##......##..... .###########......#### .'ĺki# B#..............##'#### .#.# # #......########## .###.# #.###....#........#.. .....# #........#........#.. .....# #........#........#.. .###.# #.###....#........#..ĺki@' 041.8 (20.0)ĺki' +2.8 (21ĺki\+ ĺki. . _i - a scroll of identifyĺkiO Iĺki ĺkiI Bĺkin ĺki ĺkii ĺki ĺki ĺki ĺkiz ĺki ĺki ĺki ĺki ĺki ĺkij ĺki ĺki9 ĺkiz ĺki ĺki ĺkip ĺki ĺkim ĺki ĺki ĺki ĺkiI ĺki2 ĺki ĺki ĺki ĺkiq ĺki ĺki\ ĺki ĺki ĺki ĺki ĺki3 ĺki ĺki ĺki ĺki ĺki ĺki' ĺki ĺki; ĺki: ĺki ĺkid ĺki ĺkir ĺki ĺki ĺki0 ĺkig ĺki ĺki ĺki? ĺkiPĺki%ĺkiĺkiĺkiĺkiĺkiĺkiĺkiĺkifĺkiĺkiĺki ĺki ĺki ĺkip ĺki ĺkiĺkiĺkiaĺkiĺkiĺkiĺkiĺkiĺkiĺkiGĺkiĺkiVĺkiĺkijĺkiĺkiĺkipĺkiĺkiĺkiĺkiĺkiĺkiĺki. ĺki~!ĺki!ĺki"ĺki#ĺki %ĺki@%ĺki%ĺki~'ĺki9(ĺkip(ĺki&)ĺkiz*F _You reach down and open the door.ĺkiZ+ĺki+ĺki",ĺki-ĺki.ĺkiQ/ĺki%0ĺki2@  There is an open door here.ĺki:  #.....###.#...#.###. #.#####.... #.........# #... #.....###.# #.###.... ĺki:#.....# #.# #.#) ##.....# #.#.# ..###'### ĺki;Z#.....############. #.....#........ #. ĺkiB;#.....'@....... #.78.8 (36 ĺkim;#.....#........ # #.....#........ #. ĺki;#.....#........ #...... #.....#.......< #. #.....#........ #.ĺki;{ #.....######### #.ĺki; ####### ####### ĺkiB< ĺkik@ĺki@+9.8 (37ĺkiCĺkiE9 _Found a stone staircase leading up.ƺkiO6 ƺki6 ƺki= ƺkiU? Ǻkił Ǻki Ǻki1 Ǻki. Ǻkiړ Ǻki˗ ,ǺkiT @  There is an open door here.Ǻkiל ǺkiΝ  _Ǻki Ǻkid ǺkiZ Ǻki+ Ǻki Ǻki@ Ǻki_ Ǻkiө Ǻki Ǻkik Ǻki Ǻki Ǻki Ǻki Ǻkiܳ Ǻki Ǻkiܴ Ǻki Ǻki Ǻki` Ǻki" Ǻkiļ Ǻki Ǻkie Ǻki߾ Ǻkiv Ǻki[ Ǻki Ǻkih Ǻkik Ǻkiw Ǻki Ǻki5 ǺkiD ǺkiI Ǻki Ǻki Ǻkij Ǻki nǺki Ǻki} Ǻki Ǻki Ǻki^ Ǻki ǺkiO Ǻki_ Ǻki Ǻki{ Ǻki Ǻki Ǻkir Ǻki& Ǻkiy Ǻki Ǻki Ǻki Ǻki ǺkiI Ǻki Ǻki Ǻki Ǻki Ǻki< Ǻki Ǻki\ Ǻki Ǻki Ǻki Ǻki Ǻki ,Ǻki Ǻki5 Ǻki Ǻki Ǻki Ǻkim Ǻki Ǻki^ Ǻki@ ǺkiC Ǻki Ǻki Ǻki Ǻki $  Things that are here:Ǻki ..............##......##...... .....###########......##......## .....'.#...#...#..............##' .....#.#.#.#.#.#......########## .....###.#...#.###....#........# ǺkiS .........#####........#........#. .........# #........#........# .....###.# #.###....#........# .....# #.# #.#@.....#........#803.8 (24 .....# #.#.# ..###'####........#' ....############........... ....#........ #........... ....'........ #........... Ǻki 0....#........ #.......########..  ....#........ #.......# #..  Ǻki ....#........ #.......# #..  ....#.......< #.......##.. Ǻki Ǻki_ Ǻki  Ǻki7 y_a +0 dagger of speed; a +0 robeȺkipPȺkiSPick up what? 14/52 gear slots (_ for help) Hand Weapons (select all with ))  a - a +0 dagger of speed Armour (select all with [)  b - a +0 robe [Up|Down] select[Esc] exit Letters toggle [.|Space] toggle selected[top]ȺkiJ>  a + a +0 dagger of speed[Enter] accept (1 chosen)ɺki-ɺkiɺkiɺki%ɺki-H..............##......##......... ludeguy the Toxicologist .....###########......##......##. Octopode of Gozag Gold: 1235 .....'.#...#...#..............##' Health: 71/71 ======================== .....#.#.#.#.#.#......##########. Magic: 17/17 ======================== .....###.#...#.###....#........#. AC: 3Str: 13 ɺki0..........#####........#........#. EV: 15Int: 20 .........# #........#........#. SH: 0Dex: 21 .....###.# #.###....#........#. XL: 10 Next: 78% Place: Dungeon:8 .....# #.# #.#@.....#........#. Noise: ---------  Time: 9803.8 (0.0) .....# #.#.# ..###'####........#' c) +0 dagger (protect) ....############................. Cast: Poisonous Vapours ɺkid.....#........ #................. Fly ....'........ #................. ....#........ #.......########..ɺki.  ....#........ #.......##..  ....#........ #.......##..ɺki.  ....#.......< #.......##..  ɺki._You reach down and open the door.  There is an open door here. _Found a stone staircase leading up. _There is an open door here.  ɺki/Things that are here: _a +0 dagger of speed; a +0 robeɺki6ɺki7*4.8 (1ɺki=ɺki?N _o - a +0 dagger of speedʺki ʺki ʺki ʺki$ʺkiʺki,ʺkiʺki7,ʺkiiʺkiʺkiʺkiʺkiʺkiʺkisʺkiʺki ʺkid"ʺki/$ʺkiu$ʺkiE%ʺki1'ʺki(ʺki(ʺki)ʺki+ʺki/Xʺki73Xʺki3ʺkiV4ʺki5ʺki7ʺki8ʺki%9ʺki9ʺki#;ʺkiK<ʺki=ʺki=ʺki9GʺkiSHʺkiHʺkikIʺkivLʺkiMʺkiQNʺkiOʺkiQʺkiRʺkiLSʺkiTʺkiAWʺkiXʺkiYʺkiYʺki\ʺki^ʺki^ʺki`ʺkibʺkiyhʺkihʺkiiʺkiFlʺkipBʺkirʺkitʺkiuʺkivʺki'yʺkizʺki{ʺki|ʺki~ʺkiʺkivʺkiʺki͆@  There is an open door here.ʺkiLjʺki _ʺkiʺki9ʺki)ʺki#ʺkiʺkiʺkiMʺkiڕʺki,ʺkiʺkiʺkiʺkiDʺkiʺkiʺki-ʺkiƣʺkiʺkiʺkiʺkijʺkioʺkiʺkiʺki%ʺkiޮʺkinʺkiAʺkiױʺkiʺkiʺkiʺkiCʺkiʺkiʺkiEʺkiSʺkiٽʺkif  You encounter a wyvern.ʺkie#.###....#........#.....#  #........#........#.....#  #........#........#.....#  #.###....#........#.....#  ʺki#.#[.....#........#..∩..#  ..###'####........#'######  ###......................#   #......................#  ʺki  #.............@........#   #.......########.......#   #.......# #.......#  ʺkiB, #.......# #.......#   #.......# ##  ʺkio #.......# #.......#   k   wyvern (asleep)  #.......# k ʺki   #########    ʺki, ʺki035.8 (31.0)ʺkid26.8 (32 _ʺkiʺki9ʺkiR~# #........#.....# .......#........#.....# #.###....#........#.....# #.#[.....#........#..∩..# ..###'####........#'###### ...................#  #......................#  ʺki~........@........#  .########.......#   #.......#   #.......#   #.......#   #.......#  ʺki~y k  ʺkiz  #........#.....# .......#........#.....# .###....#........#.....# ʺki J.#[.....#........#..∩..# ..###'####........#'###### ...................#  #......................#  ........@........#  .########.......#  ʺkiM #.......#   #.......#  ʺkir e #.......#  ʺki e #.......#  ʺki O k  ʺki ʺki ʺkiM! ʺkiu' ʺki++ ] _A wyvern is nearby!ʺkiI  #........#.....# .......#........#.....# #.###....#........#.....# #.#[.....#........#..∩..# ..###'####........#'###### ...................# ʺki3M  #......................#  ........@........#  .########.......#   #.......#   #.......#   #.......#   #.......#   k  ʺki7  #........#.....# .......#........#.....# .###....#........#.....# .#[.....#........#..∩..# ..###'####........#'###### ...................#  #......................#  ........@........#  .########.......#   #.......#   #.......#   #.......#   #.......#   k   _A wyvern is nearby!˺kio6˺ki77˺ki&>˺kiA _You can't see any susceptible monsters within range! (Use Z to cast anyway.)˺ki  ˺ki ˺kiI ˺ki: ̺kiB'.###....#.#.....#  .#.#.....#  ........#.#.....#  .###....#.#.....#  .#[.....#.̺ki#..∩..#  .###'####.#'######  .....#  #......#  #..............#  #.#.̺ki#  #.# #.......#  #.̺ki# #.......#  #.̺kiB# #.......#  #.# #.......#  ̺ki#.# .....k. # #######  ̺ki ̺ki) 77.8 (1.0) _̺ki̺ki̺ki......#.#.....#  #.#.....#  ###....#.#.....#  #[.....#.#..∩..#  ###'####.#'###### #..............#  #.#  #.̺kiR#  #.#########  #.# #.#  #.# #.#  #.# #.#  #.# #.̺kiO#  #.# #.....k.#  ######### #########  ̺ki^/  ̺kiF̺ki%8̺ki̺kiv̺kiT #.#.....#  ##....#.#.....#  [.....#.#..∩..#  ##'####.#'###### ..............#  ...#  .....#  .#########  .# #.#  .# #.̺kiFU #  .# #.#  .# #.#  .# #.....k.#  ######## #########      ̺ki7Z ̺kiZ %9̺kiA_ ̺ki/a ͺki>......#........#.....#  ludeguy the Toxicologist ##....#........#.....#  Octopode of Gozag Gold: 1235 [.....#........#..∩..#  Health: 71/71 ======================== ##'####........#'######  Magic: 15/17 =====================--- ......................#  AC: 3ͺkiTStr: 13 ......................#  EV: 15Int: 20 ......................#  SH: 0Dex: 21 .......########.......#  XL: 10 Next: 78% Place: Dungeon:8 ͺki~,.......##.@.....#  Noise: ---------  Time: 9839.8 (0.0) .......#ͺki#..*....#  c) +0 dagger (protect) .......#ͺki#...*...#  Cast: Poisonous Vapours .......#ͺkiX#....*..#ͺki  Fly .......##.....k.#ͺki9 #################ͺki9  k   wyvern (weak)  ͺkiq Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wyvern (asleep, chance to weaken: 88%)  ͺkiYou feel a surge of power! The glob of mercury hits the wyvern!  The wyvern looks weaker.  The wyvern is moderately wounded.ͺkij9k.ͺkir,....ͺkisP==40.8 (1Poisonous Vapoursͺkixͺkiy{  Press: ? - help, Shift-Dir - straight line  Aim: a wyvern (asleep, chance to weaken: 88%)  You feel a surge of power! The glob of mercury hits the wyvern!  ͺki{The wyvern looks weaker.  The wyvern is moderately wounded. _The wyvern hisses angrily.ͺki5#....#.#.....#  .....#.#..∩..#  #'####.ͺki#'###### .............#  ..#  .#  #########  # #.#  ͺki# #.#  # #.ͺki#  # #....k..#  ͺki*# #.......#  ####### #########   ͺkiT;  ͺki9k.ͺki9 ͺki--1ͺki#ͺki!'T _The wyvern closely misses you.ͺki/U#....#........#.....#  ludeguy the Toxicologist .....#........#..∩..#  Octopode of Gozag Gold: 1235 #'####........#'######  Health: 71/71 ======================== .....................#  Magic: 13/17 ==================------ .....................#  AC: 3Str: 13 ͺki40.....................#  EV: 15Int: 20 ......########.......#  SH: 0Dex: 21 ......##.......#  XL: 10 Next: 78% Place: Dungeon:8 ......##..@....#  Noise: =--------  Time: 9841.8 (0.0) ......##...k...#  c) +0 dagger (protect) ......##.......#  Cast: Poisonous Vapours ......##.......#  Fly #######ͺkiW0#########   k   wyvern (weak) ͺki0Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wyvern (lightly wounded, weak, chance to weaken: 88%)  You feel a surge of power! The glob of mercury hits the wyvern!  The wyvern looks even weaker.ͺki@Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: a wyvern (lightly wounded, weak, chance to weaken: 88%)  You feel a surge of power! The glob of mercury hits the wyvern!  The wyvern looks even weaker.  The wyvern is severely wounded.ͺki2=2.8 (1ͺkiͺkiVT _The wyvern closely misses you.ͺki / 1#....#........#.....#  ludeguy the Toxicologist .....#........#..∩..#ͺkis/   Octopode of Gozag Gold: 1235 #'####........#'######  Health: 71/71 ======================== .....................#  Magic: 12/17 ================-------- .....................#ͺki/ h  AC: 3Str: 13 .....................#  EV: 15Int: 20 ......########.......#  SH: 0Dex: 21 ......##.......#ͺki0   XL: 10 Next: 78% Place: Dungeon:8 ......##..@....#ͺki!0   Noise: ==-------  Time: 9842.8 (0.0) ......#ͺki<0 b#...k...#ͺki\0   c) +0 dagger (protect) ......#ͺki{0 #.......#  Cast: Poisonous Vapours ͺki0 N......##.......#ͺki0 m  Fly #######ͺki0 #########   k   wyvern (poisoned, weak)ͺki1 1 ͺki#1 Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetͺkiA1 Aim: a wyvern (severely wounded, weak)  You feel a surge of power!  ͺkie1 Poisonous fumes billow around the wyvern!  The wyvern is poisoned. The wyvern closely misses you.ͺkir2 2-3.8 (1ͺki6 ͺki8   Press: ? - help, Dir - move target  Aim: a wyvern (severely wounded, weak)  You feel a surge of power!  Poisonous fumes billow around the wyvern!  The wyvern is poisoned. The wyvern closely misses you. _The wyvern barκki $You puncture the wyvern!  Your weapon exudes an aura of protection.κkiFSκki 1235 10 83-4.6 (0.8Poisonous VapoursκkiYκkiJ _You kill the wyvern!κkiI1....#.#..∩..#  '####.#'###### ............#  .#  #  #########  # #.κkiŽ#  # #.#  # #.#  # #.......#  # #.#  ###### #########     κkiqκki/4-5.6 (1.0κkiκkiκkiB513κki/>==-6.6 (2κkiκki٤@ _You now have 1251 gold pieces (gained 16).κkiX####.#'##### ...........#  #  #  #########  # #.#  # #.#  # #.#  # #.#  # #.#  κki##### #########     κkiκki)*7.6 (1κkiκkiơκkiV κki޶ κki κki κki]  3 ==κki κki] K4=κki κki3 κkiW κki κki: κkid κki κki κki κki" κki κki 9=κkiD κki κki κki κki" κki{ Z12515==κki κki κki κki κki κki κkig κki κkiD κki κki κkiv :==κki κki κki κki_ κki κki κkij κki κki> K6=κki κki κkiL κki κki$ κkiS κki κki κki κkip κki κki. 9=κki κki κki κkiT κki κki κkiv κki> κki L7==κki% κki3 κki κkiu κki κki6 κki[ κki κki κki κki κkiJκkiκkiBκkiκkiP:==κkiκkiκkiκki κkiκkiκkiκki"κkiκki κki"κkiz"κki+#κkiQ)κki*κki'+κki+κki2κkib3κki3κki4κki9κki:κki:κkiP;κki?κki[@κki@κkiAκkiEκkiGκkicHκkiHκkiLκkinMκkiMκkiNκkiUκkiWκkiGXκki}Yκkim]κkiQ^κki^κki_κki5bκkicκki_cκki1dκkigκki5iκkiiκkikκkio@  There is an open door here.κki pκkip _κkiqκkiwκkiRyκkiyκkizκkibκkiκkilκki3κkiɇκkiκkiوκki κkiqκkiκki=κkiκki κkiκki<κkiκki κki(κkiκkiκki̙κkiκki>κkiκkiκkiκkiEκkiκkiκkiκki`κkiκkiݨκkiϩκki9κkiªκkimκkizκkiծκkiκkiκkiκkijκkidzκkiκkiκki,κkiKκkiKκkiκkiPκkiXκkiTκkiκkiqκkiκki_κkiκkigκki,κkiκkiκkiNκkiκki8κkipκkiκkiiκkiyκkiκkiκkiOκkiκkiVκkiκkiκkiκkiκki\κkiκki κkiCκkiκkiκkiYκkiκkiκkiκkiw; ........#.......#...... #'.......+...... ##.......#...... ########+#...... ................. ................. .............>... ................. >......@................914.6 (67.0) .#########.....######### #.....'.#...#..#.....#.#.#.#.##.....###.#...# #.........##### #.........##### #.....###.#...# #.....# #.#.#.#κkiκki+5.6 (68κki κki; _Found a stone staircase leading down.Ϻki Ϻki7ϺkiϺkiϺki<Ϻkiv,Ϻki.ϺkiϺkidϺki6Ϻki<Ϻki ϺkiD!Ϻki"Ϻki$$Ϻki%Ϻki &Ϻki&Ϻki+)Ϻki(*Ϻkin*Ϻki*Ϻki+Ϻki,Ϻki,ϺkiF-Ϻki .Ϻki.Ϻki.ϺkiS/Ϻki2Ϻki2Ϻki2ϺkiV3Ϻkii4Ϻki:l PPPP..#### _.............'..# ...........P..#?># #.........P...####ϺkiM;  #PP ##..P.P ##..P..P ###.PϺki;B #@.......#...P23.6 (8.0) #........#.......#........'.......+#........#.......#####........#######+.......................Ϻki;.#.....................#.....................Ϻki <I.......................ϺkiH@Ϻki@*4.6 (9Ϻki|CϺkiE5 _Found a stormy altar of Qazlal.ϺkiMϺkiC  Skill  Level Cost  Apt Skill  Level Cost  Apt Ϻki a - Fighting   7.1   8.0   0   j + Spellcasting 5.0   7.1  -1           b - Polearms   0.0   1.0   0   k - Conjurations   4.0   5.0   0  Ϻki c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1   d - Throwing   0.0   1.0   0   m + Fire MagicϺki>3.4   4.0   0      n + Air Magic4.2   5.0   0  Ϻki e + Short Blades   4.7   2.5   0 +4    Ϻkih/ f - Long Blades   2.8   1.0   0   o - Evocations   0.0   0.8  +1       p - Shapeshifting   0.0   1.2  -1  g + Dodging5.4   6.0   0       h - Shields   0.0   1.0   0      i + Stealth7.7   4.0  +4              Ϻki                            Ϻkit    Skills enhanced by cross-training are in green. Bonus from skill manuals is in  red.  [?] Help[=] set a skill target  Ϻki}[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetsҺkiPҺkiPXҺki_cPPP......P..#### ludeguy the Toxicologist_.............'..# Octopode of Gozag Gold: 1251Һkiv` ...........P..#?># Health: 71/71 ========================#.........P...#### Magic: 17/17 ========================#.........PP...... AC: 3Str: 13#........#..P.P... EV: 15Int: 20#........#..P..P.. SH: 0Dex: 21#........##.P..... XL: 10 Next: 83% Place: Dungeon:8#@.......#...P.... Noise: ---------  Time: 9924.6 (0.0)#........#.......# c) +0 dagger (protect)Һki`#........'.......+ Cast: Poisonous Vapours#........#.......# Fly #####........#######+#.......................Һki`  .#..................... #.....................Һki` ....................... Һki=ajYour weapon exudes an aura of protection. _You kill the wyvern! Һkiia_You now have 1251 gold pieces (gained 16). _There is an open door here. _Found a stone staircase leading down. _Found a stormy altar of Qazlal.ҺkigҺkigҺkijnҺkipӺkivӺkiH Your spells (describe)TypeFailure Level Ӻki a + Poisonous VapoursAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudӺkiLJ_Conjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%ӺkiL4  e - Sticky FlameFire/Alchemy1%Ӻki04 Select a spell to describe [?] help [!]/[I] toggle spell headersԺki?"Sticky Flame Unleashes a short-ranged spray of incendiary goo that clings to an adjacent creature and deals armour-ignoring fire damage over several turns. If the victimis allowed to move, it will put out the fire prematurely. ԺkiIf the target is insubstantial, the liquid fire will fail to stick. Level: 4Schools: Fire/AlchemyFail: 1%  Power: 53% Damage: 2d9 (max 2d15)  ԺkiRange: 1  Noise: A bit loud Miscasting this spell causes magic contamination and also either poisons you or deals up to 9 fire damage. ԺkivThis spell would have no effect right now because you can't see any hostile targets that would be affected. Ժki_________________ Ժki6“Give a man a fire and he's warm for a day, but set fire to him and he's warm  for the rest of his life.”  -Terry Pratchett, “Jingo”. 1997.ֺkim5 Your spells (describe)TypeFailure Level a + Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1% 3  d - Olgreb's Toxic Radiance Alchemy 1%4  e - Sticky FlameFire/Alchemy1% 4 Select a spell to describe [?] help [!]/[I] toggle spell headers׺ki3 Olgreb's Toxic Radiance Causes the caster to radiate toxic energy, continuously inflicting poison on everything in line of sight for as long as the spell lasts. Level: 4 School: Alchemy Fail: 1% Power: 69% Range: N/A Noise: A bit loud Miscasting this spell causes magic contamination. This spell would have no effect right now because you can't see any hostile targets that would be affected.غki = Your spells (describe)TypeFailure Level a + Poisonous VapoursAlchemy/Air1%1  b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic Radiance Alchemy1% 4  e - Sticky FlameFire/Alchemy1%4 Select a spell to describe [?] help [!]/[I] toggle spell headersںkiMephitic Cloud Conjures a fragile flask that explodes into short-lived clouds of noxious fumes.These clouds may cause confusion in any creature not resistant to poison. Tougher, more experienced creatures are less likely to be affected. Level: 3Schools: Conjuration/Alchemy/AirFail: 1% Power: 48% Range: 4 Noise: Very loud Miscasting this spell causes magic contamination. ںkiMThis spell would have no effect right now because you can't see any hostile targets that would be affected. _________________ “Seit mehreren Jahren schon hatte die indische Cholera eine verstärkte  Neigung zur Ausbreitung und Wanderung an den Tag gelegt. Erzeugt aus  den warmen Moraesten des Ganges-Deltas, aufgestiegen mit dem  mephitischen Odem jener üppig-untauglichen, von Menschen gemiedenen  Urwelt- und Inselwildnis, in deren Bambusdickichten der Tiger kauert,  hatte die Seuche in ganz Hindustan andauernd und ungewöhnlich heftig  gewütet, hatte östlich nach China, westlich nach Afghanistan undۺki Your spells (describe)TypeFailure Level a + Poisonous VapoursAlchemy/Air1%1 ۺkiE b - Mercury ArrowConjuration/Alchemy 1% 2  c - Mephitic CloudConjuration/Alchemy/Air 1% 3  d - Olgreb's Toxic Radiance Alchemy1% 4  e - Sticky FlameFire/Alchemy1%ۺki ;4 ۺkiF ۺkiۺkiۺkiSelect a spell to describe [?] help [!]/[I] toggle spell headersۺki=Q ۺkiY ۺki` cPPP......P..#### ludeguy the Toxicologist_.............'..# Octopode of Gozag Gold: 1251ۺki` ...........P..#?># Health: 71/71 ========================#.........P...#### Magic: 17/17 ========================#.........PP...... AC: 3Str: 13#........#..P.P... EV: 15Int: 20ۺkia #........#..P..P.. SH: 0Dex: 21#........##.P..... XL: 10 Next: 83% Place: Dungeon:8ۺki4a #@.......#...P.... Noise: ---------  Time: 9924.6 (0.0)#........#.......# c) +0 dagger (protect)ۺkiQa #........'.......+ Cast: Poisonous Vapoursۺkiza #........#.......# Fly #####........#######+#ۺkia ....................... .#..................... #..................... ۺki#b x....................... Your weapon exudes an aura of protection. _You kill the wyvern! _You now have 1251 gold pieces (gained 16). _There is an open door here. _Found a stone staircase leading down. _Found a stormy altar of Qazlal.ۺkis Pܺki ܺki ,  Skill  Level Cost  Apt Skill  Level Cost  Apt  a - Fighting   7.1   8.0   0   j + Spellcasting 5.0   7.1  -1           b - Polearms   0.0   1.0   0   k - Conjurations   4.0   5.0   0  ܺki c c - Unarmed Combat   0.0   1.0   0   l - Alchemy  12.1  12.6  +1   d - Throwing   0.0   1.0   0   m + Fire Magic3.4   4.0   0      n + Air Magic4.2   5.0   0  ܺki  e + Short Blades   4.7   2.5   0 +4     f - Long Blades   2.8   1.0   0   o - Evocations   0.0   0.8  +1      ܺki  p - Shapeshifting   0.0   1.2  -1  g + Dodging5.4   6.0   0       h - Shields   0.0   1.0   0      i + Stealth7.7   4.0  +4              ܺki             ܺki a    ܺki _    ܺki0 a    ܺkiF _    ܺki[ T    ܺkix Skills enhanced by cross-training are in green. Bonus from skill manuals is in  ܺki red.  [?] Help[=] set a skill target  ܺki }[/] auto|manual mode [*] useful|all skills [_] enhanced|base level  [!] training|cost|targetskiX n * Air Magic   4.2kikp n - Air Magic   4.2kiY ki.PPP......P..#### ludeguy the Toxicologist_.............'..# Octopode of Gozag Gold: 1251...........P..#?># Health: 71/71 ========================ki>#.........P...#### Magic: 17/17 ========================#.........PP...... AC: 3Str: 13#........#..P.P... EV: 15Int: 20#........#..P..P.. SH: 0Dex: 21#........##.P..... XL: 10 Next: 83% Place: Dungeon:8#@.......#...P.... Noise: ---------  Time: 9924.6 (0.0)#........#.......# c) +0 dagger (protect)ki#........'.......+ Cast: Poisonous Vapours#........#.......# Fly #####........#######+#....................... .#..................... kiUH#..................... ....................... Your weapon exudes an aura of protection. _You kill the wyvern! ki_You now have 1251 gold pieces (gained 16). _There is an open door here. _Found a stone staircase leading down. _Found a stormy altar of Qazlal.ki3kikiki#ki'$ki3*ki.  _You kill the wyvern! _You now have 1251 gold pieces (gained 16). _There is an open door here. _Found a stone staircase leading down.rmy altar of Qazlal. _Unknown command.kir?ki?kiEkikHF _Unknown command.ki+ kiG kij ki ki ki : _ki ki ki- ki ki\ ki ki ki ki3 ki ki kiI ki ki kir ki& ki kiy ki ki} ki, H.......#....... P......#...P..P.PP PPP....#........PPP. ..P....'....PP..PP...PPP.......#...PP....PPPPPP.....P.....PP..PPP...PPP......P..####PP..._.....'..##..ki ..P..#?>#30.6 (6##.P...###.PP......P.P... #....P..P.. #........##.P #........#...P #........## #........'+ki ki ki T _Key pressed, stopping explore.ki ki3 ki# ki' F _Unknown command.kiLy3ki|ki#kiki]: _ki"L  There is a stormy altar of Qazlal here.kiki  _kikikikikikikiDkiki5kikikiki6kikikiLki9kiki\kikikikikikikikilkiki5ki kikiVki]kikiRkikikikibki ki ki kikikiUki'kikixkikikiVkikikkikiki!kikiki ki!ki*"ki%ki%kiI&ki'ki(ki),ki*ki+ki-kil-ki-ki\0ki1ki&2ki2ki4ki5kin5ki5ki8ki9kih:ki;ki=kir>ki>ki@kiTAkiBkiBkiCkiEkiFkiFki]GkiIki6KkiKkiILkiYNkiOkiPkiPkiRkiSki2Tki@UkiVkiXkiXkiYkiw]ki_ki`ki9bkickiekifki)gki0jkikkikkilkiokipkipkiqki`ukivki wkiJxki'zki{ki3|ki7}kiPki~kikikikikikikikiki9kiđkikikiki}kipkiki kikikiZkiդkiȥkiki֩ki_ki}kinkiki|kipkiRkikiLkiI _i - 4 scrolls of identify (gained 3)ki»3kikikiJkikiRkikiki*kikiakikikikiki$kikigkikikiki kikiZkikiki\kikiDki,ki kirkikikikiki RkiBki%kikiki%kiAkinki4kikin kiJki L,kiN,kiO,kiPkiQki!RkiRkiTkiUkiOVkiVkilXki5^ki`ki`ki;aki bkiDckihdkidkidkifkigkihkiikiikijkikkkikkimkibnki*okiokipkiqkilrkirkiukiuki=vkivki*yki/zkizkizkia|ki^}ki}kiS~kikikiPkiki|ki2kiki&kikiki#kiokikikiQkikiAkikihkiki7kikiܤki kikikiki`kikihkiHkikiPkikikiHkikiki kiki kikikikikikikikiZkiki$ki]kiki,kikiki     ####  ki_\ #...   #####..#   #.....#   #.#..### ##  #.. PP10033.6 (103.0)  #..PPP..._. PPP.  ##..PPPP... PPPPP  #.....PP PPP......P  #.P....PPP......PPP  #.PPPP......PPPPP..  #...PPP...PPP.....#  ###...PPPPP....#### ###.......##.#ki ki +44ki6ki9 _Found a shadowy altar of Dithmenos.kidkijeki gkin0.0)................kirkicukixT _Key pressed, stopping explore.ki kikikikiki: _kiPkiٗkiYkivkikiHkiߝkikikikikiki kiUkiťkijkikikiMkiki7kikiki8kikikikikivkiָ     .  .......kiC ############# .... ##....@......[ ....42.6 (8 #####..########### ... #.....##. #.#..### ## PP P...ki #......#.. PP. PPP. #..PPP..._. PPP. ..P.  ##..PPPP...PPPPPP...PPP....  #.....PPPPPP......PPPPPP..ki˹  #.P....PPP......PPP...PPP. kiki*3.6 (9ki8_kiv _Found a robe.kiHki;ki|kiBki&kikiRkiki kinkikikikikiGkikiEkiki6ki;kikikikikiBki\  You see here a +0 robe.kifki _kiK ki ki ki ki ki ki ,ki ki ki ki! ki# ki?( ki+ ki], ki. ki3 ki9 ki9 ki< ki@ kiD ki?E ki/H kiM kiP kiQ kiLS ki U kiX ki"Y ki[ kiE_ kie kihe kiog kiQi kil ki=m kin kiq kis kit kiv kix ki!z kiz ki6| ki kiт kia ki0 kiR ki] ,ki ki_ kiE ki kiؐ kiw ki kie ki} ki ki! kiq kiǛ ki{ ki ,ki ki ki^ ki kiϪ ki] ki ki9 kiz ki ki ki ki/ ki ki< ki ki/ ki kir ki ki kij kiT ki ki@ ki ki ki ki ki kif ki ki6 kiD kil ,ki ,ki0 kis ki ki& ki ki ki ki ki ki ki ki8 kiB ki ki4 ki ki ki; ki ki ki ki ki ki ki ki= ki ki kij ,kiZ ki ki  kim ki< ki, ki ki5 ki ki ki ki ki( ki ki ki ki ki ki! ki! kik" ki) kiK+ ki+ ki, ki.3 ki4 kic4 ki5 ki8 ki9 ,ki: kijA kiqB kiB kiC kiG kigH kiH kiPJ kiZ @  There is an open door here.ki'_ kiM`  _kic kiRi ki?l kil kin kit ki&w kiw kiy ki ki kis kix ki kiҋ ki3 ki ki kiѕ ki= ki_ ki ki ki ki kiף kig ki ki ki ki! ki~ kiy ki) kiô ki ki kiط ki$ kix ki; ki ki kiG ki ki ki ki ki) ki ki kie ki ki. F _You reach down and open the door.kiM 3ki ki @  There is an open door here.ki kiZ  _ki5 ki ki ki, ki ki+ ki ki2 ki ki ki ki) ki ki ki ki6 kiG ki ki ki ki ki R  There is a stone staircase leading down here.ki ki  _ki^ ki ki ki ki kiZ ki ki5 ki kib kiv ki ki ki ki ki+ ki ki ki ki ki kiO" ki# kif# kiC$ ki+ ki), kia, ki, ki2 ki3 kiH4 ki4 ki= ki= ki> ki> kiD kiD ki E kiE ki_K kiM ki)N kiN kiV kiX kigY kiZ ki` ki b kizb kiyc kim ki p kiop kiq ki{ ki} ki} ki ki ki ki ki ki> ki kiY kiz ki ki> ki̦ ki ki ki8 ki ki kiK ki kiu ki ki* ki kiY kiݾ ki kiK ki ki ki ki ki ki kiR ki ki. ki ki ki9 ki ki ki ki& ,ki4 kio ki ,kim kiR kif ki ki ki ki kid ki ki*# kiJ& ,ki' kia+ ki0 Bki2 ki5 ki5 ki6 ki9 kiK; ki; ki< ki@ kiA kiB kiJC kiF kiG kiH kiH kiK ki$M ki~M ki]N ki;P kiQ kiCQ kiQ kiT BkibU kiFW kiW ki6X kiX kiZ ki0[ ki[ kiR\ ki^ ki_ ki_ ki` kia kigb kib kic kid kif kitf ki"g kihh ki i ki_i kii kij ki5k ki`k kil kil kiQm kim kiXn kip ki#q kirq kiq kir kis ,kit kit kiu kiu kiAv kiSx @  There is an open door here.kiy kisz  _kiz ki{ kiV| ki| ki| ki0~ ki Bki ki kix ki kiD ki kib kiۙ ki ki[ kiѝ ki ki @  There is an open door here.kiC ki  _kig ki ki~ kiƧ kih ki 8 .....##.....'.#...#...#... #....##.....#.#.#.#.#.#... #....##.....###.#...#.###. .....##.........#####.... .#...##.........#####.... ##...##.....###.#...#.### #....##.....# #.#.#.#.#[ ki u.....## ##.....# #.#.#...###' ......# #...@.############175.6 (132.0) ......# #.....#..........# ......# #.....'..........# ......# #.....#..........# ......# #.....#..........#.. ......# #.....#..........#.. ......# #.....#.......<..# ......# #.....#..........#. ......# #.....############..ki kim ki j _Key pressed, stopping explore.ki ki kiP \ _Unknown command.ki ki ki F _Unknown command.ki Ikis ki kii : _ki, kiV ki ki ki ki ,ki kik kiu ,ki ki ki kiK ki ki ki ki kiJ ki[ ki kiW ki ki. ki0 ki1 ki1 ki46 ki7 ki8 ki[9 ki@ BkiA kiC kihD kiD kiE kiTI kitJ kiJ kiK kiO kiP kiuQ kioR ki2V ki/W ,kiW ki ki? ki@@ kiA kiB kiC kiC kiD kiE kihF kiF kifH kiJ kiKL kiL kiM kiO kiQ kiR kiw   #...#.#.....#....>.......  ##.##.##...##.....#########....  #.#...#...#......# #....  #...#.......#....# #....  ##.###.....##....# #....  #.#.#.....#.....# #....  #...........#...# #....  ##.#.......##...# #.... #.#.......#@...# #....110.0) ######..............## ##.... ...........# #..... ..........# #..... ..........# #..... .....................# #..... .......kiz d[40m..............# #..... .....................# #..... .....................# #.....kix kiG ki ki0 kiF ki Bkiy kiy ki ki` ki ki! ki ki ki ki ki ki ki ki ki] kir  #...#.#.....#....> ##.##.##...##.....######## #.#...#...#......#  #...#.......#....#  ##.###.....##....#  #.#.#.....#.....#  #...........#...#  ##.#.......##...#  #.#...@...#....# 22.6 (5.0)  #######..............## #  #...........# #  #..........# #  #.........# #  #........# #  #.......# #  #.....# kidt [40m#  #.....# #ki)ki *ki*kiQ6ki7ki^;,ki <ki>ki>ki?kiAkia]kiw^ki^kiy`ki`kiakickirdkidkiekin #.## ##.#.## #........# ...# #.....# #........'....... .#.# #.#.#.# #........#....... ##.###.###.######........#######+ #...#...#........................ ..#.#.#...#.#.................... .##.#.##.##.#............ .#.....#.#................ ...#.#.....#....@................31.6 (9 #.##.##...##.....#########.....# #.#...#...#......# #.....'. #...#....# #.....#. ##.###.....##....# #.....##.#.#.....#.....# #.......  #...........#...# #.......  ##.#.......##...# #.....###.#.......#....#iko]7m #.....#ki"uki } _Done exploring. __There is a stone staircase leading down here.ki}kikiki27Iki/?ki@kihFP _ki:_Bki`kibkiLd,kifgkiIikiikikkirXkikiXkiBkiͥkikikiki PPPPP..._.............' P.....#............P..#?># ...######.........P...###' #.........PP...........#. ##.# #..#..P.P......P.#.# #........#..P..P...P...# ..## #........##.P.......P'## #.# #.#...P....P #.## #.......@#.......#9.6 (8 kiiF...# #........'.......+....... .#.# #........#........ ##.######........#######+. #............................... ..#.#.....................#  .##.#.......................>...#  .#..............................#  ...#....>.......................# kikikiki kifkiki1ki"kiRkiM _You can't go down here!kiR~ ki~ ki ki kiT ki : _kiƓ ki ki ,ki kiY ,kiS ki kiC kiҠ ki ki kiD ki ,ki6 kiթ ki7 ki_ ki ki| ki ki ki[ ki kiy kiQ ki 8 #.## ##.#.## #........ ...# #.....# #........' .#.# #.#.#.# #.........##.###.######........#######+ #...#...#.................#.#.#...#.#................... .##.#.##.##.#................... .#.....#.#.......... ...#.#.....#....@.........47 #.##.##...##.....#########.....## #.#...#...#......# ki :' #...#.......#....# # ##.###.....##....# #.....#  #.#.#.....#.....# #.  #...........#...# #.......  ##.#.......##...# #.....##  #.#.......#....# #.....#ki- kiQ ki) c _There is a stone staircase leading down here.kiR!ki"ki(ki-/kih318.6 (1 _ki6kio@ 9  You fly downwards.kivy ..###................j....... .$..$........ ...$.$###..... <.....# .....#kibz.....# ......#....... .##.............@# ........................ ..###............. ..# ... ............... ..# .. ............... ... ...........f... f   Maurice (wand, asleep) ... ............... ... ..#...........# ...You encounter Maurice the Thief. He is wielding a +7 dagger of venom, wearing a+1 cloak of willpower and carrying a wand of roots.ki/  --more--ki7 ki* ki5 = 50.1 (2.5 _ki9 kiI a _There is a stone staircase leading up here.ki Your spells (describe)TypeFailure Level  a + Poisonous VapoursAlchemy/Air1% 1 b - Mercury ArrowConjuration/Alchemy1%2  c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%4  e - Sticky FlameFire/Alchemy1%4 Select a spell to describe [?] help [!]/[I] toggle spell headerski`kieekikl..###....ludeguy the Toxicologist ............Octopode of Gozag Gold: 1251 ....j.......Health: 71/71 ======================== .$..$........Magic: 17/17 ======================== ...$.$###.....AC: 3Str: 13 <.....# .....#EV: 15Int: 20 ......# ......#SH: 0Dex: 21 ........ .......##XL: 10 Next: 83% Place: Dungeon:9 ................@#kifl>Noise: ---------  Time: 10250.1 (0.0) ........................c) +0 dagger (protect) ..###...................Cast: Poisonous Vapours ..# ... ...............Fly ..# .. ............... ..............f...f   Maurice (wand, asleep) ki5mc.................. .....#...........# ... _You can't go down here! _There is a stone staircase leading down here.  You fly downwards.  You encounter Maurice the Thief. He is wielding a +7 dagger of venom, wearing a_+1 cloak of willpower and carrying a wand of roots. _There is a stone staircase leading up here.kiskiTtkiyki{ki_  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiH ki ki|  _You can't see any susceptible monsters within range! (Use Z to cast anyway.)kit .........j .. $..$.....$.$###..#..# .....# #.## .....# .#...#.. .##.......<#..............### .# ... # .. . .f ....# ..###  ### kiZG1.1 (1 _kiki>ki ...........ludeguy the Toxicologist ...j.........Octopode of Gozag Gold: 1251 $..$...........Health: 71/71 ======================== ..$.$###.......#Magic: 15/17 =====================--- kij".....# .....# #.##AC: 3Str: 13 .....# ......# #...#.EV: 15Int: 20 ....... .......###......SH: 0Dex: 21 ...............<#.......XL: 10 Next: 83% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10251.1 (0.0) .###.............*......c) +0 dagger (protect) .# ... .........*......Cast: Poisonous Vapours .# .. ..........*.....Fly .............f.... .................#f  kij# Maurice (wand, weak) ....#...........## ..##.........## ..Aiming: Mercury Arrow (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (asleep, chance to weaken: 88%)  You feel a surge of power! The glob of mercury hits Maurice!  Maurice looks weaker.ki< ...fPress: ? - help, Shift-Dir - straight line  Aim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (asleep, chance to weaken: 88%)  You feel a surge of power! The glob of mercury hits Maurice!  Maurice looks weaker.  Maurice is moderately wounded.kiO####*####ki\  Maurice zaps a wand. The roots erupt in riotous growth!kiekiq <#..@....  The roots grab you!The grasping roots constrict you.kir 669-kis  5  =======2.1 (1Constr kiz ki} 9 _You hear an angry buzzing noise. x2kikib Your spells (describe)TypeFailure Level a - Poisonous VapoursAlchemy/Airki1%1  b + Mercury ArrowConjuration/Alchemy 1% 2 c - Mephitic CloudConjuration/Alchemy/Air 1%3  d - Olgreb's Toxic RadianceAlchemy1%kiL4  e - Sticky FlameFire/Alchemy1%ki&4 Select a spell to describe [?] help [!]/[I] toggle spell headerskiC kiHK=...........ludeguy the Toxicologist ...j.........Octopode of Gozag Gold: 1251 $..$...........Health: 69/71 =======================- ..$.$###.......#Magic: 15/17 =====================--- .....# .....# #.##AC: 3Str: 13 .....# ......# #...#.EV:  5 Int: 20 ....... .......###......SH: 0Dex: 21 ...............<#.......kiL_XL: 10 Next: 83% Place: Dungeon:9 ................@.......Noise: =======--  Time: 10252.1 (0.0) .###....................c) +0 dagger (protect) .# ... ................Cast: Poisonous Vapours .# .. ................Fly Constr .............f.... .................#f   Maurice (wand, weak) ....#...........## ..##.........## ..kiLNMaurice looks weaker.  Maurice is moderately wounded.Maurice zaps a wand. The roots erupt in riotous growth!  The roots grab you!The grasping roots constrict you. _You hear an angry buzzing noise. x2kiSkiTkiYki[ki  Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.kiA........... ludeguy the Toxicologist ...j....... ..  Octopode of Gozag Gold: 1251 $..$........ ...  Health: 69/71 =======================- ..$.$###..... ..#  Magic: 12/17 ================-------- .....# .....# #.##  AC: 3Str: 13 .....# ......# #...#.  EV:  5 Int: 20 ....... .......###......  SH: 0Dex: 21 ...............<#.......  XL: 10 Next: 83% Place: Dungeon:9 ................@.......  Noise: =======--  Time: 10252.1 (0.0) kiA\.###.............*......  c) +0 dagger (protect) .# ... .........*......  Cast: Poisonous Vapours .# .. ..........***...  Fly Constr .. ..........*f*... .. ..........***..#  f   Maurice (wand, weak) .. ..#...........## .. ##.........## ..Casting: Mercury Arrow (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (moderately wounded, weak, chance to affect: 77%)ki?...........ludeguy the Toxicologist ...j.........Octopode of Gozag Gold: 1251 $..$...........Health: 69/71 =======================- ..$.$###.......#Magic: 12/17 ================-------- .....# .....# #.##AC: 3Str: 13 .....# ......# #...#.EV:  5 Int: 20 ....... .......###......SH: 0Dex: 21 ...............<#.......XL: 10 Next: 83% Place: Dungeon:9 ................@.......Noise: =======--  Time: 10252.1 (0.0) .###.............*..ki@....c) +0 dagger (protect) .# ... .........*......Cast: Poisonous Vapours .# .. ..........###...Fly Constr ............###... ............###..#f   Maurice (wand, weak) ....#...........## ..##.........## ..Aiming: Mephitic Cloud (safe; 1% risk of failure)  Press: ? - help, Shift-Dir - straight lineAim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (moderately wounded, weak, chance to affect: 77%)  You feel a surge of power!  The flask of dizzying concoctions shatters into a vile cloud!kiki>f§Press: ? - help, Shift-Dir - straight line  Aim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (moderately wounded, weak, chance to affect: 77%)  You feel a surge of power!  The flask of dizzying concoctions shatters into a vile cloud!  Maurice is moderately wounded.ki%% ..§§§§§○§§fd, confused, weak)Maurice is engulfed in noxious fumes. Maurice appears confused.ki&6-======-3.1 (1Poisonous Vapourski+ki-7 _The grasping roots constrict you.ki...........ludeguy the Toxicologist ...j.........Octopode of Gozag Gold: 1251 $..$...........Health: 66/71 ======================-- ..$.$###.......#Magic: 10/17 ==============---------- .....# .....# #.##AC: 3Str: 13 .....# ......# #...#.EV:  5 kiEInt: 20 ....... .......###......SH: 0Dex: 21 ...............<#.......XL: 10 Next: 83% Place: Dungeon:9 ................@.......Noise: ======---  Time: 10253.1 (0.0) .###.............*......c) +0 dagger (protect) .# ... .........*......Cast: Poisonous Vapours .# .. ..........f§§...Fly Constr ..ki..........§§§... ............○§§..#f   Maurice (wand, confused, weak) ....#...........## ..##.........## ..Press: ? - help, Shift-Dir - straight lineAim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (moderately wounded, confused, weak, chance to  weaken: 88%)  You feel a surge of power! The glob of mercury hits Maurice!!  ki!Maurice looks even weaker.ki?f.  Aim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (moderately wounded, confused, weak, chance to  weaken: 88%)  You feel a surge of power! The glob of mercury hits Maurice!!  Maurice looks even weaker.  Maurice is heavily wounded.ki .  Maurice laughs at nothing.The grasping roots constrict you.ki: 5-15 ==----4.1 (1kihkiE _The roots around you sink back into the ground. ki"!........... ludeguy the Toxicologist ...j....... ..  Octopode of Gozag Gold: 1251 $..$........ ...  Health: 65/71 =====================--- ..$.$###..... ..#  Magic: 9/17============------------ .....# .....# #.##  AC: 3Str: 13 .....# ......# #...#.  EV: 15Int: 20 ....... .......###......  SH: 0Dex: 21 ...............<#.......  XL: 10 Next: 83% Place: Dungeon:9  ki:"................@.......  Noise: ==-------  Time: 10254.1 (0.0) .###..............f.....  c) +0 dagger (protect) .# ... ................  Cast: Poisonous Vapours .# .. ...........§§...  Fly .. ..........§§§... .. ..........○§§..#  f   Maurice (wand, confused, weak) .. ..#...........## .. ##.........## ..Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (heavily wounded, confused, weak)  You feel a surge of power! Poisonous fumes billow around Maurice! kin+.. .. $..$........ ... $.$###..... ..#  .....# #.##  ......# #...#.  .......###...... ......<#....... ........ ........  ... .........  .. ..... ki],N§...  ..........§☼§... ..........°§§..# poisoned, we…) ..#...........## ##.........## ki,`6=-5.1 (1 ki1 ki5*  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (heavily wounded, confused, weak)  You feel a surge of power! Poisonous fumes billow around Maurice! _Maurice is poisoned. kiOd........... ludeguy the Toxicologist ...j....... ..  Octopode of Gozag Gold: 1251 $..$........ ...  Health: 66/71 ======================-- ..$.$###..... ..#  Magic: 8/17 kie;===========------------- .....# .....# #.##  AC: 3Str: 13 .....# ......# #...#.  EV: 15Int: 20 ....... .......###......  SH: 0Dex: 21 ...............<#.......  XL: 10 Next: 83% Place: Dungeon:9 ................@.f.....  Noise: =--------  Time: 10255.1 (0.0) .###....................  c) +0 dagger (protect) .# ... ................  Cast: Poisonous Vapours  kie;.# .. ...........§§...  Fly .. ..........§☼§... .. ..........°§§..#  f   Maurice (wand, confused, poisoned, we…).. ..#...........## .. ##.........## ..Confirm with . or Enter, or press ? or * to list all spells.Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move targetAim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (heavily wounded, confused, poisoned, weak)  You feel a surge of power! Poisonous fumes billow around Maurice! kiwo.. .. $..$........ ... $.$###..... ..#  .....# #.##  ......# #...#.  .......###...... ......<#....... ........ ........  ... .........  .. ..... ki9pX§...  ..........§☼§... ...........§§..#  very poison ..#...........## ##.........## kip*6.1 (1 kiw kioz=  Aiming: Poisonous Vapours (safe; 1% risk of failure)  Press: ? - help, Dir - move target  Aim: Maurice, wielding a +7 dagger of venom, wearing a +1 cloak of willpower  and carrying a wand of roots (heavily wounded, confused, poisoned, weak)  You feel a surge of power! Poisonous fumes billow around Maurice! _Maurice looks even sicker. kim j....... ... ..$.. ... $.$###..... ..# # .....# #.## .# ......# #...#. .###.<#.f. ###. # ... . # .. .§§. .§☼§...# .§§..# ..   ki ○ Maurice closely misses you. Maurice bites you.  You feel your power leaking away. ki5-7--7 ki kizZ _Maurice drains your magic. ki`$ _Maurice drains your magic.puncture  Your weapon exudes an aura of protection.  You grab Maurice. You squeeze Maurice!  Maurice is almost dead.  You constrict Maurice. kiB☼ ki1251 --10 6949 (0.8Poisonous Vapours kiJ ki]G _You kill Maurice! kiI / j. .... $.. .... $.$###..... ..# .# .....# #.## .# ......# ##...#. .......###.<#...  ... .  .. .☼§....# .§○§...# ... ..# #  ki> A°☼ ki b6=-8.9 (1.0 kiΣ  kiu ○☼°☼You now have 1272 gold pieces (gained 21).  c - a wand of roots (11) (gained 7 charges)  Things that are here: ki& a72-9.9 (2 ki  kiݻ _a +7 dagger of venom; a +1 cloak of willpower ki. ..j. .....$.. .... .$.$###..... ..# ..# .....# #.## ...# ......# ##...#.... .......###..<#.). ki?#. # ... ..j. # .. .○§....# . .☼°☼...## . .☼§..##j   gnoll (wandering) . ..#.## . ##.## . kiOK.j ki/y ki .○☼y   killer bee (wandering)j   gnoll ki> 3 60.9 (1 ki ki [ _You encounter a killer bee. ki+..j....... .... $..$.. .....$.$###..... ..# ..# .....# #.## .. kiPv.# ......# ##...#.... .###..<#..). .###. .# ... ...j. .# .. ..y.○§....# .. .☼.☼... ki5## .. .○☼..## .. ..#.## .. ## kiR.##. kiA.y kiF.j ki}G.y kie°○.○ ki]7=1 kiծ ki ki"  j....... .... ..$.. .... $.$###..... ..# . # .....# #.## .. # ......# ##...#...  .###. <#. ). ###. # ... ....j.  ki# ^# .. .°§....#  ....y.....○.○...## .○☼..##  ..#.##   ki$ 2y. ki' 8j. ki.( 2y. ki 1 =°○ ki1 %2 ki7  ki9 ki j. .... $.. .... $.$###..... ..# . # .....# #.## .. # ......# ##...#...  .......###. <#. . .j.  ... .  .. .°§....#  ..y.○.○...## .°○..## j   gnoll ..#.## # kiK.jki%1ykiP/yki}@.☼.°.°yy 2 killer bees (wandering)j   gnollki:Z8==3ki kie t _You encounter a killer bee. x2  Things that are here:ki _a +7 dagger of venom; a +1 cloak of willpowerkikiWield or unwield which item (- for none)?- - Tentacles Inventory Items Hand Weapons (go to first with ))  c - a +0 dagger of protection (weapon)  b - a +0 dagger of draining  k - the +6 spear of Immorality {vamp, ^Drain rF- rCorr Dex+7} kijX o - a +0 dagger of speed Floor Items ([,] to select) Hand Weapons a +7 dagger of venom[?] describe selected [!] equip|wield|wear|put on[tab] equip|unequip kiQkiki0.........ludeguy the Toxicologist .j...........Octopode of Gozag Gold: 1272 .$............Health: 67/71 ======================-- $.$###.......# .Magic: 8/17===========------------- ...# .....# #.## ..AC: 3Str: 13 ...# ......# ##...#...EV: 16Int: 20 ..... .......###........SH: 0Dex: 21 .............<#.........XL: 10 Next: 94% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10263.9 (0.0) ##..........kie[33mj...........c) +0 dagger (protect)... ..................Cast: Poisonous Vapours.. ...y........☼....#Fly ...y......°.°...##...........°○..##yy 2 killer bees (wandering)..#...........##j   gnoll##.........##Things that are here: _a +7 dagger of venom; a +1 cloak of willpower _You encounter a killer bee. _You encounter a killer bee. x2  Things that are here: _a +7 dagger of venom; a +1 cloak of willpowerki .yYou unwield your +0 dagger of protection.  Your +0 dagger of protection goes still.  Your +7 dagger of venom begins to drip with poison!ki1y.kiK.jkio1ykiFx yp - a +7 dagger of venom (weapon)ki-ykiF.ykiTG.yki .°yyyyy 5 killer bees (4 wandering)kim 84.9 (1p) +7venom) Poisonous Vapourski7ki^ _You encounter a killer bee. x2kiZ  Casting: Poisonous Vapours (safe; 1% risk of failure)  Confirm with . or Enter, or press ? or * to list all spells.ki.........# .#.## .....# ##...#.......###............<#................@...........j................................☼....#.y....°.°...##..y......°..##yyyypoisoned)...........## (poisoned)#.........## feel a surge of power! You begin to radiate toxic energy.  The killer bee buzzes angrily.  The killer bee is poisoned. x3  The killer bee buzzes angrily.  The killer bee is poisoned.  The killer bee buzzes angrily.ki|W .........# .#.## .....# ##...#.......###............<#................@...........j................................☼....#.y....°.°...##..y......°..##...........###.........##ki_^ y.  The killer bee is poisoned. The gnoll is poisoned.  The killer bee looks even sicker. x2; The gnoll looks even sicker.ki^ 6y.kix_ 9y.ki_ 1y.ki*` 8y.ki` :j.ki*a 7y.kia 6y.kiPb 6y.kib 9y.kib 6y.kivk ○...3 poisoned, 2 very …)very poisoned)kiul 4------===5Toxic Fly ki2r kis 6 _You hear an angry buzzing noise.ki. ..j. .....$.. .... .$.$###..... ..# .ki5.# .....# #.## ...# ......# ##...#.... .......###..<#.kiO.y..j@[.#.y. # ... .....y.y. # .. .y....○....# . .## . .°..## . ..#.## . ##.## .ki> $The killer bee looks even sicker. x2ki? $You kill the killer bee!The gnoll looks even sicker.  Your toxic aura wanes.ki}.y.ykis9y.ki .yYou kill the killer bee!y.kiŹU. 3 killer bees (1 poisoned, 2 very poki& 59---------7-6Fly  _The gnoll closely misses you. The killer bee stings you!kikim _Your Short Blades skill increases to level 5!ki l $You puncture the gnoll!ki 2$ki =.yki ° 2 killer bees (1 poisoned, 1 very poi  You kill the gnoll! You kill the killer bee!kiT 60=--9--7.7 (0.8ki ki\ X _The killer bee closely misses you.ki  $You miss the killer bee. You grab the killer bee.  The killer bee is almost dead.You constrict the killer bee.ki yYou kill the killer bee!The killer bee barely misses you.ki( w )  You encounter a killer bee.ki) kiH2 ..........ludeguy the Toxicologist ..j...........Octopode of Gozag Gold: 1272 ..$............Health: 60/71 ====================---- .$.$###.....ki3 ..# .Magic: 4/17=====------------------- ....# .....# #.## ..AC: 3Str: 13 ....# ......# ##...#...EV: 16Int: 20 ...... .......###........SH: 0Dex: 21 ..............<#.........XL: 10 Next: 100% Place: Dungeon:9 ...............$@[.......ki(4 Noise: =--------  Time: 10268.4 (0.7) ###.........$.$y.........p) +7 dagger (venom) # ... ..y...............Cast: Poisonous Vapours # .. .......$....°....#Fly .................## ................##yy 2 killer bees (1 poisoned) ...#...........## .##.........## .You miss the killer bee. You grab the killer bee.  The killer bee is almost dead.You constrict the killer bee.  You kill the killer bee!The killer bee barely misses you.ki4 EYou encounter a killer bee.ki5 _The killer bee closely misses you.You have reached level 11!ki,@ /  --more--ki @3/7581 0% kiP kie 4 _kiY} $You puncture the killer bee!ki([A.yki{c_.   killer beekigj9.2 (0.8Poisonous VapourskinkiqN _You kill the killer bee!ki ##.... . .j. .... ....... .... $.$###..... ..# . # .....# #.## .. # ......# ##...#...  .......## ....<#.@. .....$.[ #.........$.$$  ... ...y.....  .. .$ . .... ..#.. ##.........##y.ki Uyy(unaware, dazed)ki =4-70.2 (1.0ki ki P _The killer bee is distracted by your dazzling golden aura.ki............. .j.... $..... $.$###.....# . kiW...# .....# #.## .....# ##...#.... .......###.............<#......$ ##y$.$$..  ... ......... $# .#ki## # ## ki8 kiG  The killer bee is no longer dazed.kioc5=-1kiki# I _The killer bee is distracted by your dazzling golden aura.ki { _You see here a +1 cloak of willpower.kiI. .... ..j. .....$.. .... .$.$###..... ..# ..# .....# #.## ...# ......# ##...#.... .......###..<#..$@[.#.y$.$$. # ... . # .. .$.# . .## . .## . ..#.## . ##.## .kikim:12722 _kiZkiki. .....j....... .... $..$.. .....$.$###..... ..# ..# .....# #.## ...# ......# ##...#.... .###..<#.ki<.@.[. .###.y$.$$. .# ... . .# .. .$.# .. .## .. .## .. .#.## .. ##.##.ki kiY -53ki kir $  Things that are here:ki P _11 gold pieces; a +0 flailki e . .....j.. .... .$..$. .....$.$###..... ..# . <.....# .....# #.## ...# ......# ##...#...kizf . .###..<#.$.[. ..###.y$.$$. ..# ... . ..# .. .$.#. .##. .##. ..#.##..###.##.kin kio H4Poisonous Vapours _kiv kix ki ). .....j.. .... $.$..$.. .....$.$###..... ..# . .<.....# #.....# #.## ...# #......## ##...#.....###...<#..$.[..###.y$.$$..# .....# ...$.#...##..##..#.##..###.##.kikiTA=5kikiki j... .$.$..$......... .... ki;.....$.$###..... ..# .<.....# #.....## #.## .. ........###......## ##...#........###.........<#....$.[.###y@.$$...# .....kiO..# $#.. .#..#.##. ##kiEyyki_[6==6kiki^v _The killer bee is no longer dazed. The killer bee barely misses you. x2kiQ _You see here 4 gold pieces.kix#  You barely miss the killer bee. Your grab misses the killer bee.The killer bee barely misses you.ki*$c6==7.0 (0.8ki$+ki7(very poisoned)  You barely miss the killer bee. Your grab misses the killer bee.  The killer bee barely misses you.stings you but does no damage.  You hit the killer bee. The killer bee is poisoned.r grab misses the killer bee. Your squeeze misses the killer bee.The killer bee is lightly wounded.ki@8*7 (0.7ki>ki;M_  You closely miss the killer bee. You grab the killer bee.  You constrict the killer bee. The killer bee misses you.The killer bee stings you.  You are poisoned.kiM4=-8.5 (0.8Pois Fly kiiUkijB $ ki4k\_The killer bee poisons you!  You puncture the killer bee!kisi   You kill the killer bee!kiWz 1272 -==19.3Poisonous Vapours _You feel sick.kimkiԉ  Your Stealth skill increases to level 8!You now have 1276 gold pieces (gained 4).kiW63-80.3 (1ki{kiQ$ _You feel sick.kiJ#......j. .... ..$.$..$.......... .....$.$###...... ..# ..<.....# #.....## #.## ...###......## ##...#....###.. ki##.<#. #.$.[. #....###.@..$$..# ..# .$.#..##....##..#..##..###.##. ...# ##.# #....ki<ki2=--10kiki d _You feel sick.  You now have 1281 gold pieces (gained 5).ki >81-ki #2.3 (2kikim$ _You feel sick.kin......j. .... $.$..$.......... .... $.$###...... ..# . <.....# #.....## #.## .. ###......## ##...#... ###.. .ki!<#. .$.[. ....###.$$. # . # .$.#  .##  ...## .....#..## ....###.## ...# ##.# ....ki 17=3.3 (1ki.ki$ _You feel sick.kiWj. .... $.$..$.......... .... $.$###...... ..# . <.....# #.....## #.## .. ###......## ##...#... ###. <#. $.[. ###.$$. # . # .$.#  .##  ..## .....#.kiV## ....###.## ...# ##.# kiK3  You feel sick.ki͟0=4Fly kizq _You are no longer poisoned.ki j. .... .$..$.. .... $.$###...... ..# . <.....# #.....## #.## .. ###......## ##...#... ###. <#. ki݊ >$.[. ###.. # . # .$.#  .##  .## .....#.## ....###.## ...# ki ki1 -15kiu kib ki- F76.3 (2ki kiD ? _You now have 1287 gold pieces (gained 6).ki[ j. .... $..$... .... $.$###...... ..# . .....# #.....## #.## .. ###......## ##...#... ###.ki  <#. $.[. ###.. # . # .$.#  .##  .## .....#.## ....  ki ki F=7.3 (1ki ki ki O9328.3 (2ki ki ? _You now have 1293 gold pieces (gained 6). ki j. .... ..$... .... $.$###...... ..# . # #.....## #.## .. ###......## ##...#... ###. <#. $.[. ###. # . # .$.#  .##  .## .....  ki ki`]8=9.3 (1 kiE ki ki)1 gM.  ....j... .....$............. $.$###...... ..#  ## #.##  ki2 =##### ##...####<#.. ...$@[##... #$. . ...................####.......## kib9  ki9 &90 ki>  ki@ !kix. .....j......... .... $..$.... .....$.$###...... ..# ..# #.....## #.## ...###......## ##...#....###..<#..@.[. .###. .# . .# .$.# .. .## .. !kiAg.## .. .#.## .. ....###.## .. ...# ##.##!ki!ki4%1!kiν!ki  You now have 1304 gold pieces (gained 11).3043=2.3 (2!ki!kiT. _You see here a +0 flail."kiij... .$..$.... .... ...$.$###...... ..# . "kiY<.....# #.....## #.## ...###......## ##...#........###.........<...).[.###."ki. ..# . ..# $"kiX# ... .#"ki |. . .....#"kiW. ....###. ...# ##"ki"ki*1304"ki<<=3.3 (1"ki6"ki-#kiyL $..$. ...$.$###..# . <.....# ## #.## . .#.## ##...#.....###.....<#..).[###...  $#..### ##...#.##.#ki΁#ki*%4#ki#ki.#kiA ..$.$#### . <.....# ## #.## . .#.## ##...#.....###.....<#..).[###...  #ki#..### ### ...#####ki#kiQ4=9#ki8==5#ki#kif#ki3116.3 (2#ki0#ki? _You now have 1311 gold pieces (gained 7).#kiT <.....# ## #.## . .#.## ##...#.....###.....<#..).[###...  #.### ### .Fly .... #.#ki#ki *7.3 (1#ki%#ki'#ki PM...$.$##. ..# < ## #.## ##### ##...####<#.....).[##..#..##..##..#..## ... ....###.........##....#ki`V#kiV-58#ki[#ki\#kiC M$..$...... ...$.$##. ..# #kiC < ## #.## ##### ##...####<#.....).[##..#..##.#kiC .## ... .....#...........##...#####kiH #kiH A==9#kibM #kiN #kie M...j $..$........ ...$.$##. ..# < ## #.## ##### ##...####<#.....).[##..#..## ... ..................####...#.###kim #kikm '300#kiq #kis $kiPM.  .... ....j. .. .$..$............. ...$.$##. ..# < $kiPu## #.## ##### ##...####<#.....).[##..#. ... ...................#####.......##$ki Y$kiYS6=1$kiL`$kia$ki M###....  .  .... ....j.. . .$..$............ ...$.$##. ..# < ## #.## ##### ##...####.....#.........).[##.. ..# ....................#.###.........##$ki$kigY10/18=2$ki$kira _There is a stone staircase leading up here.$kiq$kiٲ$ki]$ki$ki@a _There is a stone staircase leading up here.$ki $ki| $ki $ki $ki ,$kiڌ $kib #7$ki 2=$kiˏ $ki# $ki~ $ki $kik $ki 9=$kiӘ $ki $ki %8$ki $ki $ki^ 71=$ki $ki% $ki' $ki $kiL $ki $ki #9$ki. (=$ki٪ $ki $kiH $ki~ $kiʱ $ki1 9=$ki $kiU $kiԶ V70=$ki $ki $ki N2==$ki_ $ki_ $ki $ki $ki $ki $ki= $ki $ki %1$ki $kiU $ki :==$ki $ki $kiU $kiA $kiy $ki {2=3=$ki $ki= ,$kiR $ki $ki $kid $ki $ki U3=$ki $kiO {=$ki $ki $ki $kiU %4$ki $kiH $ki K4=$ki $ki $ki $ki $ki k _You start resting.HP restored.$ki $kie 028.3 (26.0)$ki #5$ki ==9.3 (27 _$ki $kiO %ki@&3%ki 1%ki@5%ki9,%ki9=%ki=9=%ki?%kiB%kiC%ki=E%kiG%kiH#=%kiDHE5==%kiYJ%kiL%kiAM%kiO%ki_Q%kiQ%kiWS%kiU,%kiV%kiXX%kiX3==%kiY%ki\%kiS\%ki:^%ki`%ki`56=%ki`%ki0b%kird,%ki`e%kif%kif%kih%kii%kiTi%kiQk%kim%kim9=%kin%kip%kigp%ki&q%kira7=%kis%kiu%kiOu%kiv%kix%kiy%kiz%kiY}%ki}%kiH%ki%ki9=%ki%ki<%kit%ki %ki8%kiq%ki%kidn _You start resting.Magic restored.%kit%ki-51.3 (22%kiԞ68==%ki+2.3 (23 _%kiԢ%ki%ki%ki%ki*%kiͽ,%kiC,%ki%ki,%ki %ki%ki%ki%ki%ki%ki%......  .......)....... ..# ....................# ...............  #..............  #.....................? .... ##......j......# ....$.$..$%ki0....# ....$.$###...@..# ..# .5.3 (3.0)<.....# #.....## #.## ..........###......## ##...#...%ki\~..........###........ ##....<#......... %ki #....).[....... ##....###%kiN..........# ...........%kiY...# ...........#%ki%kiG==6.3 (4%ki2%kio' _Found a hand axe.%ki+ 3%ki, %ki: %ki> ,%kiB %kiAE %kiG %ki6H %kiiJ %kiNM %kiZ  ..###....>....# ....#  .. .... .......) ...# . ...# ...... %kic[ ###....... .......?...... 8.3 (2.j............#....... $.$..$...........## ..... $.$###......## ..# . .<.....# #.....## #.## .. .......###......## ##...#... %ki[ Q...........###....%ki[ Q..<#......%ki[ e).[%kid %kid *9.3 (3%kil %kiQo 9 _Found an escape hatch in the floor.'kiY..###....>....#....#.# . .).# .# .###.?...... j...#. .$..$...## ...... $.$###......## ...# . <.....# #.....## #.## ..###......## ##...#...'kiՉ...###......... 'ki'kih+60.3 (1'ki'kix'kih :..###....>....## ....#.# .# .).# . .# . .###.?...... j.'ki^i |#. $..$.###...... $.$###......## #...#. . .....# #.....## ####......## ##...#......###............<#.......'kii 6.. 'kio 'kio %1'kiu 'ki+w (kiyp..###....>....## ....#.##  .# .).# # . # . ###.?...... j.#. ..$.###.$.$###......## #...#... (ki{Q# #.....## #.## ..###......## ##...#.......###.............<#......... (kiӃ(ki%2(kiJ(kiM(ki}..###....>....## ....#.##  .##  .).#  .#  ...j.#.$..###. $.$###......## ##...#... # #.....## #.## ..(ki~C###......## ##...#.......###........<#......... (ki(ki%3(ki(ki(ki*4.3 (2(ki(kiá: _i - 5 scrolls of identify (gained 1)(kiC 5..###....>....## ....#.##  .##  .).##  .#.#. j.#. $...###. (kimD e.$###......## ##...#.# #.....## ##.## .###......## ##...#...###.........<#......... (kiM (kiM *5.3 (1(kiS (kiU )ki*)ki@VRead which item? Scrolls  t - 2 scrolls of teleportation  a - 3 scrolls of enchant armouri - 5 scrolls of identify  x - a scroll of amnesia  W - a scroll of brand weapon )kike p - a scroll of poison  V - 2 scrolls of vulnerability  c - a scroll labelled CUEPRO YTRIV [!] read|quaff|evoke[?] describe selected*kiد*ki0*kiludeguy the Toxicologist..###....>....##Octopode of Gozag Gold: 1311....#...........##Health: 75/75 ========================..................##Magic: 18/18 ========================.......)............##AC: 3Str: 13  .....................##EV: 16Int: 20  ......................#SH: 0Dex: 21 #.......................XL: 11 Next:  1% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10365.3 (0.0) j............#..........p) +7 dagger (venom) $...........###.........Cast: Poisonous Vapours .$###......## ##...#....Fly *ki$[34m..# #.....## ##.## ... ..###......## ##...#.... ............###......... ............<#......... .............).[....... _HP restored. _You start resting. _Magic restored. _Found a hand axe. _Found an escape hatch in the floor. _i - 5 scrolls of identify (gained 1)Identify which item? (\ to view known items) Scrolls (select first with ?)  c - a scroll labelled CUEPRO YTRIV Potions (select first with !)  d - 2 silvery potions  k - a sapphire potion  n - 2 bubbling amethyst potions  p - 3 glowing amethyst potions[?] describe selected+ki-+ki.+ki{6ludeguy the Toxicologist..###....>....##Octopode of Gozag Gold: 1311....#...........##Health: 75/75 ========================..................##Magic: 18/18 ========================.......)............##+ki-7#AC: 3Str: 13  .....................##EV: 16Int: 20  ......................#SH: 0Dex: 21 #.......................XL: 11 Next:  1% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10365.3 (0.0) +ki\7j............#..........p) +7 dagger (venom) $...........###.........+ki7Cast: Poisonous Vapours .$###......## ##...#....Fly +ki7..# #.....## ##.## ... +ki7..###......## ##...#.... ............###......... +ki7[............<#......... +ki7.............).[....... _HP restored. +ki8O_You start resting. _Magic restored. +ki68g_Found a hand axe. _Found an escape hatch in the floor. _i - 5 scrolls of identify (gained 1)+kiE]  As you read the scroll of identify, it crumbles to dust.+kiWF*6.3 (1+kiL+kiNX _c -> g - a scroll of fog1ki1kifsRead which item? Scrolls 1ki- g - a scroll of fog  t - 2 scrolls of teleportation  a - 3 scrolls of enchant armouri - 4 scrolls of identify  x - a scroll of amnesia  W - a scroll of brand weapon  p - a scroll of poison 1ki V - 2 scrolls of vulnerability [!] read|quaff|evoke1ki%G[?] describe selected2ki2ki*)2ki(1ludeguy the Toxicologist..###....>....##Octopode of Gozag Gold: 1311....#...........##Health: 75/75 ========================..................##Magic: 18/18 ========================.......)............##AC: 3Str: 13  .....................##EV: 16Int: 20  ......................#SH: 0Dex: 21 #.......................XL: 11 Next:  1% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10366.3 (0.0) 2ki1j............#..........p) +7 dagger (venom) $...........###.........Cast: Poisonous Vapours .$###......## ##...#....Fly 2ki1$..# #.....## ##.## ... ..###......## ##...#.... 2ki2............###......... ............<#......... 2ki\2k.............).[....... 2ki2D_Magic restored. _Found a hand axe. 2ki2V_Found an escape hatch in the floor. _i - 5 scrolls of identify (gained 1)  2ki2>As you read the scroll of identify, it crumbles to dust. 2ki2C_c -> g - a scroll of fog2ki52ki9Identify which item? (\ to view known items) Potions (select first with !)  d - 2 silvery potions 2kiM9T k - a sapphire potion  n - 2 bubbling amethyst potions 2kim9 p - 3 glowing amethyst potions[?] describe selected4ki4kiՉ4kiTludeguy the Toxicologist..###....>....##Octopode of Gozag Gold: 1311....#...........##Health: 75/75 ========================..................##Magic: 18/18 ========================.......)............##AC: 3Str: 13  .....................##EV: 16Int: 20  ......................#SH: 0Dex: 21 4ki#.......................XL: 11 Next:  1% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10366.3 (0.0) j............#..........p) +7 dagger (venom) $...........###.........Cast: Poisonous Vapours .$###......## ##...#....Fly ..# #.....## ##.## ... ..###......## ##...#.... ............###......... ............<#......... .............).[....... _Magic restored. _Found a hand axe. _Found an escape hatch in the floor. _i - 5 scrolls of identify (gained 1)  4kiْAs you read the scroll of identify, it crumbles to dust. _c -> g - a scroll of fog4kiU]  As you read the scroll of identify, it crumbles to dust.4kiӯ*7.3 (14ki4kij3 _k -> a - a potion of ambrosia4ki 4kir sRead which item? Scrolls 4ki  g - a scroll of fog  t - 2 scrolls of teleportation  a - 3 scrolls of enchant armouri - 3 scrolls of identify  x - a scroll of amnesia  4ki mW - a scroll of brand weapon  p - a scroll of poison  V - 2 scrolls of vulnerability 4ki [!] read|quaff|evoke[?] describe selected6kiJ ludeguy the Toxicologist..###....>....##Octopode of Gozag Gold: 1311....#...........##Health: 75/75 ========================..................##Magic: 18/18 ========================.......)............##AC: 3Str: 13  .....................##EV: 16Int: 20  ......................#SH: 0Dex: 21 #.......................XL: 11 Next:  1% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10367.3 (0.0) j............#..........p) +7 dagger (venom) $...........###.........Cast: Poisonous Vapours .$###......## ##...#....Fly i [13d..# #.....## ##.## ... ..###......## ##...#.... ............###......... ............<#......... .............).[....... _Found an escape hatch in the floor. _i - 5 scrolls of identify (gained 1)  As you read the scroll of identify, it crumbles to dust. _c -> g - a scroll of fogAs you read the scroll of identify, it crumbles to dust. _k -> a - a potion of ambrosiaIdentify which item? (\ to view known items) Potions (select first with !)  d - 2 silvery potions  n - 2 bubbling amethyst potions  p - 3 glowing amethyst potions[?] describe selectedki ki|ludeguy the Toxicologist..###....>....##Octopode of Gozag Gold: 1311....#...........##Health: 75/75 ========================..................##Magic: 18/18 ========================kiU.......)............##AC: 3Str: 13  .....................##EV: 16Int: 20  ......................#SH: 0Dex: 21 #.......................XL: 11 Next:  1% Place: Dungeon:9 ................@.......Noise: ---------  Time: 10367.3 (0.0) j............#..........p) +7 dagger (venom) $...........###.........Cast: Poisonous Vapours ki.$###......## ##...#....Fly ..# #.....## ##.## ... ..###......## ##...#.... ............###......... ............<#......... kiI.............).[....... _Found an escape hatch in the floor. _i - 5 scrolls of identify (gained 1)  As you read the scroll of identify, it crumbles to dust. _c -> g - a scroll of fogkirAs you read the scroll of identify, it crumbles to dust. _k -> a - a potion of ambrosiakiP  Okay, then.kiDYkiQbD [?25h[?0c [?1051l[?1052l[?1060l[?1061l